


| Basic Information | |
|---|---|
| Family ID | F048267 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINRELK |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 44.59 % |
| % of genes near scaffold ends (potentially truncated) | 14.19 % |
| % of genes from short scaffolds (< 2000 bps) | 76.35 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (39.189 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (13.514 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.703 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (35.811 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.71% β-sheet: 0.00% Coil/Unstructured: 44.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 1.35 |
| PF00805 | Pentapeptide | 0.68 |
| PF09511 | RNA_lig_T4_1 | 0.68 |
| PF01555 | N6_N4_Mtase | 0.68 |
| PF11649 | T4_neck-protein | 0.68 |
| PF05433 | Rick_17kDa_Anti | 0.68 |
| PF12627 | PolyA_pol_RNAbd | 0.68 |
| PF13392 | HNH_3 | 0.68 |
| PF02086 | MethyltransfD12 | 0.68 |
| PF11116 | DUF2624 | 0.68 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.68 |
| PF00415 | RCC1 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 1.35 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.68 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.68 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.68 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.68 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.81 % |
| Unclassified | root | N/A | 39.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199911478 | All Organisms → Viruses → Predicted Viral | 2645 | Open in IMG/M |
| 3300001274|B570J13895_1001945 | All Organisms → Viruses → Predicted Viral | 2787 | Open in IMG/M |
| 3300001580|Draft_10019964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 5139 | Open in IMG/M |
| 3300002835|B570J40625_100077948 | All Organisms → Viruses → Predicted Viral | 4318 | Open in IMG/M |
| 3300002835|B570J40625_100389246 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300002835|B570J40625_101011434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 709 | Open in IMG/M |
| 3300003413|JGI25922J50271_10002618 | All Organisms → cellular organisms → Bacteria | 5215 | Open in IMG/M |
| 3300003413|JGI25922J50271_10033836 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300003430|JGI25921J50272_10063643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 815 | Open in IMG/M |
| 3300004787|Ga0007755_1329524 | Not Available | 546 | Open in IMG/M |
| 3300005581|Ga0049081_10112398 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300005583|Ga0049085_10264899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 562 | Open in IMG/M |
| 3300005805|Ga0079957_1138123 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300005805|Ga0079957_1189305 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300005940|Ga0073913_10040888 | Not Available | 719 | Open in IMG/M |
| 3300005941|Ga0070743_10021252 | All Organisms → Viruses → Predicted Viral | 2259 | Open in IMG/M |
| 3300005943|Ga0073926_10079130 | Not Available | 657 | Open in IMG/M |
| 3300006014|Ga0073919_1028532 | Not Available | 529 | Open in IMG/M |
| 3300006033|Ga0075012_10312623 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300006639|Ga0079301_1137174 | Not Available | 729 | Open in IMG/M |
| 3300006641|Ga0075471_10117712 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300006810|Ga0070754_10216395 | Not Available | 887 | Open in IMG/M |
| 3300006875|Ga0075473_10338663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 608 | Open in IMG/M |
| 3300006875|Ga0075473_10402110 | Not Available | 553 | Open in IMG/M |
| 3300007538|Ga0099851_1158257 | Not Available | 840 | Open in IMG/M |
| 3300007539|Ga0099849_1054289 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300007539|Ga0099849_1378063 | Not Available | 500 | Open in IMG/M |
| 3300007541|Ga0099848_1298306 | Not Available | 554 | Open in IMG/M |
| 3300007542|Ga0099846_1259385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 602 | Open in IMG/M |
| 3300007548|Ga0102877_1228208 | Not Available | 524 | Open in IMG/M |
| 3300007560|Ga0102913_1136431 | Not Available | 793 | Open in IMG/M |
| 3300007562|Ga0102915_1159307 | Not Available | 736 | Open in IMG/M |
| 3300007618|Ga0102896_1007500 | All Organisms → Viruses → Predicted Viral | 3732 | Open in IMG/M |
| 3300007632|Ga0102894_1193009 | Not Available | 542 | Open in IMG/M |
| 3300007649|Ga0102912_1111140 | Not Available | 789 | Open in IMG/M |
| 3300007960|Ga0099850_1151815 | Not Available | 932 | Open in IMG/M |
| 3300007974|Ga0105747_1282568 | Not Available | 560 | Open in IMG/M |
| 3300008107|Ga0114340_1131987 | All Organisms → Viruses | 949 | Open in IMG/M |
| 3300008107|Ga0114340_1132317 | Not Available | 947 | Open in IMG/M |
| 3300008107|Ga0114340_1157587 | Not Available | 827 | Open in IMG/M |
| 3300008110|Ga0114343_1071236 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300008113|Ga0114346_1141070 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300008261|Ga0114336_1029487 | All Organisms → Viruses → Predicted Viral | 3055 | Open in IMG/M |
| 3300008261|Ga0114336_1048254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2221 | Open in IMG/M |
| 3300008261|Ga0114336_1064292 | All Organisms → Viruses → Predicted Viral | 1837 | Open in IMG/M |
| 3300008448|Ga0114876_1115459 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300008962|Ga0104242_1018371 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300009009|Ga0105105_10010391 | All Organisms → Viruses → Predicted Viral | 3732 | Open in IMG/M |
| 3300009051|Ga0102864_1116789 | Not Available | 728 | Open in IMG/M |
| 3300009075|Ga0105090_10730318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 601 | Open in IMG/M |
| 3300009082|Ga0105099_10027599 | All Organisms → Viruses → Predicted Viral | 2917 | Open in IMG/M |
| 3300009085|Ga0105103_10012031 | All Organisms → Viruses → Predicted Viral | 4194 | Open in IMG/M |
| 3300009086|Ga0102812_10430911 | Not Available | 719 | Open in IMG/M |
| 3300009165|Ga0105102_10046769 | All Organisms → Viruses → Predicted Viral | 1887 | Open in IMG/M |
| 3300009169|Ga0105097_10208183 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300009450|Ga0127391_1032517 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300009470|Ga0126447_1043599 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
| 3300010297|Ga0129345_1192282 | Not Available | 726 | Open in IMG/M |
| 3300010297|Ga0129345_1233123 | Not Available | 646 | Open in IMG/M |
| 3300010297|Ga0129345_1256338 | Not Available | 611 | Open in IMG/M |
| 3300010299|Ga0129342_1052141 | All Organisms → Viruses → Predicted Viral | 1603 | Open in IMG/M |
| 3300010318|Ga0136656_1109313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 965 | Open in IMG/M |
| 3300010354|Ga0129333_10000231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 41180 | Open in IMG/M |
| 3300010354|Ga0129333_10228475 | All Organisms → Viruses → Predicted Viral | 1685 | Open in IMG/M |
| 3300010354|Ga0129333_10835469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 783 | Open in IMG/M |
| 3300010354|Ga0129333_10927572 | Not Available | 735 | Open in IMG/M |
| 3300010354|Ga0129333_11124968 | Not Available | 655 | Open in IMG/M |
| 3300010354|Ga0129333_11274969 | Not Available | 608 | Open in IMG/M |
| 3300010354|Ga0129333_11284846 | Not Available | 605 | Open in IMG/M |
| 3300010354|Ga0129333_11525500 | Not Available | 547 | Open in IMG/M |
| 3300010354|Ga0129333_11581772 | Not Available | 535 | Open in IMG/M |
| 3300010354|Ga0129333_11771666 | Not Available | 501 | Open in IMG/M |
| 3300010370|Ga0129336_10170417 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300011268|Ga0151620_1007876 | All Organisms → Viruses → Predicted Viral | 3867 | Open in IMG/M |
| 3300012000|Ga0119951_1027019 | All Organisms → Viruses → Predicted Viral | 1934 | Open in IMG/M |
| 3300012963|Ga0129340_1016366 | Not Available | 663 | Open in IMG/M |
| 3300012970|Ga0129338_1282961 | Not Available | 631 | Open in IMG/M |
| 3300017963|Ga0180437_10154846 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
| 3300019708|Ga0194016_1002143 | All Organisms → Viruses → Predicted Viral | 1850 | Open in IMG/M |
| 3300019784|Ga0181359_1267935 | Not Available | 509 | Open in IMG/M |
| 3300020151|Ga0211736_10268590 | All Organisms → Viruses → Predicted Viral | 1504 | Open in IMG/M |
| 3300020506|Ga0208091_1006557 | All Organisms → Viruses → Predicted Viral | 1533 | Open in IMG/M |
| 3300020519|Ga0208223_1005762 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
| 3300020527|Ga0208232_1036161 | Not Available | 660 | Open in IMG/M |
| 3300020549|Ga0207942_1040803 | Not Available | 576 | Open in IMG/M |
| 3300020566|Ga0208222_1000349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13307 | Open in IMG/M |
| 3300020566|Ga0208222_1028241 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300021962|Ga0222713_10503154 | Not Available | 724 | Open in IMG/M |
| 3300021962|Ga0222713_10800414 | Not Available | 526 | Open in IMG/M |
| 3300021963|Ga0222712_10750511 | Not Available | 543 | Open in IMG/M |
| 3300022198|Ga0196905_1081235 | Not Available | 883 | Open in IMG/M |
| 3300022198|Ga0196905_1200417 | Not Available | 501 | Open in IMG/M |
| 3300022200|Ga0196901_1065367 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300022752|Ga0214917_10061921 | All Organisms → Viruses → Predicted Viral | 2425 | Open in IMG/M |
| 3300022752|Ga0214917_10306273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 703 | Open in IMG/M |
| 3300023174|Ga0214921_10075399 | All Organisms → Viruses → Predicted Viral | 2713 | Open in IMG/M |
| 3300024239|Ga0247724_1040919 | Not Available | 681 | Open in IMG/M |
| 3300024289|Ga0255147_1000176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25247 | Open in IMG/M |
| 3300024289|Ga0255147_1000683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 8895 | Open in IMG/M |
| 3300024289|Ga0255147_1000801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 8179 | Open in IMG/M |
| 3300024343|Ga0244777_10333282 | Not Available | 954 | Open in IMG/M |
| 3300024346|Ga0244775_10003382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16973 | Open in IMG/M |
| 3300024350|Ga0255167_1029529 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300024352|Ga0255142_1070554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 528 | Open in IMG/M |
| 3300024513|Ga0255144_1045462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 741 | Open in IMG/M |
| 3300024565|Ga0255273_1041297 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300024572|Ga0255268_1098727 | Not Available | 731 | Open in IMG/M |
| 3300024865|Ga0256340_1093643 | Not Available | 736 | Open in IMG/M |
| 3300025585|Ga0208546_1037848 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300025674|Ga0208162_1061795 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300025732|Ga0208784_1004475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5192 | Open in IMG/M |
| 3300025732|Ga0208784_1082907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 966 | Open in IMG/M |
| 3300025732|Ga0208784_1210124 | Not Available | 565 | Open in IMG/M |
| 3300026571|Ga0255289_1073672 | Not Available | 772 | Open in IMG/M |
| 3300026573|Ga0255269_1077272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 915 | Open in IMG/M |
| 3300027121|Ga0255074_1037055 | Not Available | 605 | Open in IMG/M |
| 3300027205|Ga0208926_1047961 | Not Available | 634 | Open in IMG/M |
| 3300027693|Ga0209704_1022258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1623 | Open in IMG/M |
| 3300027743|Ga0209593_10303106 | Not Available | 549 | Open in IMG/M |
| 3300027762|Ga0209288_10009883 | All Organisms → Viruses → Predicted Viral | 2674 | Open in IMG/M |
| 3300027769|Ga0209770_10000449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22825 | Open in IMG/M |
| 3300027792|Ga0209287_10114171 | Not Available | 1015 | Open in IMG/M |
| 3300027899|Ga0209668_10384752 | Not Available | 916 | Open in IMG/M |
| 3300027899|Ga0209668_10903386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 595 | Open in IMG/M |
| 3300027940|Ga0209893_1000344 | All Organisms → Viruses → Predicted Viral | 4831 | Open in IMG/M |
| 3300028025|Ga0247723_1121062 | Not Available | 639 | Open in IMG/M |
| 3300029199|Ga0168647_101050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9980 | Open in IMG/M |
| 3300031787|Ga0315900_10745499 | Not Available | 685 | Open in IMG/M |
| 3300031857|Ga0315909_10616664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 721 | Open in IMG/M |
| 3300031951|Ga0315904_10010652 | Not Available | 11853 | Open in IMG/M |
| 3300031951|Ga0315904_10259017 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300033981|Ga0334982_0030772 | All Organisms → Viruses → Predicted Viral | 3064 | Open in IMG/M |
| 3300034019|Ga0334998_0285676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 986 | Open in IMG/M |
| 3300034021|Ga0335004_0483071 | Not Available | 681 | Open in IMG/M |
| 3300034061|Ga0334987_0849079 | Not Available | 502 | Open in IMG/M |
| 3300034062|Ga0334995_0358325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 | 930 | Open in IMG/M |
| 3300034066|Ga0335019_0144998 | All Organisms → Viruses → Predicted Viral | 1567 | Open in IMG/M |
| 3300034072|Ga0310127_079225 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300034072|Ga0310127_182259 | Not Available | 797 | Open in IMG/M |
| 3300034073|Ga0310130_0000228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 46943 | Open in IMG/M |
| 3300034073|Ga0310130_0059899 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300034102|Ga0335029_0000154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58367 | Open in IMG/M |
| 3300034102|Ga0335029_0103267 | All Organisms → Viruses → Predicted Viral | 2009 | Open in IMG/M |
| 3300034102|Ga0335029_0345197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CRM01 | 920 | Open in IMG/M |
| 3300034109|Ga0335051_0054649 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
| 3300034112|Ga0335066_0109175 | All Organisms → Viruses → Predicted Viral | 1737 | Open in IMG/M |
| 3300034283|Ga0335007_0011727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6964 | Open in IMG/M |
| 3300034283|Ga0335007_0018632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 5493 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.81% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.76% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.08% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.41% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.70% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.70% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.03% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.35% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.35% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.35% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.35% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.35% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.35% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.35% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.35% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.68% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.68% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.68% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.68% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029199 | Deep subsurface microbial communities from shale gas basins in Pennsylvania, USA - 1_Day0 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200095668 | 2199352004 | Freshwater | MTDEEWETSLKSMNEGVKKWVDEEIDKIKYNVVKEIINRELKND |
| B570J13895_100194513 | 3300001274 | Freshwater | MTNEEWETALKNMNEGVKKWVDEEIDKIKYNIIKNIIDKELK* |
| Draft_1001996419 | 3300001580 | Hydrocarbon Resource Environments | MTDEEWETSLKSMNESAKKWVDEEIDKIKYNVVKELIQKETKND* |
| B570J40625_1000779482 | 3300002835 | Freshwater | MTDEEWETSLKSMNEGVKKWVDEEIDKIKYNVVKEIINRELKND* |
| B570J40625_1003892462 | 3300002835 | Freshwater | MTDEEWETTLKSMNEKAKKWVDEEIDKIKYNVVKEIIQRETKND* |
| B570J40625_1010114342 | 3300002835 | Freshwater | MTNEEWETALKSMNENVKKWVDEEIDKIKYNIIKDIINEDLEEL* |
| JGI25922J50271_1000261813 | 3300003413 | Freshwater Lake | MTDKEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINGELK* |
| JGI25922J50271_100338361 | 3300003413 | Freshwater Lake | SMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL*VKNKS* |
| JGI25921J50272_100636432 | 3300003430 | Freshwater Lake | MTDEEWETTLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL* |
| Ga0007755_13295243 | 3300004787 | Freshwater Lake | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYNIIKDIINGELK* |
| Ga0049081_101123985 | 3300005581 | Freshwater Lentic | MTDKEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINGDLEAL* |
| Ga0049085_102648991 | 3300005583 | Freshwater Lentic | MTDEEWETSLKSMNEEAKKWVDEEIDKIKYNVVKEIIQREKEND* |
| Ga0079957_11381233 | 3300005805 | Lake | MTDEEWETSLKSMNEYAKKWVDEEIDKIKYNVVKELISEDLKND* |
| Ga0079957_11893053 | 3300005805 | Lake | MTDEEWNKALKSVNEQVKKWVDEEIFKIKYNVVKDVINKESLEND* |
| Ga0073913_100408882 | 3300005940 | Sand | MTDKEWETALKSMNESVKKWVDEEIDKIKYNIIKDIINEDLEAL* |
| Ga0070743_100212528 | 3300005941 | Estuarine | MTDEEWETALKSMNEYAKKWVGEEIDKIKYNIIKDIINGELEAL* |
| Ga0073926_100791302 | 3300005943 | Sand | MTNEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIISKELK* |
| Ga0073919_10285322 | 3300006014 | Sand | MTDEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIISKELK* |
| Ga0075012_103126232 | 3300006033 | Watersheds | MTDKEWETALKNLNEGVKKWVNEEIDKIKYNVVKEIINRELKND* |
| Ga0079301_11371742 | 3300006639 | Deep Subsurface | MTDEEWETALKSMNDGVKKWVVEEIDKIKYNVVKDIINGDLEAL* |
| Ga0075471_101177125 | 3300006641 | Aqueous | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIIKDIINGELNEKL* |
| Ga0070754_102163952 | 3300006810 | Aqueous | MTDEEWETALKNMNEGVKKWVDEEIDKIKYNIIKNIIDKELEEKL* |
| Ga0075473_103386632 | 3300006875 | Aqueous | MTDKEWETSLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL*VKNKS* |
| Ga0075473_104021101 | 3300006875 | Aqueous | MTDKEWETALKNLNENTKKWVDEEIDKIKYNIIKNIINRELK* |
| Ga0099851_11582572 | 3300007538 | Aqueous | MTDKEWETALKNLNENTKKWVDEEIDKIKYNIIKNIINGELNEKL* |
| Ga0099849_10542896 | 3300007539 | Aqueous | MTDEEWETALKSMNEYAKKWVGEEIDKIKYNIIKDLINKEDLKDD* |
| Ga0099849_13780632 | 3300007539 | Aqueous | VTDKEWETALKSMNEKAKKWVDEEIFKIKYNIIKNLINKEDLKND* |
| Ga0099848_12983061 | 3300007541 | Aqueous | MTDKEWETELKSINEGVKKWVDEEIFEIQYNIIKNLINKEDLKDD* |
| Ga0099846_12593852 | 3300007542 | Aqueous | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL* |
| Ga0102877_12282083 | 3300007548 | Estuarine | MTDKEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIISKELK* |
| Ga0102913_11364313 | 3300007560 | Estuarine | MTDEEWETTLKSMNDGVRKWVNEEIDKIKYNIIKDIIDKELK* |
| Ga0102915_11593073 | 3300007562 | Estuarine | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIIKDIINRELNEKL* |
| Ga0102896_10075002 | 3300007618 | Estuarine | MTDEEWETSLKSMNEEAKKWVDEEIDKIKYNVVKEIIQRETQND* |
| Ga0102894_11930092 | 3300007632 | Estuarine | MTNEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIINGDLEAL* |
| Ga0102912_11111403 | 3300007649 | Estuarine | MTDEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIINGDLEAL* |
| Ga0099850_11518153 | 3300007960 | Aqueous | MTNEEWETSLKSLNEETKKWVDEEIFKIKYNIIKDIINKKESER* |
| Ga0105747_12825683 | 3300007974 | Estuary Water | MTDEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDI |
| Ga0114340_11319871 | 3300008107 | Freshwater, Plankton | ALKSMNEYAKKWAEEEIMKIQCKVIHDIIEREKND* |
| Ga0114340_11323176 | 3300008107 | Freshwater, Plankton | MTDKEWETSLKSMNEGVKKWVNEEIDKIKYNIIKDIINGELNEKL* |
| Ga0114340_11575872 | 3300008107 | Freshwater, Plankton | MTDEEWETSLKNLNENVKKWVDEEIDKIKYNIIKDIINGELNETL* |
| Ga0114343_10712363 | 3300008110 | Freshwater, Plankton | MTDEEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINGELNEKL* |
| Ga0114346_11410701 | 3300008113 | Freshwater, Plankton | MTDEEWETSLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL* |
| Ga0114336_10294876 | 3300008261 | Freshwater, Plankton | MTDEEWETSLKSMNGGVKKWVDEEIDKIKYNVVKEIINRELKND* |
| Ga0114336_10482547 | 3300008261 | Freshwater, Plankton | MTNKEWEISLKNLNENVKKWVDEEIDKIKYNIIKDIINEDLEAL* |
| Ga0114336_10642921 | 3300008261 | Freshwater, Plankton | MTDEEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINEDLEAL* |
| Ga0114876_11154593 | 3300008448 | Freshwater Lake | MTEKEWETSLKSMNEYAKKWAEEEIMKIQCKVIYDIIEREKKND* |
| Ga0104242_10183714 | 3300008962 | Freshwater | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINGDLEAL* |
| Ga0105105_100103918 | 3300009009 | Freshwater Sediment | MIEEEWETSLKSMNEYAKKWVDEEIFKIKYNVVKEIINRELKND* |
| Ga0102864_11167893 | 3300009051 | Estuarine | MTDEEWETALKSMNDGVRKWVNEEIDKIKYDIIKDIINGELK* |
| Ga0105090_107303183 | 3300009075 | Freshwater Sediment | MTDEEWETSLKSMNEKAKKWVDEEIDKIKYNVVKELIQKETQND* |
| Ga0105099_100275995 | 3300009082 | Freshwater Sediment | MIEEEWETSLKSLNEETKKWVDEEIFKIKYNVVKEIINRELKND* |
| Ga0105103_1001203116 | 3300009085 | Freshwater Sediment | MIEEEWETSLKSLNEETKKWVVEEIDKIKYNVVKEIINRELKND* |
| Ga0102812_104309112 | 3300009086 | Estuarine | MTNEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIINGELEAL* |
| Ga0105102_100467696 | 3300009165 | Freshwater Sediment | MTDEEWETSLKSMNEKAKKWVDEEIDKIKYNVVKEIIQRETKND* |
| Ga0105097_102081834 | 3300009169 | Freshwater Sediment | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYSIIKDIIDKELK* |
| Ga0127391_10325175 | 3300009450 | Meromictic Pond | MTDKEWKTSLKSMNEKAKKWVDEEFDKIKYNVVKEIINRELKND* |
| Ga0126447_10435995 | 3300009470 | Meromictic Pond | MTDEEWETALKSMNENVKKWVDEEIDKIKYNIIKDIINGDLEEL* |
| Ga0129345_11922824 | 3300010297 | Freshwater To Marine Saline Gradient | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIIKDIINRELK* |
| Ga0129345_12331231 | 3300010297 | Freshwater To Marine Saline Gradient | VTDKEWETALKSMNEKAKKWVDEEIFKIKYNIIKNIINKEDLKND* |
| Ga0129345_12563381 | 3300010297 | Freshwater To Marine Saline Gradient | EREEALKYINEGVKKWVDEEIFKIHYNIIKNLINKEDLKDD* |
| Ga0129342_10521412 | 3300010299 | Freshwater To Marine Saline Gradient | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINRELK* |
| Ga0136656_11093131 | 3300010318 | Freshwater To Marine Saline Gradient | MSDEEWEITLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEVL* |
| Ga0129333_1000023113 | 3300010354 | Freshwater To Marine Saline Gradient | MTDEEWETSLKIMNEQAKKWVDEEIFKMKYNVFKEIINKENLKND* |
| Ga0129333_102284752 | 3300010354 | Freshwater To Marine Saline Gradient | MTDEEWETALKSVNEETKKWVDEEIMKIQCKVIHDIIERETKK* |
| Ga0129333_108354693 | 3300010354 | Freshwater To Marine Saline Gradient | MTDEELDKAMKSINEETKKWVDEEIFKIKYNIIKDIINKEDLKNDH* |
| Ga0129333_109275721 | 3300010354 | Freshwater To Marine Saline Gradient | KSMNEGVKKWVDEEIDKIKYNIIKDIINGDLEAL* |
| Ga0129333_111249682 | 3300010354 | Freshwater To Marine Saline Gradient | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINGDVEAL* |
| Ga0129333_112749692 | 3300010354 | Freshwater To Marine Saline Gradient | MTDEEWETALKSMNEGVKKWVNEEIDRIKYSIIKDIIDKELK* |
| Ga0129333_112848462 | 3300010354 | Freshwater To Marine Saline Gradient | MTDKEWETTLKSMNEGVKKWVNEEIDKIKYNIIKDIIDKELK* |
| Ga0129333_115255002 | 3300010354 | Freshwater To Marine Saline Gradient | MTDKEWETALKNMNENVKKWVDEEIDKIKYNIIKNIIDKELK* |
| Ga0129333_115817723 | 3300010354 | Freshwater To Marine Saline Gradient | MTDEEWETTLKSMNEGVKKWVDEEIDKIKYNIIKNIIDKELK* |
| Ga0129333_117716662 | 3300010354 | Freshwater To Marine Saline Gradient | MMTDEEWKTALKSMNEYAKKLVNEEIDKIKYNIIKDIINGDVEAL* |
| Ga0129336_101704176 | 3300010370 | Freshwater To Marine Saline Gradient | DEEWETSLKNLNENTKKWVDEEIDKIKYNIIKNIINRELK* |
| Ga0151620_10078763 | 3300011268 | Freshwater | MTDKEWETALKSMNEGVEKWVNEEIDKIKYSIIKDIIDKELK* |
| Ga0119951_10270193 | 3300012000 | Freshwater | MTDEEWETALKSMNEGVKKWVIEEIDKIKYNIVKDIISKELK* |
| Ga0129340_10163663 | 3300012963 | Aqueous | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIIN |
| Ga0129338_12829614 | 3300012970 | Aqueous | MTDEEWETTLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLE |
| Ga0180437_101548463 | 3300017963 | Hypersaline Lake Sediment | MTNEEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINGDVEAL |
| Ga0194016_10021435 | 3300019708 | Sediment | MTDEEWETTLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0181359_12679352 | 3300019784 | Freshwater Lake | MTEEEWETSLKSMNEEAKKWVDEEIDKIKYNVVKEIIQREKEND |
| Ga0211736_102685902 | 3300020151 | Freshwater | MADEEWETSLKSMNEKAKKWVDEEIDKIKYNVVKELIQKETQND |
| Ga0208091_10065573 | 3300020506 | Freshwater | MTDEEWETSLKSMNEKAKKWVDEEIDKIKYNVVKEIIQRETKND |
| Ga0208223_10057626 | 3300020519 | Freshwater | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYNVVKEIIQRETKND |
| Ga0208232_10361613 | 3300020527 | Freshwater | MTDEEWETTLKSMNEKAKKWVDEEIDKIKYNVVKEIIQRETKND |
| Ga0207942_10408031 | 3300020549 | Freshwater | ETTLKSMNEKAKKWVDEEIDKIKYNVVKEIIQRETKND |
| Ga0208222_100034948 | 3300020566 | Freshwater | MTNEEWETALKSMNENVKKWVDEEIDKIKYNIIKDIINEDLE |
| Ga0208222_10282411 | 3300020566 | Freshwater | LKSMNENVKKWVDEEIDKIKYNIIKDIINEDLETL |
| Ga0222713_105031542 | 3300021962 | Estuarine Water | MTNEEWETALKSMNEGVKKWVNEEIDKIKYNIIKEIINGDLEAL |
| Ga0222713_108004141 | 3300021962 | Estuarine Water | SLKSMNEYAKKWVDEEIDKIKYNVVKDIINRELKND |
| Ga0222712_107505112 | 3300021963 | Estuarine Water | MTNEEWETSLKSMNEGVKKWVNEEIDKIKYNVVKELIQKETQND |
| Ga0196905_10812352 | 3300022198 | Aqueous | MTDKEWETELKSINEGVKKWVDEEIFEIQYNIIKNLINKEDLKDD |
| Ga0196905_12004171 | 3300022198 | Aqueous | WETALKNLNENTKKWVDEEIDKIKYNIIKNIINGELNEKL |
| Ga0196901_10653672 | 3300022200 | Aqueous | MTDKEWETALKNLNENTKKWVDEEIDKIKYNIIKNIINGELNEKL |
| Ga0214917_100619217 | 3300022752 | Freshwater | MTDEEWEIALKSMNEGAKKWVVEEIDKIKYNIIKDIISKELK |
| Ga0214917_103062733 | 3300022752 | Freshwater | MTDEEWETALKSMNEGVKKWVIEEIDKIKYNIVKDIISKELK |
| Ga0214921_100753997 | 3300023174 | Freshwater | MTDEEWETALKSMNESVKKWVDEEIDKIKYNIIKDIINGDLEAL |
| Ga0247724_10409194 | 3300024239 | Deep Subsurface Sediment | MTDEEWETALKSMNEHAKKWVDEEVFKIKYNIIKD |
| Ga0255147_100017671 | 3300024289 | Freshwater | MTDEEWETSLKSMNEYAKKWVDEEIDKIKYNIIKDIINGELNEKL |
| Ga0255147_100068332 | 3300024289 | Freshwater | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIVKDIINGDLEAL |
| Ga0255147_100080119 | 3300024289 | Freshwater | MTDEEWETSLKSMNEGVKKWVDEEIDKIKYNIIKDIINGDVEAL |
| Ga0244777_103332824 | 3300024343 | Estuarine | MTDEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIINGDLEAL |
| Ga0244775_100033829 | 3300024346 | Estuarine | MTDEEWETALKSMNEYAKKWVGEEIDKIKYNIIKDIINGELEAL |
| Ga0255167_10295292 | 3300024350 | Freshwater | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0255142_10705542 | 3300024352 | Freshwater | MTDEEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINEDLEAL |
| Ga0255144_10454624 | 3300024513 | Freshwater | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIIKDIIN |
| Ga0255273_10412971 | 3300024565 | Freshwater | TALKSMNEGVKKWVNEGIDKIKYNIIKDIINGDVEAL |
| Ga0255268_10987274 | 3300024572 | Freshwater | MTDEEWETSLKSMNEYAKKWVDEEIDKIKYNIIKDIINGDLEAL |
| Ga0256340_10936431 | 3300024865 | Freshwater | ETSLKSMNEYVMIWVDEEIDKIKYNIIKDIINGELYEKL |
| Ga0208546_10378485 | 3300025585 | Aqueous | MTDKEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINGDLEAL |
| Ga0208162_10617953 | 3300025674 | Aqueous | MTDEEWETALKSMNEYAKKWVGEEIDKIKYNIIKDLINKEDLKDD |
| Ga0208784_100447513 | 3300025732 | Aqueous | MTDEEWETSLKNLNENTKKWVDEEIDKIKYNIIKDIINGELNEKL |
| Ga0208784_10829073 | 3300025732 | Aqueous | MTDKEWETSLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0208784_12101243 | 3300025732 | Aqueous | MTDKEWETALKNLNENVKKWVDEEIDKIKYNVVKEIINRELK |
| Ga0255289_10736724 | 3300026571 | Freshwater | EEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINEDLEAL |
| Ga0255269_10772721 | 3300026573 | Freshwater | ETSLKSMNEGVKKWVDEEIDKIKYNIIKDIINGDVEAL |
| Ga0255074_10370552 | 3300027121 | Freshwater | MTDKEWETALKSMNESVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0208926_10479613 | 3300027205 | Estuarine | MTNEEWETALKSMNDGVRKWVNEEIDKIKYDIIKDIINGELK |
| Ga0209704_10222584 | 3300027693 | Freshwater Sediment | MTDEEWETSLKSMNEKAKKWVDEEIDKIKYNVVKELIQKETQND |
| Ga0209593_103031062 | 3300027743 | Freshwater Sediment | MIEEEWETSLKSLNEETKKWVDEEIFKIKYNVVKEIINRELKND |
| Ga0209288_100098835 | 3300027762 | Freshwater Sediment | MIEEEWETSLKSMNEYAKKWVDEEIFKIKYNVVKEIINRELKND |
| Ga0209770_1000044943 | 3300027769 | Freshwater Lake | MTDKEWETALKSMNEGVKKWVNEEIDKIKYNIIKDIINGELK |
| Ga0209287_101141714 | 3300027792 | Freshwater Sediment | MIEEEWETSLKSLNEETKKWVVEEIDKIKYNVVKEIINRELKND |
| Ga0209668_103847521 | 3300027899 | Freshwater Lake Sediment | MTDEKWETALKNLNEGVKKWVNEEIDKIKYNVVKEIINRELKND |
| Ga0209668_109033861 | 3300027899 | Freshwater Lake Sediment | LKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0209893_10003443 | 3300027940 | Sand | MTDEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIISKELK |
| Ga0247723_11210623 | 3300028025 | Deep Subsurface Sediment | MTDEEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0168647_10105015 | 3300029199 | Deep Subsurface | MTDEEWETSLKSMNEEAKKRVDEEIDKIKYNVVKEIINRELKND |
| Ga0315900_107454992 | 3300031787 | Freshwater | MTDEEWETSLKNLNENVKKWVDEEIDKIKYNIIKDIINGELNETL |
| Ga0315909_106166642 | 3300031857 | Freshwater | MTDEEWETTLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEALXVKNKS |
| Ga0315904_1001065211 | 3300031951 | Freshwater | MTDKEWETSLKSMNEGVKKWVNEEIDKIKYNIIKDIINGELNEKL |
| Ga0315904_102590172 | 3300031951 | Freshwater | MTNEEWETSLKNLNENAKKWVDEEIFKIKYNIIKDLINKEDLKDD |
| Ga0334982_0030772_1698_1832 | 3300033981 | Freshwater | MTDEEWETALKSMNDGVKKWVVEEIDKIKYNVVKDIINGDLEAL |
| Ga0334998_0285676_657_791 | 3300034019 | Freshwater | MTNEEWETALKSMNENVKKWVDEEIDKIKYNIIKDIINEDLETL |
| Ga0335004_0483071_169_303 | 3300034021 | Freshwater | MTDKEWETTLKSMNEGVKKWVDEEIDKIKYNIIKDIINGDLEAL |
| Ga0334987_0849079_333_467 | 3300034061 | Freshwater | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYNVVKDIINRELKND |
| Ga0334995_0358325_330_464 | 3300034062 | Freshwater | MTDEEWETSLKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0335019_0144998_570_704 | 3300034066 | Freshwater | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYSIIKDIINGDLEAL |
| Ga0310127_079225_39_173 | 3300034072 | Fracking Water | MTDKEWETALKSMNEGVKKWVDEEIDKIKYNIIKDIINEDLEAL |
| Ga0310127_182259_496_630 | 3300034072 | Fracking Water | MTDEEWETALKSMNENVKKWVDEEIDKIKYNIIKDIINGDLEAL |
| Ga0310130_0000228_43730_43867 | 3300034073 | Fracking Water | MTDEEWETALKSMNEHAKKWVDEEVFKIKYNIIKDLINKEYLKDD |
| Ga0310130_0059899_753_890 | 3300034073 | Fracking Water | MTDEEWEIALKSMNEETKKWVDEEIFKIKYNIIKDLINKKDLKDD |
| Ga0335029_0000154_57874_58002 | 3300034102 | Freshwater | MTDEEWETTLKSMNENVKKWVNEEIDKIKYSIIKDIIDKELK |
| Ga0335029_0103267_1600_1734 | 3300034102 | Freshwater | MTDEEWETSLKSMNEYARKWVVEEMDKIKYNVVKEIIQRETKND |
| Ga0335029_0345197_627_761 | 3300034102 | Freshwater | MTDEEWETSLKSMNESVKKWVDEEIDKIKYNVVKEIINRELKND |
| Ga0335051_0054649_212_346 | 3300034109 | Freshwater | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYNIIKDIINEDLEAL |
| Ga0335066_0109175_1235_1363 | 3300034112 | Freshwater | MTDEEWETALKSMNDGVRKWVNEEIDKIKYNIIKDIINGELK |
| Ga0335007_0011727_188_316 | 3300034283 | Freshwater | MTDEEWETALKSMNDGVKKWVDEEIDKIKYNIIKDIIDKELK |
| Ga0335007_0018632_188_316 | 3300034283 | Freshwater | MTDEEWETTLKSMNEGVKKWVNEEIDKIKYSIIKDIIDKELK |
| ⦗Top⦘ |