


| Basic Information | |
|---|---|
| Family ID | F048322 |
| Family Type | Metagenome |
| Number of Sequences | 148 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Number of Associated Samples | 30 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.30 % |
| % of genes near scaffold ends (potentially truncated) | 32.43 % |
| % of genes from short scaffolds (< 2000 bps) | 61.49 % |
| Associated GOLD sequencing projects | 26 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.622 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment (29.054 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.432 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (30.405 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF14332 | DUF4388 | 1.35 |
| PF02275 | CBAH | 1.35 |
| PF14492 | EFG_III | 1.35 |
| PF01850 | PIN | 1.35 |
| PF02730 | AFOR_N | 1.35 |
| PF02321 | OEP | 1.35 |
| PF07927 | HicA_toxin | 1.35 |
| PF11028 | DUF2723 | 1.35 |
| PF13549 | ATP-grasp_5 | 1.35 |
| PF01258 | zf-dskA_traR | 1.35 |
| PF01227 | GTP_cyclohydroI | 1.35 |
| PF07638 | Sigma70_ECF | 1.35 |
| PF03099 | BPL_LplA_LipB | 1.35 |
| PF00781 | DAGK_cat | 1.35 |
| PF02738 | MoCoBD_1 | 0.68 |
| PF00510 | COX3 | 0.68 |
| PF00575 | S1 | 0.68 |
| PF13419 | HAD_2 | 0.68 |
| PF00579 | tRNA-synt_1b | 0.68 |
| PF01979 | Amidohydro_1 | 0.68 |
| PF04209 | HgmA_C | 0.68 |
| PF03461 | TRCF | 0.68 |
| PF03349 | Toluene_X | 0.68 |
| PF00155 | Aminotran_1_2 | 0.68 |
| PF01209 | Ubie_methyltran | 0.68 |
| PF02743 | dCache_1 | 0.68 |
| PF13415 | Kelch_3 | 0.68 |
| PF13840 | ACT_7 | 0.68 |
| PF01590 | GAF | 0.68 |
| PF13668 | Ferritin_2 | 0.68 |
| PF05670 | NFACT-R_1 | 0.68 |
| PF02113 | Peptidase_S13 | 0.68 |
| PF00246 | Peptidase_M14 | 0.68 |
| PF02518 | HATPase_c | 0.68 |
| PF09994 | DUF2235 | 0.68 |
| PF00302 | CAT | 0.68 |
| PF00343 | Phosphorylase | 0.68 |
| PF13847 | Methyltransf_31 | 0.68 |
| PF02579 | Nitro_FeMo-Co | 0.68 |
| PF13183 | Fer4_8 | 0.68 |
| PF01641 | SelR | 0.68 |
| PF02470 | MlaD | 0.68 |
| PF03601 | Cons_hypoth698 | 0.68 |
| PF00271 | Helicase_C | 0.68 |
| PF02782 | FGGY_C | 0.68 |
| PF01612 | DNA_pol_A_exo1 | 0.68 |
| PF09861 | Lar_N | 0.68 |
| PF02915 | Rubrerythrin | 0.68 |
| PF00406 | ADK | 0.68 |
| PF05580 | Peptidase_S55 | 0.68 |
| PF12840 | HTH_20 | 0.68 |
| PF02810 | SEC-C | 0.68 |
| PF03720 | UDPG_MGDP_dh_C | 0.68 |
| PF05103 | DivIVA | 0.68 |
| PF00072 | Response_reg | 0.68 |
| PF13432 | TPR_16 | 0.68 |
| PF00583 | Acetyltransf_1 | 0.68 |
| PF13350 | Y_phosphatase3 | 0.68 |
| PF07228 | SpoIIE | 0.68 |
| PF01138 | RNase_PH | 0.68 |
| PF16868 | NMT1_3 | 0.68 |
| PF00588 | SpoU_methylase | 0.68 |
| PF09335 | SNARE_assoc | 0.68 |
| PF00563 | EAL | 0.68 |
| PF00528 | BPD_transp_1 | 0.68 |
| PF01521 | Fe-S_biosyn | 0.68 |
| PF02225 | PA | 0.68 |
| PF04325 | DUF465 | 0.68 |
| PF13424 | TPR_12 | 0.68 |
| PF02868 | Peptidase_M4_C | 0.68 |
| PF00483 | NTP_transferase | 0.68 |
| PF00326 | Peptidase_S9 | 0.68 |
| PF03949 | Malic_M | 0.68 |
| PF00923 | TAL_FSA | 0.68 |
| PF16257 | UxaE | 0.68 |
| PF00034 | Cytochrom_C | 0.68 |
| PF01475 | FUR | 0.68 |
| PF16811 | TAtT | 0.68 |
| PF01042 | Ribonuc_L-PSP | 0.68 |
| PF00383 | dCMP_cyt_deam_1 | 0.68 |
| PF14237 | GYF_2 | 0.68 |
| PF03060 | NMO | 0.68 |
| PF13701 | DDE_Tnp_1_4 | 0.68 |
| PF13189 | Cytidylate_kin2 | 0.68 |
| PF04264 | YceI | 0.68 |
| PF01212 | Beta_elim_lyase | 0.68 |
| PF07494 | Reg_prop | 0.68 |
| PF00701 | DHDPS | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.70 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 2.70 |
| COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 1.35 |
| COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 1.35 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.35 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 1.35 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.35 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 1.35 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.35 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.35 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.35 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 1.35 |
| COG3049 | Penicillin V acylase or related amidase, Ntn superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.35 |
| COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 1.35 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.68 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.68 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.68 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.68 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.68 |
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.68 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.68 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.68 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.68 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.68 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.68 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.68 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.68 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.68 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.68 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.68 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.68 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.68 |
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.68 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.68 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.68 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG2067 | Long-chain fatty acid transport protein | Lipid transport and metabolism [I] | 0.68 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.68 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.68 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.68 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.68 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.68 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.68 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.68 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.68 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.68 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.68 |
| COG3227 | Zn-dependent metalloprotease (Neutral protease B) | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.68 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.68 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.68 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.68 |
| COG4845 | Chloramphenicol O-acetyltransferase | Defense mechanisms [V] | 0.68 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.68 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.68 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.62 % |
| Unclassified | root | N/A | 28.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002225|JGI24723J26617_10027391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2388 | Open in IMG/M |
| 3300002225|JGI24723J26617_10043087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1667 | Open in IMG/M |
| 3300002225|JGI24723J26617_10047310 | Not Available | 1544 | Open in IMG/M |
| 3300002225|JGI24723J26617_10055981 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300002225|JGI24723J26617_10074690 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300002225|JGI24723J26617_10088541 | Not Available | 947 | Open in IMG/M |
| 3300002225|JGI24723J26617_10121719 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300002225|JGI24723J26617_10122342 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300002225|JGI24723J26617_10168984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300005588|Ga0070728_10195206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM1 | 1139 | Open in IMG/M |
| 3300005588|Ga0070728_10502030 | Not Available | 634 | Open in IMG/M |
| 3300005590|Ga0070727_10425289 | Not Available | 741 | Open in IMG/M |
| 3300005590|Ga0070727_10474371 | Not Available | 699 | Open in IMG/M |
| 3300005590|Ga0070727_10691640 | Not Available | 572 | Open in IMG/M |
| 3300005600|Ga0070726_10699631 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005612|Ga0070723_10454074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 627 | Open in IMG/M |
| 3300005612|Ga0070723_10584016 | Not Available | 559 | Open in IMG/M |
| 3300005612|Ga0070723_10709140 | Not Available | 510 | Open in IMG/M |
| 3300006467|Ga0099972_10322332 | Not Available | 793 | Open in IMG/M |
| 3300006467|Ga0099972_10438288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 677 | Open in IMG/M |
| 3300006467|Ga0099972_10439882 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300006467|Ga0099972_10749254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter | 2079 | Open in IMG/M |
| 3300006467|Ga0099972_11132449 | Not Available | 592 | Open in IMG/M |
| 3300006467|Ga0099972_11974094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2748 | Open in IMG/M |
| 3300006467|Ga0099972_11975645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 2505 | Open in IMG/M |
| 3300006467|Ga0099972_12909242 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300006467|Ga0099972_12995446 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006467|Ga0099972_13045132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2050 | Open in IMG/M |
| 3300006467|Ga0099972_13285326 | Not Available | 525 | Open in IMG/M |
| 3300006467|Ga0099972_13561323 | Not Available | 556 | Open in IMG/M |
| 3300006467|Ga0099972_13561895 | Not Available | 1652 | Open in IMG/M |
| 3300009149|Ga0114918_10294718 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010392|Ga0118731_102647174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 9790 | Open in IMG/M |
| 3300010392|Ga0118731_103225731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6498 | Open in IMG/M |
| 3300010392|Ga0118731_104020081 | All Organisms → cellular organisms → Bacteria | 17143 | Open in IMG/M |
| 3300010392|Ga0118731_105457366 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300010392|Ga0118731_106347004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 6472 | Open in IMG/M |
| 3300010392|Ga0118731_106397077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM2 | 2299 | Open in IMG/M |
| 3300010392|Ga0118731_107251971 | All Organisms → cellular organisms → Bacteria | 17315 | Open in IMG/M |
| 3300010392|Ga0118731_107484544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 12852 | Open in IMG/M |
| 3300010392|Ga0118731_107775452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 34314 | Open in IMG/M |
| 3300010392|Ga0118731_107899361 | All Organisms → cellular organisms → Bacteria | 17769 | Open in IMG/M |
| 3300010392|Ga0118731_108101081 | All Organisms → cellular organisms → Bacteria | 15163 | Open in IMG/M |
| 3300010392|Ga0118731_109939685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3836 | Open in IMG/M |
| 3300010392|Ga0118731_111959517 | All Organisms → cellular organisms → Bacteria | 4546 | Open in IMG/M |
| 3300010392|Ga0118731_112448885 | All Organisms → cellular organisms → Bacteria | 4032 | Open in IMG/M |
| 3300010392|Ga0118731_113487655 | All Organisms → cellular organisms → Bacteria | 3373 | Open in IMG/M |
| 3300010392|Ga0118731_113769819 | All Organisms → cellular organisms → Bacteria | 8823 | Open in IMG/M |
| 3300010392|Ga0118731_113862114 | All Organisms → cellular organisms → Bacteria | 10565 | Open in IMG/M |
| 3300010392|Ga0118731_115385331 | All Organisms → cellular organisms → Bacteria | 23104 | Open in IMG/M |
| 3300010430|Ga0118733_100006357 | All Organisms → cellular organisms → Bacteria | 33354 | Open in IMG/M |
| 3300010430|Ga0118733_100018817 | All Organisms → cellular organisms → Bacteria | 16299 | Open in IMG/M |
| 3300010430|Ga0118733_100022562 | All Organisms → cellular organisms → Bacteria | 14507 | Open in IMG/M |
| 3300010430|Ga0118733_100028182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12563 | Open in IMG/M |
| 3300010430|Ga0118733_100045855 | All Organisms → cellular organisms → Bacteria | 9264 | Open in IMG/M |
| 3300010430|Ga0118733_100127854 | All Organisms → cellular organisms → Bacteria | 5089 | Open in IMG/M |
| 3300010430|Ga0118733_100248247 | All Organisms → cellular organisms → Bacteria | 3519 | Open in IMG/M |
| 3300010430|Ga0118733_100313626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3103 | Open in IMG/M |
| 3300010430|Ga0118733_100336998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfomonile → Desulfomonile tiedjei | 2985 | Open in IMG/M |
| 3300010430|Ga0118733_100522767 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
| 3300010430|Ga0118733_100757947 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300010430|Ga0118733_105660768 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010430|Ga0118733_108260713 | Not Available | 538 | Open in IMG/M |
| 3300013098|Ga0164320_10567506 | Not Available | 586 | Open in IMG/M |
| 3300013099|Ga0164315_10017345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5682 | Open in IMG/M |
| 3300013099|Ga0164315_10229145 | Not Available | 1515 | Open in IMG/M |
| 3300013099|Ga0164315_10257636 | Not Available | 1421 | Open in IMG/M |
| 3300013099|Ga0164315_10439385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300013099|Ga0164315_10626013 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300013099|Ga0164315_10835845 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300013099|Ga0164315_11045147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300013099|Ga0164315_11377746 | Not Available | 555 | Open in IMG/M |
| 3300013099|Ga0164315_11452094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 539 | Open in IMG/M |
| 3300013101|Ga0164313_10000104 | All Organisms → cellular organisms → Bacteria | 53301 | Open in IMG/M |
| 3300013101|Ga0164313_10001937 | All Organisms → cellular organisms → Bacteria | 18578 | Open in IMG/M |
| 3300013101|Ga0164313_10003192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 14634 | Open in IMG/M |
| 3300013101|Ga0164313_10005473 | All Organisms → cellular organisms → Bacteria | 11229 | Open in IMG/M |
| 3300013101|Ga0164313_10008793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 8791 | Open in IMG/M |
| 3300013101|Ga0164313_10008815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8781 | Open in IMG/M |
| 3300013101|Ga0164313_10009521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8432 | Open in IMG/M |
| 3300013101|Ga0164313_10025363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 5029 | Open in IMG/M |
| 3300013101|Ga0164313_10042701 | All Organisms → cellular organisms → Bacteria | 3822 | Open in IMG/M |
| 3300013101|Ga0164313_10052839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM1 | 3420 | Open in IMG/M |
| 3300013101|Ga0164313_10058806 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300013101|Ga0164313_10072713 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
| 3300013101|Ga0164313_10231446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
| 3300013101|Ga0164313_10283743 | Not Available | 1391 | Open in IMG/M |
| 3300013101|Ga0164313_10321747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300013101|Ga0164313_10348901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300013101|Ga0164313_10388427 | Not Available | 1166 | Open in IMG/M |
| 3300013101|Ga0164313_10415030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1123 | Open in IMG/M |
| 3300013101|Ga0164313_10419814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM1 | 1116 | Open in IMG/M |
| 3300013101|Ga0164313_10515259 | Not Available | 994 | Open in IMG/M |
| 3300013101|Ga0164313_10544496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 963 | Open in IMG/M |
| 3300013101|Ga0164313_10572583 | Not Available | 936 | Open in IMG/M |
| 3300013101|Ga0164313_10601505 | Not Available | 910 | Open in IMG/M |
| 3300013101|Ga0164313_10875292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300013101|Ga0164313_10875385 | Not Available | 735 | Open in IMG/M |
| 3300013101|Ga0164313_10900438 | Not Available | 723 | Open in IMG/M |
| 3300013101|Ga0164313_10902798 | Not Available | 722 | Open in IMG/M |
| 3300013101|Ga0164313_11129627 | Not Available | 635 | Open in IMG/M |
| 3300013101|Ga0164313_11130357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300013101|Ga0164313_11502032 | Not Available | 543 | Open in IMG/M |
| 3300013101|Ga0164313_11619070 | Not Available | 521 | Open in IMG/M |
| 3300013233|Ga0172420_10405000 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300013233|Ga0172420_10858188 | Not Available | 678 | Open in IMG/M |
| 3300013233|Ga0172420_11121891 | Not Available | 588 | Open in IMG/M |
| 3300013233|Ga0172420_11185803 | Not Available | 571 | Open in IMG/M |
| 3300014914|Ga0164311_10061316 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300014914|Ga0164311_10749093 | Not Available | 557 | Open in IMG/M |
| 3300021508|Ga0190283_1028088 | Not Available | 1143 | Open in IMG/M |
| 3300021508|Ga0190283_1069702 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021508|Ga0190283_1083368 | Not Available | 591 | Open in IMG/M |
| 3300021514|Ga0190293_1005593 | All Organisms → cellular organisms → Bacteria | 4216 | Open in IMG/M |
| 3300021514|Ga0190293_1011574 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300021514|Ga0190293_1019919 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 2143 | Open in IMG/M |
| 3300021514|Ga0190293_1039764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
| 3300021514|Ga0190293_1118548 | Not Available | 713 | Open in IMG/M |
| 3300021514|Ga0190293_1143451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 631 | Open in IMG/M |
| (restricted) 3300023086|Ga0233407_10100157 | Not Available | 527 | Open in IMG/M |
| 3300024262|Ga0210003_1398125 | Not Available | 500 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10339175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM2 | 707 | Open in IMG/M |
| 3300027758|Ga0209379_10244616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter | 610 | Open in IMG/M |
| 3300027820|Ga0209578_10561543 | Not Available | 508 | Open in IMG/M |
| 3300027834|Ga0209344_10001537 | All Organisms → cellular organisms → Bacteria | 29442 | Open in IMG/M |
| 3300027834|Ga0209344_10001991 | All Organisms → cellular organisms → Bacteria | 24162 | Open in IMG/M |
| 3300027834|Ga0209344_10004253 | All Organisms → cellular organisms → Bacteria | 13291 | Open in IMG/M |
| 3300027834|Ga0209344_10004704 | All Organisms → cellular organisms → Bacteria | 12309 | Open in IMG/M |
| 3300027834|Ga0209344_10006324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9791 | Open in IMG/M |
| 3300027834|Ga0209344_10008181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 8155 | Open in IMG/M |
| 3300027834|Ga0209344_10009450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7336 | Open in IMG/M |
| 3300027834|Ga0209344_10208286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 987 | Open in IMG/M |
| 3300027834|Ga0209344_10550461 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 509 | Open in IMG/M |
| 3300027852|Ga0209345_10134983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium | 1606 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10280313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10385801 | Not Available | 681 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10500226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10602657 | Not Available | 531 | Open in IMG/M |
| 3300027858|Ga0209013_10324812 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10062323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 1773 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10400127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10445980 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10587803 | Not Available | 538 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10042340 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300032231|Ga0316187_10048277 | All Organisms → cellular organisms → Bacteria | 3407 | Open in IMG/M |
| 3300032258|Ga0316191_10632386 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300032272|Ga0316189_10410884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300032272|Ga0316189_10431559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 29.05% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 20.95% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 16.22% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 13.51% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.76% |
| Hydrothermal Vent Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat | 6.08% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 2.70% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 2.70% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.35% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002225 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013099 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300013233 | Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161 | Environmental | Open in IMG/M |
| 3300014914 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cm | Environmental | Open in IMG/M |
| 3300021508 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-0-1_MG | Environmental | Open in IMG/M |
| 3300021514 | Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MG | Environmental | Open in IMG/M |
| 3300023086 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24723J26617_100273914 | 3300002225 | Marine | MLWWLQKMQEYWWYVEAFRKRPERKDLVQIAGENRSI* |
| JGI24723J26617_100430872 | 3300002225 | Marine | MRCAKSLMLWCLQKMQEYWWYAEAFCKRPERKELVQIAGENRSI* |
| JGI24723J26617_100473101 | 3300002225 | Marine | LWCLQEMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| JGI24723J26617_100559812 | 3300002225 | Marine | MKCAKSLMLWCLQKTQEYWWSVEAFCKRTERKELVQIA* |
| JGI24723J26617_100746902 | 3300002225 | Marine | MRYTKSLMLWCLQKMQEYWWYVEAFCKRPERKESVQIAGENRSI* |
| JGI24723J26617_100885411 | 3300002225 | Marine | MRCTNSLMLWFLQKTQKYWWDVEAFCKYPERKELVQIA* |
| JGI24723J26617_101217191 | 3300002225 | Marine | WCLQKMQETWWYVEAFCKRPERKELVQIAVENRSIQVQD* |
| JGI24723J26617_101223422 | 3300002225 | Marine | MGCGNSLMLWCLQKTQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| JGI24723J26617_101689842 | 3300002225 | Marine | SLMLWCLQKMQEYWWYVEAFCKRPERKDFVQVAGGNRSV* |
| Ga0070728_101952061 | 3300005588 | Marine Sediment | FCRMRCAKSLMLWCLQKTQGYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0070728_105020302 | 3300005588 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0070727_104252892 | 3300005590 | Marine Sediment | MRCAKTLMLWCLQEMQEYWWYVEAFCKRPERKELVQIA* |
| Ga0070727_104743712 | 3300005590 | Marine Sediment | MRCAKSLLLWYLQKMQEYWWYVEAFCKYPERKELLQIAGENRSI* |
| Ga0070727_106916401 | 3300005590 | Marine Sediment | MLWCLQKTQEYWWYVEAFCKHPERKELVQIAGENRSI* |
| Ga0070726_106996311 | 3300005600 | Marine Sediment | MRCANSLMLWCLQKTQEYWWYVEAFCKRPERKELVQIAG |
| Ga0070723_104540741 | 3300005612 | Marine Sediment | MLWRLQKMQEYWWYVEAFCKCPQRKKFVQITGENHSI* |
| Ga0070723_105840161 | 3300005612 | Marine Sediment | MLWYLQKMQEYWWYVEAFCKYPERKELVQIAGENRSI* |
| Ga0070723_107091401 | 3300005612 | Marine Sediment | FCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0099972_103223321 | 3300006467 | Marine | MLPDEMCPFLMLWCLQKIQEYWWYVEAFCKRPERKELVQLAGENRSI* |
| Ga0099972_104382882 | 3300006467 | Marine | MLWRLQKMQEYWWYVEAFCKCPQRKELVQITGENRSI* |
| Ga0099972_104398821 | 3300006467 | Marine | MLWWLQKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0099972_107492543 | 3300006467 | Marine | MRCVKCLMLWHLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI* |
| Ga0099972_111324492 | 3300006467 | Marine | RCANSLMLWRLQKMQEYWWYVEAFCKCPQRKELVQTTGENRSI* |
| Ga0099972_119740942 | 3300006467 | Marine | MRWCLQKTQEYWWYVEYFCKRPERKELVQIAGENRSI* |
| Ga0099972_119756451 | 3300006467 | Marine | FCRMRCANSLMLWYLQKMQEYWWYVEAFCKYPERKELVQIAGEYRSS* |
| Ga0099972_129092422 | 3300006467 | Marine | MLWYLQKMQEYWWYVEAFCRYPERKELVQIAGENRSI* |
| Ga0099972_129954462 | 3300006467 | Marine | MRCAKCLMLWCLQKTQEYWWYVEAFCKCHQRKNLVQI |
| Ga0099972_130451321 | 3300006467 | Marine | MRCANSLMLWYLQKIQEYWWYVEAFCKYPERKELVQIAGENR |
| Ga0099972_132853262 | 3300006467 | Marine | FCRMRCANSLMLWCLQKTQEYWWYVEAFCKYSERKELVQIAGENRSI* |
| Ga0099972_135613232 | 3300006467 | Marine | MRCAKSLMLWCMQKMQEYWWYVEAFCKRPERKELVQ |
| Ga0099972_135618952 | 3300006467 | Marine | MRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQ |
| Ga0114918_102947182 | 3300009149 | Deep Subsurface | MLWCLHKTQEYWWYVEAFCERPERKDLVQIAGENRSI* |
| Ga0118731_1026471747 | 3300010392 | Marine | MRWCLQKMQEYWWYIEAFCKRPERKDLVQIAGENRSI* |
| Ga0118731_1032257312 | 3300010392 | Marine | MLWCLQKTQEYWWYVEAFCKYSERKELVQIAGENRSI* |
| Ga0118731_10402008118 | 3300010392 | Marine | ERFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0118731_1054573662 | 3300010392 | Marine | LWRLQKMQEYWWYVEAFCKCPQREDLVQITGENRSI* |
| Ga0118731_1063470043 | 3300010392 | Marine | MLWYLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI* |
| Ga0118731_1063970774 | 3300010392 | Marine | LMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0118731_1072519717 | 3300010392 | Marine | MLWCLQKTQEYWWYVEAFCKCPERKELVQIAGENRSI* |
| Ga0118731_1074845448 | 3300010392 | Marine | MLWHPQKTQEYWWYVEAFCGCHQRKNLVQIAGENRSI* |
| Ga0118731_1077754528 | 3300010392 | Marine | MLWYLQKIQEYWWYVEAFCKYPERKELVQIAGENRSI* |
| Ga0118731_10789936113 | 3300010392 | Marine | MLWCLQKMQEYWWYVEAFCKRPERKNLVQIAGENRSI* |
| Ga0118731_1081010819 | 3300010392 | Marine | MLWCLQKMQEYWWYVEAFCKYPERKELVQIAGENRSI* |
| Ga0118731_1099396851 | 3300010392 | Marine | MRCAKTLMLWCLQEMQEYWWYVEAFCKRPERRELVQIA |
| Ga0118731_1119595172 | 3300010392 | Marine | MLWHLQKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0118731_1124488853 | 3300010392 | Marine | MLWCLQKTQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0118731_1134876551 | 3300010392 | Marine | NSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0118731_11376981911 | 3300010392 | Marine | KSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0118731_1138621147 | 3300010392 | Marine | MLWCLQKMQEYWWYVETFCKRSERKELVQIAGENRSI* |
| Ga0118731_11538533112 | 3300010392 | Marine | MLWYLQRMQEYWWYVEAFCKYPERKELVQIAGEYRSS* |
| Ga0118733_10000635728 | 3300010430 | Marine Sediment | MLWHLQKTQEYWWYVEAFCGCHQRKNLVQIAGENRSI* |
| Ga0118733_1000188175 | 3300010430 | Marine Sediment | MLWHLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI* |
| Ga0118733_1000225627 | 3300010430 | Marine Sediment | MRWCLQKTQEYWWNVEYFCKRPERKELVQIAGENRSI* |
| Ga0118733_1000281826 | 3300010430 | Marine Sediment | MLWRLQKMQEYWWYVEAFCKCPQRKELVQTTGENRSI* |
| Ga0118733_1000458554 | 3300010430 | Marine Sediment | MLWCLQKMQEYWWYVEAFRKCPQRKELVQITGENRSI* |
| Ga0118733_1001278541 | 3300010430 | Marine Sediment | RFCRMRCANSLMLWYLQKMQEYWWYVEAFCKYPERKELVQIAGEYRSS* |
| Ga0118733_1002482474 | 3300010430 | Marine Sediment | SLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0118733_1003136261 | 3300010430 | Marine Sediment | CAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQLAGENRSI* |
| Ga0118733_1003369981 | 3300010430 | Marine Sediment | TERFCRMRCANSLMLWYLQKMQEYWWYVEAFCKYPERKELVQVAGENCSI* |
| Ga0118733_1005227671 | 3300010430 | Marine Sediment | MLWCLQKTQEYWRYVEAFCKRPERKELVQIAGENRSI* |
| Ga0118733_1007579473 | 3300010430 | Marine Sediment | MLWCLQKTQEYWWYVEAFCKHPERKELVQIAGKNRSI* |
| Ga0118733_1056607681 | 3300010430 | Marine Sediment | MLWCLQKTQEYWWYVEAFCKCHQRKNLVQIAGENRSI* |
| Ga0118733_1082607132 | 3300010430 | Marine Sediment | FCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKNLVQIAGENRSI* |
| Ga0164320_105675062 | 3300013098 | Marine Sediment | CRVRCAKSLMLWRLQKMQEYWWYAEAFCKCPQRKELVQITGENRSI* |
| Ga0164315_100173457 | 3300013099 | Marine Sediment | MLWWLQKTQEYWWYVEAFCKRPERKELVQIAGEIRSI* |
| Ga0164315_102291451 | 3300013099 | Marine Sediment | MLWCLQEMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0164315_102576362 | 3300013099 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKRPERKDLVQIAGENRSI* |
| Ga0164315_104393852 | 3300013099 | Marine Sediment | AKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0164315_106260132 | 3300013099 | Marine Sediment | MLWCVQKTQEYWLYAEAFCAWPQRKELVQIAGENYSS* |
| Ga0164315_108358451 | 3300013099 | Marine Sediment | MLWCLQKTQEYWWYAEAFCKYPERKELVQIAGKNRSI* |
| Ga0164315_110451471 | 3300013099 | Marine Sediment | MLWFLKKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0164315_113777462 | 3300013099 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKCPERKELVQIAGENRSI* |
| Ga0164315_114520941 | 3300013099 | Marine Sediment | MLWCLQKTQEYWWYAEAFCKRLERKELVQIAGENRSI* |
| Ga0164313_1000010413 | 3300013101 | Marine Sediment | MLWCLQKVQEYWWYVEAFCKRPERKELVQIAGKNRSI* |
| Ga0164313_100019377 | 3300013101 | Marine Sediment | MLWCLQKMQEYWWYAEAFCKRPERKELVQIAGENRSI* |
| Ga0164313_100031929 | 3300013101 | Marine Sediment | MLWRLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0164313_1000547310 | 3300013101 | Marine Sediment | FCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIA* |
| Ga0164313_100087931 | 3300013101 | Marine Sediment | FCRMRCAKSLMLWCLQEMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0164313_100088156 | 3300013101 | Marine Sediment | MFWCLQKSQEYWWYVEAFCKYPERGELVQIAGNNRSIQV* |
| Ga0164313_100095219 | 3300013101 | Marine Sediment | CRMRYAKSLMLWCLQKTQEYWWYIEAFCKHPERKELVQIAGKNRSI* |
| Ga0164313_100253631 | 3300013101 | Marine Sediment | MLWFLKKMQKYWWYVEAFCKYPERKELVQIAGKNRSI |
| Ga0164313_100427011 | 3300013101 | Marine Sediment | LMLWCLQKTQEYWWYAEAFCKYPERKELVQIAGKNRSI* |
| Ga0164313_100528393 | 3300013101 | Marine Sediment | MLWCLKKTQEYWWYVEAFCRRPERKELVQIAGENRSI* |
| Ga0164313_100588061 | 3300013101 | Marine Sediment | MLWYLQKTQKYWWYVESFCKRPERKELVQITGENRSI* |
| Ga0164313_100727132 | 3300013101 | Marine Sediment | MFWCLQKMQEYWWYVEAFCKRPGRKELVQIAGENRSS* |
| Ga0164313_102314461 | 3300013101 | Marine Sediment | MLWRLQKMQEYWWYVEAFCKCPQRIELVQITGENRSI* |
| Ga0164313_102837434 | 3300013101 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKRPERKGLVQIAGKNRSI* |
| Ga0164313_103217472 | 3300013101 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKYPERKELVQIAGKNRSI* |
| Ga0164313_103489012 | 3300013101 | Marine Sediment | MRCAKGLMLWCLQKSQEYWWYVEAFFKCHQRKNLVQITGENRSV* |
| Ga0164313_103884272 | 3300013101 | Marine Sediment | MLWWLQKKSQEYWWYVEAFYKRPERKELVQVAGENRSI* |
| Ga0164313_104150302 | 3300013101 | Marine Sediment | MLWCLKKMQEYWWYVEAFCKYPERKELVQIAGKNRLI* |
| Ga0164313_104198142 | 3300013101 | Marine Sediment | MLWYLQKMQEYWWYVEAFCKYPERKELVQIAGENHSF* |
| Ga0164313_105152591 | 3300013101 | Marine Sediment | MLWCLQKMQEYWWYVEAFFKRPERKELVQIAGENRSI* |
| Ga0164313_105444961 | 3300013101 | Marine Sediment | MLWCLQKTQEYWWYVEAFCKRLERKELVQIAGENRSI* |
| Ga0164313_105725831 | 3300013101 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKYSERKELVQIVGKNRSF* |
| Ga0164313_106015051 | 3300013101 | Marine Sediment | MCPFLMLWSLKKSQEYWWYVEDFRKRPERKELVQIA* |
| Ga0164313_108752922 | 3300013101 | Marine Sediment | MSCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQITGENRSI* |
| Ga0164313_108753852 | 3300013101 | Marine Sediment | MFWRLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0164313_109004382 | 3300013101 | Marine Sediment | MRCTNSLMLWCLQKKQEYWWYAEAFYKCPERKELVQIAGENRSI* |
| Ga0164313_109027982 | 3300013101 | Marine Sediment | FCRMRCANSLMLWCLQKMQEYWWYVEAFCKYPEREELVQIAGENRSI* |
| Ga0164313_111296271 | 3300013101 | Marine Sediment | MRWCLQKTQEYWWYVEAFCKRPGRKEMVQTAGENRLI |
| Ga0164313_111303572 | 3300013101 | Marine Sediment | MLWCLQKMQEYWWYAEDFCKCPERKELVQVVGENRSI* |
| Ga0164313_115020321 | 3300013101 | Marine Sediment | IERFCRMRCANSLMLWCLQKMQEYWWYVEAFCKRPERRELAQISGENRSI* |
| Ga0164313_116190701 | 3300013101 | Marine Sediment | MLWCLQKSQEYWWYVEAFCKRPERKELVQIAGKNRSI* |
| Ga0172420_104050002 | 3300013233 | Marine | MLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRPI* |
| Ga0172420_108581881 | 3300013233 | Marine | MLWSLQKTQEYWWYVEAFCKRPERKELVQIAGENRST* |
| Ga0172420_111218912 | 3300013233 | Marine | MGCAKSLMLWYLRKMQEYWLYVEAFRKYPERKELVQTAGENRSI* |
| Ga0172420_111858031 | 3300013233 | Marine | MLWRLQKMQEYWWYVEAFCKRPQRKELVQTAGENRSI* |
| Ga0164311_100613161 | 3300014914 | Marine Sediment | MLWCLQKTQEYWWYVEAFCKYPERKELVQIAGENRSS* |
| Ga0164311_107490932 | 3300014914 | Marine Sediment | MFETWTERFCRMRCAKSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI* |
| Ga0190283_10280882 | 3300021508 | Hydrothermal Vent Microbial Mat | MLWRLQKMQEYWWYVEVFCKCPQRKELVQITGENRSV |
| Ga0190283_10697021 | 3300021508 | Hydrothermal Vent Microbial Mat | MLWCLQKKQKYWWYVEAFCKCPERKELVQIAGKNRSI |
| Ga0190283_10833683 | 3300021508 | Hydrothermal Vent Microbial Mat | MLWCLQKMQEYWWYVEAFCKRPERKGLVQIAGKNRSI |
| Ga0190293_10055932 | 3300021514 | Hydrothermal Vent Microbial Mat | MSNSLMLWYLKKTQEYWWYVEAFCKYPERKGLVQIAGENRSI |
| Ga0190293_10115743 | 3300021514 | Hydrothermal Vent Microbial Mat | MFWCLQKMQEYWWYVEAFCKRPGRKELVQIASENRSS |
| Ga0190293_10199193 | 3300021514 | Hydrothermal Vent Microbial Mat | MRCANPLMLWCLQKTQEYWWYVEAFCKRLERKELVQIAGENRSI |
| Ga0190293_10397642 | 3300021514 | Hydrothermal Vent Microbial Mat | MFWCLQKTQEYWWCVEDFCKYPERKELVQIAGENCSI |
| Ga0190293_11185482 | 3300021514 | Hydrothermal Vent Microbial Mat | MFWCLQKMQEYWWYVEAFCKYSERRELVQIVGKNRSI |
| Ga0190293_11434511 | 3300021514 | Hydrothermal Vent Microbial Mat | MCKPLMLWCLQKTQEYWWYAEAFCKRLERKELVQIAGENRSI |
| (restricted) Ga0233407_101001572 | 3300023086 | Seawater | MRCANSLMLWYLQKMQEYWWYVEAFSKYPERKELVQIAGENRSI |
| Ga0210003_13981252 | 3300024262 | Deep Subsurface | MLWCLHKTQEYWWYVEAFCERPERKDLVQIAGENRSI |
| (restricted) Ga0255046_103391751 | 3300024519 | Seawater | MLWRLQKMQEYWWYVEAFCKCPQRKELVQITGENRSI |
| Ga0209379_102446161 | 3300027758 | Marine Sediment | MLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Ga0209578_105615431 | 3300027820 | Marine Sediment | MRCANSLMRWCLQKTQEYWWYVEYFCKRPERKELV |
| Ga0209344_1000153721 | 3300027834 | Marine | MRYTKSLMLWCLQKMQEYWWYVEAFCKRPERKESVQIAGENRSI |
| Ga0209344_100019919 | 3300027834 | Marine | MFWRLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Ga0209344_100042536 | 3300027834 | Marine | MLWCLQKMQEYWWYAEAFCKRPERKELVQIAGENRSI |
| Ga0209344_1000470411 | 3300027834 | Marine | MGCGNSLMLWCLQKTQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Ga0209344_100063246 | 3300027834 | Marine | MRCTNSLMLWFLQKTQKYWWDVEAFCKYPERKELVQIA |
| Ga0209344_100081816 | 3300027834 | Marine | MLWCLQKMQETWWYVEAFCKRPERKELVQIAVENRSIQVQD |
| Ga0209344_100094502 | 3300027834 | Marine | MLWWLQKMQEYWWYVEAFRKRPERKDLVQIAGENRSI |
| Ga0209344_102082862 | 3300027834 | Marine | MLWCLQKMQEYWWYIEAFCKRPERKELVQIAGENRSI |
| Ga0209344_105504612 | 3300027834 | Marine | MLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENCSI |
| Ga0209345_101349831 | 3300027852 | Marine | KSLMLWCLQKMQECWWYVEAFCKRLERKELVQIAGENRSILVSDKVAQ |
| (restricted) Ga0255054_102803131 | 3300027856 | Seawater | NSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| (restricted) Ga0255054_103858012 | 3300027856 | Seawater | MLWRLQKMQEYWWYVEAFCKRPERKDLVQIAGENRSI |
| (restricted) Ga0255054_105002262 | 3300027856 | Seawater | MLWCLQKTQEYWWYVEAFCKRPERKEFVQIAGENRSI |
| (restricted) Ga0255054_106026572 | 3300027856 | Seawater | MRCDKSLMLWHLQKKQEYWWYVEAFCKCPELKELVQIA |
| Ga0209013_103248122 | 3300027858 | Marine | MLWCLQKMQEYWWYVEAFCQRPERKELVQITGENRSI |
| (restricted) Ga0255053_100623233 | 3300027868 | Seawater | RCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| (restricted) Ga0255053_104001271 | 3300027868 | Seawater | ERFCRMRCDKSLMLWHLQKKQEYWWYVEAFCKCPELKELVQIAGENRSV |
| (restricted) Ga0255053_104459801 | 3300027868 | Seawater | MLWYLQKMQEYWWYVEAFCKYPERKGLVQIAGENRSI |
| (restricted) Ga0255053_105878032 | 3300027868 | Seawater | MLWFLQKMQEYWWYVEAFCKYPERKELVQIAGKNRSI |
| (restricted) Ga0233413_100423403 | 3300027996 | Seawater | MLWCLKKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Ga0316187_100482772 | 3300032231 | Worm Burrow | MLWCLRKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Ga0316191_106323861 | 3300032258 | Worm Burrow | RFCRMRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIAGENRSI |
| Ga0316189_104108841 | 3300032272 | Worm Burrow | RFCRMRCANSLMLWCLQKMQEYWWYVEAFCKRPERKELVQIA |
| Ga0316189_104315592 | 3300032272 | Worm Burrow | MRCAKCLMLWCMQKMQEYWWYIEVFCKRPERKELVQT |
| ⦗Top⦘ |