


| Basic Information | |
|---|---|
| Family ID | F048204 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.65 % |
| % of genes from short scaffolds (< 2000 bps) | 88.51 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.649 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.324 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.162 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.324 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 0.00% Coil/Unstructured: 95.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF02321 | OEP | 72.30 |
| PF06912 | DUF1275 | 2.70 |
| PF03600 | CitMHS | 0.68 |
| PF14833 | NAD_binding_11 | 0.68 |
| PF14559 | TPR_19 | 0.68 |
| PF00034 | Cytochrom_C | 0.68 |
| PF03404 | Mo-co_dimer | 0.68 |
| PF00563 | EAL | 0.68 |
| PF10017 | Methyltransf_33 | 0.68 |
| PF16576 | HlyD_D23 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 144.59 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 2.70 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.68 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.68 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.68 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.65 % |
| Unclassified | root | N/A | 1.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02H8TQI | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000955|JGI1027J12803_103505702 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300000955|JGI1027J12803_103849162 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300002558|JGI25385J37094_10025139 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300002908|JGI25382J43887_10518498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300005167|Ga0066672_10210875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1240 | Open in IMG/M |
| 3300005177|Ga0066690_10276016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1131 | Open in IMG/M |
| 3300005178|Ga0066688_10671437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300005178|Ga0066688_10715943 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005180|Ga0066685_10976741 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005181|Ga0066678_10784847 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005187|Ga0066675_10580411 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005332|Ga0066388_107458391 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005440|Ga0070705_100341089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
| 3300005440|Ga0070705_101434989 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005440|Ga0070705_101682743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 536 | Open in IMG/M |
| 3300005445|Ga0070708_101498074 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005454|Ga0066687_10469044 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005467|Ga0070706_100497350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300005467|Ga0070706_101102444 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005467|Ga0070706_101126291 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005467|Ga0070706_101936334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
| 3300005468|Ga0070707_102071046 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005471|Ga0070698_101526601 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005518|Ga0070699_100257303 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005518|Ga0070699_100271656 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300005538|Ga0070731_10577770 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005540|Ga0066697_10027465 | All Organisms → cellular organisms → Bacteria | 3134 | Open in IMG/M |
| 3300005540|Ga0066697_10341634 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005555|Ga0066692_10547747 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005556|Ga0066707_10761831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005556|Ga0066707_10857126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300005557|Ga0066704_10634800 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005559|Ga0066700_10751435 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005561|Ga0066699_10396507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300005617|Ga0068859_102955954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 520 | Open in IMG/M |
| 3300006034|Ga0066656_10036661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2762 | Open in IMG/M |
| 3300006049|Ga0075417_10163559 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300006794|Ga0066658_10233184 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300006796|Ga0066665_10611434 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300006797|Ga0066659_10833121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
| 3300006806|Ga0079220_10895295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300006845|Ga0075421_101480051 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300006852|Ga0075433_10400983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
| 3300006854|Ga0075425_100181355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2418 | Open in IMG/M |
| 3300006854|Ga0075425_101250064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 843 | Open in IMG/M |
| 3300006854|Ga0075425_101603549 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006871|Ga0075434_101116154 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300006880|Ga0075429_100048110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3709 | Open in IMG/M |
| 3300006880|Ga0075429_100917831 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006903|Ga0075426_10373746 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300006903|Ga0075426_11008012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 629 | Open in IMG/M |
| 3300006904|Ga0075424_100194359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2154 | Open in IMG/M |
| 3300006914|Ga0075436_100963407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300006969|Ga0075419_11030307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 600 | Open in IMG/M |
| 3300007076|Ga0075435_100847259 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300007076|Ga0075435_100849250 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300007076|Ga0075435_101693387 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300007255|Ga0099791_10542765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300007265|Ga0099794_10374107 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009012|Ga0066710_102325970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 779 | Open in IMG/M |
| 3300009012|Ga0066710_102478208 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009012|Ga0066710_104885594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300009090|Ga0099827_10526862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1016 | Open in IMG/M |
| 3300009090|Ga0099827_11146631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 675 | Open in IMG/M |
| 3300009094|Ga0111539_10808032 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300009100|Ga0075418_11632715 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009100|Ga0075418_12023759 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009137|Ga0066709_102435423 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300009137|Ga0066709_103058249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
| 3300009143|Ga0099792_10437448 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300009143|Ga0099792_10491050 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300009147|Ga0114129_11895627 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300009147|Ga0114129_12990627 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009162|Ga0075423_11421625 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300010047|Ga0126382_12304141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300010336|Ga0134071_10091083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1439 | Open in IMG/M |
| 3300012096|Ga0137389_10182409 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300012096|Ga0137389_11702435 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012203|Ga0137399_10735432 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300012205|Ga0137362_10275067 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300012205|Ga0137362_10867483 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012349|Ga0137387_11309750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
| 3300012685|Ga0137397_10009078 | All Organisms → cellular organisms → Bacteria | 6921 | Open in IMG/M |
| 3300012918|Ga0137396_10712892 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300012918|Ga0137396_11186776 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012923|Ga0137359_10224604 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300012924|Ga0137413_11094055 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012924|Ga0137413_11304107 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012930|Ga0137407_10490796 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300012976|Ga0134076_10038734 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300012986|Ga0164304_10677602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 780 | Open in IMG/M |
| 3300015053|Ga0137405_1252892 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300015053|Ga0137405_1339639 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300015245|Ga0137409_10226439 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300015357|Ga0134072_10271721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 620 | Open in IMG/M |
| 3300017654|Ga0134069_1065044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1159 | Open in IMG/M |
| 3300017656|Ga0134112_10163169 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300017656|Ga0134112_10165247 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300017656|Ga0134112_10358844 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300018076|Ga0184609_10412060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300018433|Ga0066667_10145342 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300019377|Ga0190264_11680369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300019789|Ga0137408_1018798 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300019879|Ga0193723_1026101 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300019885|Ga0193747_1027718 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300019888|Ga0193751_1074770 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300020061|Ga0193716_1043796 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300021080|Ga0210382_10537457 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021168|Ga0210406_10965083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
| 3300021170|Ga0210400_11676313 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300021432|Ga0210384_11409745 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021432|Ga0210384_11885169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300021559|Ga0210409_10291171 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300025910|Ga0207684_11591369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300026277|Ga0209350_1085963 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300026285|Ga0209438_1150926 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300026296|Ga0209235_1043221 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300026297|Ga0209237_1023366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3486 | Open in IMG/M |
| 3300026297|Ga0209237_1056094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1945 | Open in IMG/M |
| 3300026298|Ga0209236_1224059 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300026313|Ga0209761_1194872 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300026318|Ga0209471_1071809 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1545 | Open in IMG/M |
| 3300026323|Ga0209472_1038544 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300026326|Ga0209801_1090566 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300026331|Ga0209267_1012689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4489 | Open in IMG/M |
| 3300026331|Ga0209267_1094405 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300026335|Ga0209804_1234434 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300026342|Ga0209057_1083119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1349 | Open in IMG/M |
| 3300026374|Ga0257146_1073822 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300026532|Ga0209160_1028908 | All Organisms → cellular organisms → Bacteria | 3529 | Open in IMG/M |
| 3300026537|Ga0209157_1034052 | All Organisms → cellular organisms → Bacteria | 2905 | Open in IMG/M |
| 3300026537|Ga0209157_1253738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
| 3300026542|Ga0209805_1172515 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300026548|Ga0209161_10299664 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 781 | Open in IMG/M |
| 3300027535|Ga0209734_1028861 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300027616|Ga0209106_1100210 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300027882|Ga0209590_10387247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 902 | Open in IMG/M |
| 3300027903|Ga0209488_11090449 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300027909|Ga0209382_10009814 | All Organisms → cellular organisms → Bacteria | 11964 | Open in IMG/M |
| 3300028536|Ga0137415_10433997 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300029636|Ga0222749_10577011 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300029911|Ga0311361_10614028 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031720|Ga0307469_11563549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300031720|Ga0307469_12544398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300032205|Ga0307472_101787953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.35% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_00125840 | 2065487018 | Soil | QAGLNGTEMIVKQPSVSLQEGQVVEPMETKDSSRR |
| JGI1027J12803_1035057022 | 3300000955 | Soil | QAGLHGNETIVSQPTVSLQEGQVVKPIQSKKTPQG* |
| JGI1027J12803_1038491622 | 3300000955 | Soil | IQSGLQGNETIVKQPTVSLQEGQVVTPLESPHPSGG* |
| JGI25385J37094_100251391 | 3300002558 | Grasslands Soil | RFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKSSSGG* |
| JGI25382J43887_105184982 | 3300002908 | Grasslands Soil | GNTLRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSFQEGQRVTPIESKNSSGG* |
| Ga0066672_102108751 | 3300005167 | Soil | FGTSIDVQAGLQGHETIVKQPTVSFQEGQRVTPIESKTSSGG* |
| Ga0066690_102760161 | 3300005177 | Soil | FGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG* |
| Ga0066688_106714371 | 3300005178 | Soil | LHFQQVVVGRDLGTAIDVQSGLEGHETVVKQPTVSLQEGQAVNPIAAPAAAGG* |
| Ga0066688_107159432 | 3300005178 | Soil | LRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG* |
| Ga0066685_109767411 | 3300005180 | Soil | TSIDVQAGLQGHETIVTQPTVSLQEGQRVTPIESKSSSGG* |
| Ga0066678_107848471 | 3300005181 | Soil | SIDVQAGLDGNETIVKQPTVSLQEGRVVTPIASPHASGS* |
| Ga0066675_105804111 | 3300005187 | Soil | LGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPATAGG* |
| Ga0066388_1074583912 | 3300005332 | Tropical Forest Soil | PVVPGRDFGMSIDIQAGLNGTEQVVKQPTVSLQEGQVVEPMESQDSSWR* |
| Ga0070705_1003410891 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LHFQDVVVGRDLGTSIDIQAGLRGDEAVVQQPRVSLQEGQAVTPIESRIGSGG* |
| Ga0070705_1014349892 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDVQSELQGHEAVMKQPTVALQEDQIVTPIESPNPSGGD* |
| Ga0070705_1016827432 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDIQAGLHGDEMVVSQPTVSLQEGQVVKPIEPPSPAGG* |
| Ga0070708_1014980742 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DLGTAIDVQAGLQGNETIVKLPTVALQEGQIVNPVAAPATNGG* |
| Ga0066687_104690441 | 3300005454 | Soil | LGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPAAAGG* |
| Ga0070706_1004973502 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RDLGASIDIQSGLRGDETIVKQPTVSLQEGQVVKPIEAQKPSGG* |
| Ga0070706_1011024442 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRDFGTSIDIQAGLQGNETIVKQPTVSLQEGQIVTPIESPNPSGG* |
| Ga0070706_1011262912 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | HFQDVAVGRDLGTTIDIQAGLNGNETIVSQPTVSLQEGQVVKPIQSQKTPQG* |
| Ga0070706_1019363342 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGRDFGTSIDVQAGLQGHETIVTQPTVSLQEGQRVTPIESKSSSGG* |
| Ga0070707_1020710462 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HFQPVVFGRDLGASIDIQSGLRGDETIVKQPTVSLQEGQVVKPIEAQKPSGG* |
| Ga0070698_1015266012 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LGRDFGTSIDIQGGLQGNEAVVKQPTVSLQEDQVVTPIESPNPSGG* |
| Ga0070699_1002573031 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VGRDLGTAIDVQAGLQGNETIVKLPTVALQEGQIVNPVAAPATNGS* |
| Ga0070699_1002716561 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ASIDIQSGLRGDETIVKQPTVALQEGQVVKPIEAQKPSGG* |
| Ga0070731_105777702 | 3300005538 | Surface Soil | ELGRDFGMSIDIQEGLYGTETIVKQPTVSLEEGQVVRPIESQGSSWH* |
| Ga0066697_100274651 | 3300005540 | Soil | LRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKSSSGG* |
| Ga0066697_103416342 | 3300005540 | Soil | IGENNTLHFQDVELGRDFGMSIDVQAGLHGTETIVKQPTVSLQEGQVVKPIESQDVSWR* |
| Ga0066692_105477472 | 3300005555 | Soil | VVLGRDFGTSIDVQSGLRGDETIVRQPTVSLQEGQVVTPVEPPKPSGG* |
| Ga0066707_107618312 | 3300005556 | Soil | FGMSIDIQEGLNGTEIIVKQPSVSLQEGQVVEPMESQDSSWR* |
| Ga0066707_108571261 | 3300005556 | Soil | GTSIDIQTGLQGNETIVKQPTVSLQEGELVTPLASQDPSGS* |
| Ga0066704_106348002 | 3300005557 | Soil | RFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSFQEGQRVTPIESKNSSGG* |
| Ga0066700_107514352 | 3300005559 | Soil | RDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG* |
| Ga0066699_103965072 | 3300005561 | Soil | DFGTSIDVQAGLQGDETIVKQPTVSLQEGQVVAPIESPDPSGG* |
| Ga0068859_1029559541 | 3300005617 | Switchgrass Rhizosphere | FGTSIDIQAGLLGNETIVKQPTVSLQEGQVVTPLESPTPSGG* |
| Ga0066656_100366614 | 3300006034 | Soil | FQQVVVGRDLGAAVDVQSGLEGNETIVAQPTVSLQEGQTVNPVAAPATNGG* |
| Ga0075417_101635592 | 3300006049 | Populus Rhizosphere | IQSGLRGDESVVQQPRVSLEEGQTVTPIQARPGSGG* |
| Ga0066658_102331842 | 3300006794 | Soil | GRDLGTSIDIQAGLRGNELIVSQPTVSLQEGQLVNPIESKNPSGG* |
| Ga0066665_106114342 | 3300006796 | Soil | GRDFGMSIDVQAGLHGTETIVKQPTVSLQEGQVVKPIESQDVSWR* |
| Ga0066659_108331212 | 3300006797 | Soil | DVQSGLEGHETVVKQPTVSLQEGQTVNPVASPAAAGG* |
| Ga0066659_111624092 | 3300006797 | Soil | RDFGDTIDVQAGLSGGETVVKQPDVSMQDAQVVTPVESQNAP* |
| Ga0079220_108952951 | 3300006806 | Agricultural Soil | EVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSD* |
| Ga0075421_1014800512 | 3300006845 | Populus Rhizosphere | DFGMSIDIQAGLNGTELVLKQPTVSLQEGQVVEPMESQDSSWR* |
| Ga0075433_104009832 | 3300006852 | Populus Rhizosphere | GVSIDIQAGLNGNETIVKQPTVSLQEGQVVQPVESR* |
| Ga0075425_1001813554 | 3300006854 | Populus Rhizosphere | FQKVTVGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVKPIQSQKTPQG* |
| Ga0075425_1012500641 | 3300006854 | Populus Rhizosphere | QSGLEGTETIVKQPTVSLQEGQIVNPVASSAAAGG* |
| Ga0075425_1016035491 | 3300006854 | Populus Rhizosphere | PGNTLRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKNSAGD* |
| Ga0075434_1011161542 | 3300006871 | Populus Rhizosphere | FQPVVLGRDFGMSIDVQAGLNGAEMIVKQPSVSLQEGQVVEPMESQDSSWR* |
| Ga0075429_1000481107 | 3300006880 | Populus Rhizosphere | SMDIQAGLQGNETIVSQPTVSLQEGQVVKPIQSQKTPQG* |
| Ga0075429_1009178312 | 3300006880 | Populus Rhizosphere | IDIQAGLQGHEMIVKQPTVSFQEGQRVTPIESKNSSGS* |
| Ga0075426_103737462 | 3300006903 | Populus Rhizosphere | SMDIQAGLQGNETIVSQPTVSLQEGQVVNPIQSQKTPQG* |
| Ga0075426_110080121 | 3300006903 | Populus Rhizosphere | IDVQAGLEGHETIVKQPTVSLQEGQTVNPVAAPVATGG* |
| Ga0075424_1001943593 | 3300006904 | Populus Rhizosphere | EVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKNSAGD* |
| Ga0075436_1009634072 | 3300006914 | Populus Rhizosphere | GTVIDVQAGLEGHETIVKQPTVSLQEGQTVNPVAAPVATGG* |
| Ga0075419_110303072 | 3300006969 | Populus Rhizosphere | VGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVNPIQSQKTPQG* |
| Ga0075435_1008472591 | 3300007076 | Populus Rhizosphere | DFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSAGD* |
| Ga0075435_1008492501 | 3300007076 | Populus Rhizosphere | DFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSD* |
| Ga0075435_1016933872 | 3300007076 | Populus Rhizosphere | VVLGRDFGTSIDIQAGLQGNEILVKQPTVSLQEGQVVAPIESPNPSGG* |
| Ga0099791_105427651 | 3300007255 | Vadose Zone Soil | AGLQGNELVVSQPTVSLQEGQVVKPIESHSPSGG* |
| Ga0099794_103741071 | 3300007265 | Vadose Zone Soil | AGNTLRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSLQEGQRVTPIESKNSSGG* |
| Ga0066710_1023259701 | 3300009012 | Grasslands Soil | LHFQQVVVGRDLGTAIDVQSGLEGHETIVKQPTVSLQEGQIVNPVASPVAAGG |
| Ga0066710_1024782082 | 3300009012 | Grasslands Soil | ENNTLHFQDVELGRDFGMSIDVQAGLHGTETIVKQPTVSLQEGQVVKPIESQDVSWR |
| Ga0066710_1048855942 | 3300009012 | Grasslands Soil | GRDFGTSIDIQTGLQGNETIVKQPTVSLQEGQLVTPLASQDTSGG |
| Ga0099827_105268621 | 3300009090 | Vadose Zone Soil | TIDVQSGLEGNETIVKQPTVSLQEGQTVNPIASQAAAGG* |
| Ga0099827_111466312 | 3300009090 | Vadose Zone Soil | RDFGTSIDIQGGLQGNEAVVKQPTVSLQEGQVVTPIESPNPSGG* |
| Ga0111539_108080321 | 3300009094 | Populus Rhizosphere | TSIDVQAGLQGHELIVKQPTVSLQEGQRVTPVEPPSSSGR* |
| Ga0075418_116327151 | 3300009100 | Populus Rhizosphere | RDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVKPLQSQKTPQG* |
| Ga0075418_120237592 | 3300009100 | Populus Rhizosphere | GRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVNPIQSQKTPQG* |
| Ga0066709_1024354232 | 3300009137 | Grasslands Soil | FGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKSSSGG* |
| Ga0066709_1030582491 | 3300009137 | Grasslands Soil | QAGLEGNERIVKQPTVSLQEGQTVNPIDSRAAAGG* |
| Ga0099792_104374482 | 3300009143 | Vadose Zone Soil | FQPVVLGRDFGTSIDIQGGLQGNETIVEQPTVSLLEGQLVKPITSRTRSGG* |
| Ga0099792_104910502 | 3300009143 | Vadose Zone Soil | FQPVVLGRDLGGSIDIQNGLRGDEAIVKQPTVSLKEGQVVTPIAAQKPSGG* |
| Ga0114129_118956272 | 3300009147 | Populus Rhizosphere | YQPVVVGRDLGTVIDVQAGLEGHETIVKQPTVSLQEGQTVNPVTAPVATGG* |
| Ga0114129_129906272 | 3300009147 | Populus Rhizosphere | LPVVLGRDFGNSIDIQAGLTGGEAIVQQPRVSLKEGQAVKAIEAQHSP* |
| Ga0075423_114216252 | 3300009162 | Populus Rhizosphere | IDIQSGLQGNETIVKQPTVSLQEGQVVTPLESPTPSGG* |
| Ga0126382_123041411 | 3300010047 | Tropical Forest Soil | KVTIGRDLGTSIDIQAGLHGNETIVKQPTVSLQEEQVVNPIESKTQ* |
| Ga0134071_100910832 | 3300010336 | Grasslands Soil | VVGRDLGAAIDVQSGLEGNETIVKQPTVSLQEGQIVNPIASPAAAGG* |
| Ga0137389_101824091 | 3300012096 | Vadose Zone Soil | IDIQAGLHGGETIVKQPTVSYQEGQVVRPIPPSPAGG* |
| Ga0137389_117024352 | 3300012096 | Vadose Zone Soil | QNGLRGDETIVKQPTVSLQEGQVVRPIEPQKPSGG* |
| Ga0137399_107354321 | 3300012203 | Vadose Zone Soil | IQNGLRGDEAIVKQPTVSMHEGQVVRPIASAPSGR* |
| Ga0137362_102750672 | 3300012205 | Vadose Zone Soil | VGRDLGTAIDVQSGLEGHETVVKQPTVSLQEGQVVTPVAAPATNGG* |
| Ga0137362_108674832 | 3300012205 | Vadose Zone Soil | QGGLQGNETIVEQPTVSLVEGQLVKPIKSRTPSGG* |
| Ga0137387_113097501 | 3300012349 | Vadose Zone Soil | QAGLQGNETIVKQPTVSLQEGQIVTPISSADPPGD* |
| Ga0137397_1000907811 | 3300012685 | Vadose Zone Soil | RFQQVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKSSSGR* |
| Ga0137396_107128922 | 3300012918 | Vadose Zone Soil | EVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG* |
| Ga0137396_111867761 | 3300012918 | Vadose Zone Soil | REVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG* |
| Ga0137359_102246041 | 3300012923 | Vadose Zone Soil | FQQVVVGRDLGTTIDVQSGLEGNETIVKLPTVSLQEGQVVTPVAAPATNGG* |
| Ga0137413_110940551 | 3300012924 | Vadose Zone Soil | TIDIQNGLRGDETIVKQPTESLREGQGVRPLTSAPSGT* |
| Ga0137413_113041071 | 3300012924 | Vadose Zone Soil | RDFGDTIDVQTGLSGNELIVKQPTVSLQQGQVVSPVESQNAPQH* |
| Ga0137407_104907961 | 3300012930 | Vadose Zone Soil | RFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSSGG* |
| Ga0134076_100387341 | 3300012976 | Grasslands Soil | DFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSPGS* |
| Ga0164304_106776022 | 3300012986 | Soil | LGTSIDIQAGLHGNEMVVSQPTVSLQEGQVVKPIEPPGPAGG* |
| Ga0137405_12528922 | 3300015053 | Vadose Zone Soil | AGLRGDETIVKQPTVSLQEGQRVTPIEPKNSSGR* |
| Ga0137405_13396393 | 3300015053 | Vadose Zone Soil | SDGKLRLQNVTVGRDFGDTIDVQAGLSGNELIVKQPTVSLQQGQVVSPVESQNAPQH* |
| Ga0137409_102264391 | 3300015245 | Vadose Zone Soil | DIQAGLTGDESIVKQPTVSLQEGQVVRPIAPQKPSGG* |
| Ga0134072_102717211 | 3300015357 | Grasslands Soil | AIDVQSGLEGTETIVKQPKVSLQEGQTVNPIASPAAAGG* |
| Ga0134069_10650442 | 3300017654 | Grasslands Soil | LGRDLGSAIDVQSGLEGDETIVKQPTVSLQEGQIVNPIASPAAAGG |
| Ga0134112_101631691 | 3300017656 | Grasslands Soil | NKLHFQHVVLGRDLGSAIDVQSGLEGTETIVKQPTVSLQEGQTVNPIASPAAAGG |
| Ga0134112_101652471 | 3300017656 | Grasslands Soil | TSIDIQAGLNGNEMIVKQPTVSLQEGQLVNPIESKNPSGA |
| Ga0134112_103588441 | 3300017656 | Grasslands Soil | TSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKNSSGR |
| Ga0184609_104120601 | 3300018076 | Groundwater Sediment | IDIQAGLNGNEMIVKQPTVSLQEGQLVNPIESKNPSGG |
| Ga0066667_101453421 | 3300018433 | Grasslands Soil | TLRFQEVVLGRDFGTSIDVQAGLEGHETIMKQPTVSFQEGQRVTPIESKTSSGG |
| Ga0190264_116803692 | 3300019377 | Soil | LHSQKVTVGRDLGTSIDIQAGLQGNETIVSQPTVSLQEGQVVKPIESKDPPTG |
| Ga0137408_10187981 | 3300019789 | Vadose Zone Soil | RFQQVVLGRDFGTSIDIQAGLQGHETIVKQPTVSFQEGQRVTPIESKNSSGG |
| Ga0193723_10261013 | 3300019879 | Soil | HFQDVVIGRDLGTSIDIQAGLHGDEMVVSQPTVSLQEGQVVKPIEPPSPAGG |
| Ga0193747_10277181 | 3300019885 | Soil | QLHFQDVVIGRDLGTSIDIQAGLHGDEMVVSQPTVSLQEGQVVKPIEPPSPAGG |
| Ga0193751_10747703 | 3300019888 | Soil | VVIGRDLGTSIDIQAGLHGDEVVVSQPTVSLQEGQVVKPIEPPS |
| Ga0193716_10437963 | 3300020061 | Soil | LGTLIDIQAGLHGSETIVSQPTVSLQEGQVVKPIQSQKTPQG |
| Ga0210401_103909981 | 3300020583 | Soil | QAGLSGNETVVKQPDVSLQDGQVVTPIESQNALQG |
| Ga0210382_105374571 | 3300021080 | Groundwater Sediment | RDLGTAIDTQAGLHGSEMVVSQPTVSLQEGQVVKPIESRGPSGG |
| Ga0210406_109650831 | 3300021168 | Soil | DVQAGLEGHETIVRQPTVSLQEGQTVNPVAAPLATGG |
| Ga0210400_116763132 | 3300021170 | Soil | GLRRDFGVSIDIQSGLNGNEIIVKQPTVSLQEGQLVKPVESQTTASR |
| Ga0210384_114097451 | 3300021432 | Soil | DIQAGLRGDESIVKQPTVSLQEGQVVTPIEPQKPSGD |
| Ga0210384_118851691 | 3300021432 | Soil | QAGLEGHETIVRQPTVSLQEGQTVNPVAAPLATGG |
| Ga0210409_102911712 | 3300021559 | Soil | GESIDIQNGLRGDETIVKQPTVSLQEGQVVRPIEPQKPSGQ |
| Ga0207684_115913692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGTAIDIQAGLHGNETIVKQPTVSLQEGQLVNPIESKNPLNS |
| Ga0209350_10859631 | 3300026277 | Grasslands Soil | GNTLRFQEVVLGRDFGTSIDVQAGLEGHETIMKQPTVSFQEGQRVTPIESKTSSGG |
| Ga0209438_11509262 | 3300026285 | Grasslands Soil | GAGNTIRFRDVTPGRDLGTSVDIQAGLKGNESIVTQPTVSLQEGQIVEPLESPSTH |
| Ga0209235_10432213 | 3300026296 | Grasslands Soil | QSGLEGDETIVKQPTVSLQEGQIVNPIASPAAAGG |
| Ga0209237_10233666 | 3300026297 | Grasslands Soil | TLRFQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPVESKNSPGG |
| Ga0209237_10560941 | 3300026297 | Grasslands Soil | DLGTVIDVQSGLEGDETIVKQPTVSLQEGQTVNPIASPAAAGG |
| Ga0209236_12240591 | 3300026298 | Grasslands Soil | FQEVVLGRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIESKSSSGG |
| Ga0209761_11948721 | 3300026313 | Grasslands Soil | FQEVVVGRDFGTAIDIQAGLQGNETIVKQPTVSLQEGQVVTPVEPKNSSGG |
| Ga0209471_10718091 | 3300026318 | Soil | QVVVGRDLGTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPAAAGG |
| Ga0209472_10385443 | 3300026323 | Soil | GTAIDVQSGLEGHETVVKQPTVSLQEGQTVNPVASPATAGG |
| Ga0209801_10905662 | 3300026326 | Soil | LRFQEVVLGRDFGTSIDIQAGLQGDETIVKQPTVSFQEGQRVTPIESKNSSGG |
| Ga0209267_10126891 | 3300026331 | Soil | GRDFGTSIDVQAGLQGHETIVKQPTVSLQEGQRVTPIEPKSSSGG |
| Ga0209267_10944052 | 3300026331 | Soil | IQAGLNGNELIVKQPTVSLQEGQLVNPIQSKNPSGA |
| Ga0209804_12344341 | 3300026335 | Soil | GASIDIQAGLNGGEAIIAQPTVSLQEGQVVKAINAPRQAGS |
| Ga0209057_10831192 | 3300026342 | Soil | IDVQSGLEGDETIVKQPTVSLQEGQTVNPIASPAAAGG |
| Ga0257146_10738221 | 3300026374 | Soil | HFQDVVIGRDLGTSIDIQAGLHGDEVVVSQPTVSLQEGQVVKPIEPPSPAGG |
| Ga0209160_10289081 | 3300026532 | Soil | LHFQQVVVGRDLGAAIDVQSGLEGDETIVKQPTVSLQEGQIVNPIASPAAAGG |
| Ga0209157_10340521 | 3300026537 | Soil | FQQVVVGRDLGTAIDVQSGLEGNDTIVKQPTVSLQEGQIVNPIASPAAAGG |
| Ga0209157_12537382 | 3300026537 | Soil | RDFGTAIDVQAGLQGDELVVKQPTVSLQEGQAVTPVTPPNPAGG |
| Ga0209805_11725152 | 3300026542 | Soil | DFGTSIDVQAGLQGDETIVKQPTVSLQEGQVVAPIESPDPSGG |
| Ga0209161_102996642 | 3300026548 | Soil | RDFGNSIDIQVGLQGNEAVVKQPTVSLREGQVVTPIESPNPSSGQPRSGG |
| Ga0209734_10288613 | 3300027535 | Forest Soil | DFGDSIDVQAGLHGHESIVKQPTVSLQEGQVVRPIASAQSGG |
| Ga0209106_11002102 | 3300027616 | Forest Soil | QEVVLGRDFGTSIDIQAGLQGHEMIVKQPTVSLQEGQRVTPIEPKNSSGG |
| Ga0209590_103872471 | 3300027882 | Vadose Zone Soil | QVVLGRDLGTTIDVQSGLEGNETIVKQPTVSLQEGQTVNPIASQAAAGG |
| Ga0209488_110904491 | 3300027903 | Vadose Zone Soil | PVVLGRDFGDSIDVQAGLHGRETIVRQPTVSLQEGQAVRPMSSAPSGT |
| Ga0209382_1000981413 | 3300027909 | Populus Rhizosphere | VTVGRDLGTSMDIQAGLQGNETIVSQPTVSLQEGQVVKPIQSQKTPQG |
| Ga0137415_104339971 | 3300028536 | Vadose Zone Soil | KLHFQDVVIGRDLGTSIDIQAGLHGNEMVVSQPTVSLQEGQVVKPIESHGPSGG |
| Ga0222749_105770111 | 3300029636 | Soil | DFGTSIDVQGGLEGHEAVVKQPTVALQEGQIVTPIESPSPSGGD |
| Ga0311361_106140281 | 3300029911 | Bog | RDFGDTIDVQAGLNGTETIVKQPDVSLQEGQVVTPVQPENAPQG |
| Ga0307469_115635492 | 3300031720 | Hardwood Forest Soil | TSIDIQAGLNGNDMIVKQPTVSLQEGQLVNPIESKNPSGS |
| Ga0307469_125443981 | 3300031720 | Hardwood Forest Soil | LGRDLGTSIDIQAGLNGNELIVSQPTVSLQEGQLVNPIESKNPSGS |
| Ga0307472_1017879532 | 3300032205 | Hardwood Forest Soil | RDFGTSIEIQAGLNGNELIVSQPTVSLQEGQLVQPIESKNS |
| ⦗Top⦘ |