


| Basic Information | |
|---|---|
| Family ID | F047814 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 41 residues |
| Representative Sequence | KMLSSYIDNHNFESVRASVNRVLDALWEMLSGVCRRHAIAC |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.99 % |
| % of genes from short scaffolds (< 2000 bps) | 89.93 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.658 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.805 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.570 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.034 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF13180 | PDZ_2 | 15.44 |
| PF13365 | Trypsin_2 | 14.09 |
| PF00595 | PDZ | 6.71 |
| PF13561 | adh_short_C2 | 3.36 |
| PF00271 | Helicase_C | 3.36 |
| PF02272 | DHHA1 | 1.34 |
| PF12812 | PDZ_1 | 1.34 |
| PF07687 | M20_dimer | 1.34 |
| PF01841 | Transglut_core | 1.34 |
| PF11138 | DUF2911 | 0.67 |
| PF01266 | DAO | 0.67 |
| PF05973 | Gp49 | 0.67 |
| PF00694 | Aconitase_C | 0.67 |
| PF02913 | FAD-oxidase_C | 0.67 |
| PF01797 | Y1_Tnp | 0.67 |
| PF13469 | Sulfotransfer_3 | 0.67 |
| PF15902 | Sortilin-Vps10 | 0.67 |
| PF16798 | DUF5069 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.67 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.67 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.67 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.66 % |
| Unclassified | root | N/A | 1.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01DPXGQ | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300000955|JGI1027J12803_100489830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300000956|JGI10216J12902_112192663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1298 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100171810 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300002914|JGI25617J43924_10114022 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005167|Ga0066672_10274545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes | 1090 | Open in IMG/M |
| 3300005179|Ga0066684_10778861 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300005332|Ga0066388_108773674 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005536|Ga0070697_100096203 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300005543|Ga0070672_102078604 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005548|Ga0070665_101265933 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005556|Ga0066707_10106057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes | 1732 | Open in IMG/M |
| 3300005556|Ga0066707_10711645 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300005557|Ga0066704_10295282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes | 1096 | Open in IMG/M |
| 3300005558|Ga0066698_10524801 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 804 | Open in IMG/M |
| 3300005559|Ga0066700_10205758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes | 1361 | Open in IMG/M |
| 3300005559|Ga0066700_11026786 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005561|Ga0066699_10932250 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005574|Ga0066694_10435950 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005575|Ga0066702_10052486 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300005575|Ga0066702_10482486 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005598|Ga0066706_11364861 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005764|Ga0066903_106028008 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005921|Ga0070766_11129502 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006031|Ga0066651_10388747 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300006175|Ga0070712_100427473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1099 | Open in IMG/M |
| 3300006791|Ga0066653_10234516 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300006797|Ga0066659_11652425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300006797|Ga0066659_11702313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300006800|Ga0066660_10033793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes | 3176 | Open in IMG/M |
| 3300006800|Ga0066660_10354553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes | 1193 | Open in IMG/M |
| 3300006854|Ga0075425_101776179 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300007788|Ga0099795_10619561 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009012|Ga0066710_101639683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 983 | Open in IMG/M |
| 3300009012|Ga0066710_102767214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 696 | Open in IMG/M |
| 3300009012|Ga0066710_104606394 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009088|Ga0099830_10221136 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1489 | Open in IMG/M |
| 3300009090|Ga0099827_10876057 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009098|Ga0105245_11914896 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009137|Ga0066709_100897573 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1291 | Open in IMG/M |
| 3300009137|Ga0066709_104480964 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009137|Ga0066709_104593883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 505 | Open in IMG/M |
| 3300009143|Ga0099792_10872294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300009792|Ga0126374_11002401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 655 | Open in IMG/M |
| 3300010301|Ga0134070_10152241 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 830 | Open in IMG/M |
| 3300010322|Ga0134084_10137809 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 811 | Open in IMG/M |
| 3300010322|Ga0134084_10141530 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300010322|Ga0134084_10181396 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010325|Ga0134064_10045440 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300010325|Ga0134064_10176594 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 753 | Open in IMG/M |
| 3300010333|Ga0134080_10640793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 521 | Open in IMG/M |
| 3300010373|Ga0134128_11318878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 795 | Open in IMG/M |
| 3300010401|Ga0134121_10291863 | Not Available | 1441 | Open in IMG/M |
| 3300012096|Ga0137389_10975369 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012096|Ga0137389_11066872 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 692 | Open in IMG/M |
| 3300012198|Ga0137364_10507607 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012198|Ga0137364_11409612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 516 | Open in IMG/M |
| 3300012200|Ga0137382_10064669 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 2326 | Open in IMG/M |
| 3300012201|Ga0137365_10147442 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1768 | Open in IMG/M |
| 3300012209|Ga0137379_11071528 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012211|Ga0137377_11212289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 684 | Open in IMG/M |
| 3300012285|Ga0137370_10032554 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 2719 | Open in IMG/M |
| 3300012285|Ga0137370_10957195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
| 3300012349|Ga0137387_10154591 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1635 | Open in IMG/M |
| 3300012349|Ga0137387_11140560 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012357|Ga0137384_10833006 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012362|Ga0137361_11351215 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 636 | Open in IMG/M |
| 3300012362|Ga0137361_11748310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 541 | Open in IMG/M |
| 3300012685|Ga0137397_10710890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 746 | Open in IMG/M |
| 3300012898|Ga0157293_10223565 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 581 | Open in IMG/M |
| 3300012914|Ga0157297_10133871 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 788 | Open in IMG/M |
| 3300012917|Ga0137395_10144590 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300012923|Ga0137359_10595911 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300012927|Ga0137416_10189764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1641 | Open in IMG/M |
| 3300012927|Ga0137416_11993382 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 532 | Open in IMG/M |
| 3300012929|Ga0137404_10836970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 837 | Open in IMG/M |
| 3300012944|Ga0137410_11290302 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012955|Ga0164298_11601220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 3300012971|Ga0126369_10656760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1123 | Open in IMG/M |
| 3300012977|Ga0134087_10119553 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1120 | Open in IMG/M |
| 3300012977|Ga0134087_10748783 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012984|Ga0164309_10531641 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 906 | Open in IMG/M |
| 3300012984|Ga0164309_10952426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 704 | Open in IMG/M |
| 3300013296|Ga0157374_11282222 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300014488|Ga0182001_10512026 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300015357|Ga0134072_10119914 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300015359|Ga0134085_10045199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1751 | Open in IMG/M |
| 3300015371|Ga0132258_12720735 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1234 | Open in IMG/M |
| 3300015374|Ga0132255_104389994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
| 3300017654|Ga0134069_1095000 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 969 | Open in IMG/M |
| 3300017654|Ga0134069_1290151 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 577 | Open in IMG/M |
| 3300017659|Ga0134083_10012703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2853 | Open in IMG/M |
| 3300018071|Ga0184618_10102419 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1124 | Open in IMG/M |
| 3300018073|Ga0184624_10290031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 734 | Open in IMG/M |
| 3300018433|Ga0066667_10195364 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1481 | Open in IMG/M |
| 3300018920|Ga0190273_10396421 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300019361|Ga0173482_10601601 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300019877|Ga0193722_1038207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1233 | Open in IMG/M |
| 3300019883|Ga0193725_1012905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2350 | Open in IMG/M |
| 3300019883|Ga0193725_1093526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 718 | Open in IMG/M |
| 3300019885|Ga0193747_1101212 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300019889|Ga0193743_1162200 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 755 | Open in IMG/M |
| 3300020015|Ga0193734_1002428 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 3300 | Open in IMG/M |
| 3300021080|Ga0210382_10228555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 812 | Open in IMG/M |
| 3300021344|Ga0193719_10053238 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1754 | Open in IMG/M |
| 3300021344|Ga0193719_10318573 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300021560|Ga0126371_10798478 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300022756|Ga0222622_10346843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1034 | Open in IMG/M |
| 3300023058|Ga0193714_1018005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1051 | Open in IMG/M |
| 3300025910|Ga0207684_11325825 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 592 | Open in IMG/M |
| 3300025923|Ga0207681_10002222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 12352 | Open in IMG/M |
| 3300025927|Ga0207687_10963297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 731 | Open in IMG/M |
| 3300025928|Ga0207700_11708644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 555 | Open in IMG/M |
| 3300025929|Ga0207664_10024478 | All Organisms → cellular organisms → Bacteria | 4537 | Open in IMG/M |
| 3300025944|Ga0207661_10080818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 2683 | Open in IMG/M |
| 3300026142|Ga0207698_12735423 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300026295|Ga0209234_1137948 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300026314|Ga0209268_1179135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 523 | Open in IMG/M |
| 3300026324|Ga0209470_1207805 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300026332|Ga0209803_1165734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 842 | Open in IMG/M |
| 3300026332|Ga0209803_1369240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 500 | Open in IMG/M |
| 3300026334|Ga0209377_1065031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1585 | Open in IMG/M |
| 3300026498|Ga0257156_1050082 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 859 | Open in IMG/M |
| 3300026523|Ga0209808_1285535 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300026527|Ga0209059_1173770 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 755 | Open in IMG/M |
| 3300026529|Ga0209806_1154516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 870 | Open in IMG/M |
| 3300026530|Ga0209807_1057340 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1777 | Open in IMG/M |
| 3300026538|Ga0209056_10208044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1425 | Open in IMG/M |
| 3300026557|Ga0179587_10865329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 596 | Open in IMG/M |
| 3300027587|Ga0209220_1099531 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300027635|Ga0209625_1095279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 667 | Open in IMG/M |
| 3300027678|Ga0209011_1011309 | Not Available | 2977 | Open in IMG/M |
| 3300027882|Ga0209590_10016107 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300028707|Ga0307291_1002842 | All Organisms → cellular organisms → Bacteria | 3755 | Open in IMG/M |
| 3300028718|Ga0307307_10300171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300028784|Ga0307282_10073919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1553 | Open in IMG/M |
| 3300028793|Ga0307299_10393858 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 519 | Open in IMG/M |
| 3300028796|Ga0307287_10380421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 532 | Open in IMG/M |
| 3300028884|Ga0307308_10364654 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300030945|Ga0075373_11598543 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 768 | Open in IMG/M |
| 3300031231|Ga0170824_101829323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 816 | Open in IMG/M |
| 3300031469|Ga0170819_17314381 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1243 | Open in IMG/M |
| 3300031573|Ga0310915_10975688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 592 | Open in IMG/M |
| 3300031719|Ga0306917_10420814 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300032068|Ga0318553_10700434 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300032076|Ga0306924_12450457 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 525 | Open in IMG/M |
| 3300032770|Ga0335085_11395466 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300033412|Ga0310810_10393668 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1434 | Open in IMG/M |
| 3300033412|Ga0310810_10579059 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1086 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.01% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.34% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.34% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_07274130 | 2170459005 | Grass Soil | YIDNQNFESVRASANRVLDALWEMLSGVCRRHAIAC |
| JGI1027J12803_1004898301 | 3300000955 | Soil | DDHNFESVKVSVNRVLDALWELLSGVCRRHAIAC* |
| JGI10216J12902_1121926632 | 3300000956 | Soil | REMLNRYIDDHNFESVRVSVNRVLEALWEMLSGVCRRNTIAC* |
| JGIcombinedJ26739_1001718101 | 3300002245 | Forest Soil | AAEREMLNSYIDNHNIDNVRASVRRVLDALWEMLSGVCRRHAIAC* |
| JGI25617J43924_101140222 | 3300002914 | Grasslands Soil | EREMLGSYVDDRNIDNVRTSVRRVLDALWQMLSGVCRRHAIAC* |
| Ga0066672_102745451 | 3300005167 | Soil | RNMLAAYIDNHNFESVKASVTRVLDALWDLLSGVCRRHAIAC* |
| Ga0066684_107788612 | 3300005179 | Soil | RKLLGAYIDNGNFESVRASVNGILDALWEMLSGVCRRHAIAC* |
| Ga0066388_1087736742 | 3300005332 | Tropical Forest Soil | KMLADKIDNRNFESVRLSVNRVVDALWETLSGVCRRHAIAC* |
| Ga0070697_1000962033 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSSYIDNQNIDNVRASVRRVLEALWEMLSGVCRRHAIAC* |
| Ga0070672_1020786041 | 3300005543 | Miscanthus Rhizosphere | SAAEQRLLGGYVDNQNFESVRASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0070665_1012659331 | 3300005548 | Switchgrass Rhizosphere | AEQRLLGGYVGNQNFEPVRASLNRVLDALWEMLSGVCRRHAIAC* |
| Ga0066707_101060572 | 3300005556 | Soil | ADEREMLGSYVDDRNIDNVRTSVHRVLDALWQMLSGVCRRHAIAC* |
| Ga0066707_107116451 | 3300005556 | Soil | LDAYLNEQNFESVKRSVNRVLDTLWEMLSGVCRRHAIVC* |
| Ga0066704_102952821 | 3300005557 | Soil | IDNHNFESVKASVTRILDALWEMLSGVCRRHAIAC* |
| Ga0066698_105248011 | 3300005558 | Soil | MLDAYLNEQNFESVKRSVNRVLDTLWEMLSGVCRRHAIVC* |
| Ga0066700_102057581 | 3300005559 | Soil | ERKMLSTYVDNQNIDNVRASVQRVLDALWEMLSGVCRRHAISC* |
| Ga0066700_110267862 | 3300005559 | Soil | ADEREMLGSYVDDRNIDNVRTSVRRVLDALWQMLSGVCRRHAIAC* |
| Ga0066699_109322502 | 3300005561 | Soil | IDKQNFESVKASVNRVLDALWEMLSGVCQRHAIAC* |
| Ga0066694_104359501 | 3300005574 | Soil | EHSAAERKMLESFVDKGNFKSVRASVNRVLGALWEMLSGVCQRHAIAC* |
| Ga0066702_100524863 | 3300005575 | Soil | TEREMLNRYIDDRNFESVKASVSRVLDALWEMLSGVCRRHAIAC* |
| Ga0066702_104824861 | 3300005575 | Soil | AEREMLSEYVTDANAPSVSAAVTRILDALWEMLSGVCCRHAIAC* |
| Ga0066706_113648611 | 3300005598 | Soil | RKMLAAYVDKQNFESVKASVNRVLDALWEMLSGVCRRHVIAC* |
| Ga0066903_1060280082 | 3300005764 | Tropical Forest Soil | EHSATERKMMGEYIGKQNFESVRASVNRVLDALWEMLSGVCRRHAIA* |
| Ga0070766_111295021 | 3300005921 | Soil | KIDNRNIDNVRASVNRVLDALGELLSGVCRRHAIAG* |
| Ga0066651_103887472 | 3300006031 | Soil | SMLSGYVNDENAASTATAVDRVLDALWEMLSGVCRRHAIACA* |
| Ga0070712_1004274731 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IDNHNFESVKASVNRVLDALWEMLSGVCRRHAIA* |
| Ga0066653_102345162 | 3300006791 | Soil | REHIGNQNFESVKASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0066659_116524252 | 3300006797 | Soil | EHVGSQNLESVKASVNRVLDALWEMLSGVYRRHAIAC* |
| Ga0066659_117023132 | 3300006797 | Soil | MLESFVDKGNFKSVRASVNRVLGALWEMLSGVCQRHAIAC* |
| Ga0066660_100337932 | 3300006800 | Soil | LSTYVDNQNVDNVRASVQRVLDALWEMLSGVCRRHAIAC* |
| Ga0066660_103545531 | 3300006800 | Soil | MLGSFVDNQNVDSVRASVNRVLDALWELLSGVCRRHAIAC* |
| Ga0075425_1017761791 | 3300006854 | Populus Rhizosphere | AEQRLLSGYSGNQNFESVRASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0099795_106195611 | 3300007788 | Vadose Zone Soil | KMLGTYIDNHNFESVKASVTRVLDALWEMLSGVCRRHAIAC* |
| Ga0066710_1016396832 | 3300009012 | Grasslands Soil | RMLDAYLNEQNFESVKRSVNRVLDTLWEMLSGVCRRHAIVC |
| Ga0066710_1027672142 | 3300009012 | Grasslands Soil | GYVDDQNFESVRASVHRVLDALWEMLSGVCRRHAIAC |
| Ga0066710_1046063941 | 3300009012 | Grasslands Soil | LSAYIDNHNFESVKASVNRILDALWEMLSGVCRRHAIAC |
| Ga0099830_102211363 | 3300009088 | Vadose Zone Soil | SYIDNHNIDGVRVAVRRVLDALWEMLSGVCRRHAIAC* |
| Ga0099827_108760571 | 3300009090 | Vadose Zone Soil | HSAAERKMLKAYINDHNIDNMRASARRVLDAMWEMLSGVCRRHAVAC* |
| Ga0105245_119148962 | 3300009098 | Miscanthus Rhizosphere | MLATQIGPDNFKPIGASVQRVLDALWEMLSGVCRRHAIAC* |
| Ga0066709_1008975731 | 3300009137 | Grasslands Soil | RMLDAYLNEQNFESVKRSVNRVLDTLWEMLSGVCRRHAIVC* |
| Ga0066709_1044809641 | 3300009137 | Grasslands Soil | HSAAERKMLSDYVDDHNIDNVRASVRRVLDTLWEMLSGVCRRHAIAC* |
| Ga0066709_1045938832 | 3300009137 | Grasslands Soil | RMLDAYLNEQNFESVKRSVNRVLDTLWEMLSGVCRRHAIVY* |
| Ga0099792_108722941 | 3300009143 | Vadose Zone Soil | HVGSQNLESVKASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0126374_110024012 | 3300009792 | Tropical Forest Soil | AEQKLLGEYVGSQNFESVRASVNRVLDALWEMLSGVCRHHAIAC* |
| Ga0134070_101522411 | 3300010301 | Grasslands Soil | ERKLLGAYIDNGNFESVRASVNGILDALWEMLSGVCRRHAIAC* |
| Ga0134084_101378091 | 3300010322 | Grasslands Soil | RKMLNTYVNNRNFDSVRASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0134084_101415302 | 3300010322 | Grasslands Soil | AAAERKMLSAYIDNHNFESVKASVNRILDALWEMLSGVCRRHAVAC* |
| Ga0134084_101813962 | 3300010322 | Grasslands Soil | ADREHAAAERKMLSAYIDNHNFESVKASVNRILDALWEMLSGVCCRHAIAC* |
| Ga0134064_100454402 | 3300010325 | Grasslands Soil | EREMLSTYVDNQNINNVRASVQRVLDALWEMLSGVCRRHAIAC* |
| Ga0134064_101765942 | 3300010325 | Grasslands Soil | YIDNGNFESVRASVNGILDALWEMLSGVCRRHAIAC* |
| Ga0134080_106407931 | 3300010333 | Grasslands Soil | EYLNDDNAASASGAVERILNALWEMLSGVCRRHAIAC* |
| Ga0134128_113188781 | 3300010373 | Terrestrial Soil | MLGRYLDVHNFESVKVSVNRVLDALWDMLSGVCRRHAIAC* |
| Ga0134121_102918631 | 3300010401 | Terrestrial Soil | AERKMLGAFVDDQNFETVKASANRVLDALWEMLSGVCRRHAIAC* |
| Ga0137389_109753691 | 3300012096 | Vadose Zone Soil | SYIDDRNIDNVRTSVRRVLDALWQMLSGVCRRHAIAC* |
| Ga0137389_110668721 | 3300012096 | Vadose Zone Soil | KMLEPYIDNHSFESIRASVNRVLNALWEMLSGVCRRHAIA* |
| Ga0137364_105076072 | 3300012198 | Vadose Zone Soil | EREMLSQHVNDDNASSASTAVNRVLDALWEMLSGVCRRHAIACA* |
| Ga0137364_114096121 | 3300012198 | Vadose Zone Soil | AAEREMLGRYLDAHNFESVKVSVNRVLDALWDMLSGVCRRQAIAY* |
| Ga0137382_100646691 | 3300012200 | Vadose Zone Soil | HSAAEQRLLGGYIGNQNFESVRASVNRVLNALWEMLSGVCRRHAIAS* |
| Ga0137365_101474422 | 3300012201 | Vadose Zone Soil | AEREILSAHIGERNFRSVKASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0137379_110715281 | 3300012209 | Vadose Zone Soil | DNHNFEFVKASVTRVLDALWEMLSSVCRRHAIAC* |
| Ga0137377_112122891 | 3300012211 | Vadose Zone Soil | NEQNFESVKRSVNRVLDTLWEMLSGVCRRHAIVY* |
| Ga0137370_100325541 | 3300012285 | Vadose Zone Soil | REHSAAERSMLGAYVDNHSFEPLRASVNRVLDALWEMLSGVCRRHAIA* |
| Ga0137370_109571952 | 3300012285 | Vadose Zone Soil | AAERSMLSEYLTNANAAPTANAVELVLDAPWEMLSGVCRRHAIACA* |
| Ga0137387_101545911 | 3300012349 | Vadose Zone Soil | IDNRNFESVKESVNRVLSALWQMLSGVCRRHAIAC* |
| Ga0137387_111405602 | 3300012349 | Vadose Zone Soil | YIDNHNFESVKASVNRILDALWEMLSGVCRRHAIACRSISAE* |
| Ga0137384_108330061 | 3300012357 | Vadose Zone Soil | ERKMLGAYIDNHNFEFVKASVTRVLDALWEMLSSVCRRHAIAC* |
| Ga0137361_113512152 | 3300012362 | Vadose Zone Soil | MLFQYVTDDNTAPIAIAVDRIVDALWEMLSGVCRRHTIAC* |
| Ga0137361_117483101 | 3300012362 | Vadose Zone Soil | MLAAYVDKQNFESVKASVNRVLDALWEMLSAVCRRHAIAC* |
| Ga0137397_107108902 | 3300012685 | Vadose Zone Soil | RYINERNFESVKASVNRTLDALWEMLSGVCRRHAIAS* |
| Ga0157293_102235652 | 3300012898 | Soil | SQHVNNDNASSASAAVDRVLDALWEMLSGVCRRHTIAC* |
| Ga0157297_101338711 | 3300012914 | Soil | QNLLGEQVDKANFDSVRASVNRILDAHWEMLSGVCRRQAIAC* |
| Ga0137395_101445902 | 3300012917 | Vadose Zone Soil | AAEREMLSTYVDNQNINNVRVSVQRVLAALWEMLSGVCRRHTIAC* |
| Ga0137359_105959112 | 3300012923 | Vadose Zone Soil | ATERAMLGAYIDNKNVDNVRASVGRVLDALWEMLSGVCRRHAIVC* |
| Ga0137416_101897641 | 3300012927 | Vadose Zone Soil | DAHNFESVKVSVNRVLDALWDMLSGVCRRHAIAC* |
| Ga0137416_119933822 | 3300012927 | Vadose Zone Soil | LSQHVTDDNAAPTTNAVDRILDALWEMLSGVCRRHAIAC* |
| Ga0137404_108369701 | 3300012929 | Vadose Zone Soil | YVGNQNFEPVRASVNRVLDALWEMLSGVCRRHAIAC* |
| Ga0137410_112903021 | 3300012944 | Vadose Zone Soil | MLSGYVDDRNIDNVRASARRVLDALWEMLSGVCRRHAIAC* |
| Ga0164298_116012202 | 3300012955 | Soil | SEYVNEGNAAPVSAAVIRILDALWEMLSGVCRRHAIAC* |
| Ga0126369_106567601 | 3300012971 | Tropical Forest Soil | GYVNHDNAASAANAVDRVLDALWEMLSGVCRRHAIACG* |
| Ga0134087_101195532 | 3300012977 | Grasslands Soil | EREMLNRYIGDRNFESVKASVNRVLDALWEMLSGVCRRHAIGC* |
| Ga0134087_107487831 | 3300012977 | Grasslands Soil | SERKMLGAYIENHNFESVKASVTRVLDALWDLLSGVCRRHAIAC* |
| Ga0164309_105316412 | 3300012984 | Soil | LLGGYIGRQNFESVRASVNRVLDALCEMLSGVCRRHAIAC* |
| Ga0164309_109524261 | 3300012984 | Soil | AEQKLLGGYVGNQNFEPVRASVNRVLDSLWEMLSGVCRRHAIAC* |
| Ga0157374_112822221 | 3300013296 | Miscanthus Rhizosphere | AYVNDDNFETVRSSMQSVLNALWEMLSGVCRRHAIAC* |
| Ga0182001_105120261 | 3300014488 | Soil | VNDGNAAAVKAAVTRVLDALWDLLSGVCRRHAIAC* |
| Ga0134072_101199141 | 3300015357 | Grasslands Soil | AAERKMLSTYVDNQNVDNVRASVQRVLDALWEMLSGVCRRHTIAC* |
| Ga0134085_100451991 | 3300015359 | Grasslands Soil | AERDLLNRYVNEHNFESVKASVNCVLDALWEMLSGVCRRHAIAC* |
| Ga0132258_127207352 | 3300015371 | Arabidopsis Rhizosphere | SAAEQRLLGGYVGCQNVESVKASVNSVLDALWEMLSGVCHRHAIAC* |
| Ga0132255_1043899942 | 3300015374 | Arabidopsis Rhizosphere | EMLGEHVNSENFAKVSASVTRVLDVLWDMLSGVCRRHAIAC* |
| Ga0134069_10950002 | 3300017654 | Grasslands Soil | SAAERKMLREHVGSQNLESVKASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0134069_12901511 | 3300017654 | Grasslands Soil | VDKQNFESVKASVNRVLEALWEMLSGVCRRHAIAC |
| Ga0134083_100127031 | 3300017659 | Grasslands Soil | AAERKMLREHVGSQNLESVKASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0184618_101024192 | 3300018071 | Groundwater Sediment | YIDNNNFESVRESVHRVLNALWQMLSGVCRRHAIAC |
| Ga0184624_102900312 | 3300018073 | Groundwater Sediment | GGYVGNKNFESVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0066667_101953641 | 3300018433 | Grasslands Soil | IDNHNLESVKASVNRVLDALLEMLSGVCRRHAIAC |
| Ga0190273_103964211 | 3300018920 | Soil | AAEREMLSEHVHDDNAASASRAVNRVLDALWEMLSGVCRRHAIACA |
| Ga0173482_106016012 | 3300019361 | Soil | SAAEKKLLGRYVANQNFESVRESVNRVLDALWEMLSGVCRRHAIAC |
| Ga0193722_10382072 | 3300019877 | Soil | SAAEQKLLGGYVGDQNFESVRASANRVLDALWEMLSGVCRRHAIAC |
| Ga0193725_10129053 | 3300019883 | Soil | REMLSRHLDAHNFESVKVSVNRVLDALWDMLSGVCRRHAIAC |
| Ga0193725_10935261 | 3300019883 | Soil | AAEQRLLGGCIDNQNFEPVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0193747_11012122 | 3300019885 | Soil | MLSQHINDDNAAPTANAVDRILDALWEMLSGVFRHRHFIAC |
| Ga0193743_11622001 | 3300019889 | Soil | EMLSAYIDNNNFESVRESVNRVLNALWQMLSGVCRRHAIAC |
| Ga0193734_10024281 | 3300020015 | Soil | EMLSRHVDNRNFESVKVSVNCVLDALWDMLSGVCRRHAIAC |
| Ga0210382_102285551 | 3300021080 | Groundwater Sediment | ARRRAADVSQYVNDDNATPTTNSVDRVLDALWEMLSGVCRRHAIAC |
| Ga0193719_100532382 | 3300021344 | Soil | KMLSSYIDNYNFESVKASVQRVLDALWEMLSGVCRRHAIAC |
| Ga0193719_103185732 | 3300021344 | Soil | RDDGKRRMLSEYVSDENAAPVSAAVTRILDALWEMLSGVCRRHAIAC |
| Ga0126371_107984782 | 3300021560 | Tropical Forest Soil | ASEREMLSAYVDDADIDNVRVSVRRVLDALWEMLSGVCRRHAIIC |
| Ga0222622_103468431 | 3300022756 | Groundwater Sediment | REMLSEHVHNDNASSASKAVDRVLDALWEMLSGVCRRHAIAC |
| Ga0193714_10180051 | 3300023058 | Soil | QKLLGGYVGDQNFESVRASANRVLDALWEMLSGVCRRHAIAC |
| Ga0207684_113258251 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DREHSAVEREMLSRKIDSRNIDELRAVTASVLDALWEMLSSVCQRHVIAC |
| Ga0207681_1000222212 | 3300025923 | Switchgrass Rhizosphere | RKMLGAYIDDHNFESVRESVNRVLDALRQLLSGVCRRHAIAC |
| Ga0207687_109632971 | 3300025927 | Miscanthus Rhizosphere | QKLLGGYVGNQNFESVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0207700_117086441 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNTYVNNRSFDSVRASVDRVLDALWEMLSGVCRRHAIAC |
| Ga0207664_100244781 | 3300025929 | Agricultural Soil | YIDNHNFESVKASVNRVLDALWEMLSGVSRRHAIA |
| Ga0207661_100808181 | 3300025944 | Corn Rhizosphere | RLLGGYVDNQNFESVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0207698_127354231 | 3300026142 | Corn Rhizosphere | YVGNQNFESVRASANRVLDALWEMLSGVCRRHAIAC |
| Ga0209234_11379482 | 3300026295 | Grasslands Soil | AEREMLADKIDNQNINNIRVSVNRVLDALWEMLSGVCRRHAIAC |
| Ga0209268_11791352 | 3300026314 | Soil | YIDNRNLETVKASVNRVLDALLEMLSGVCRRHAIA |
| Ga0209470_12078051 | 3300026324 | Soil | SYVDHDNFGKVKTATQRILDALWEMLTGVCRRQAIAC |
| Ga0209803_11657342 | 3300026332 | Soil | ERKMLREHVGSQNLESVKASVNRVLDALWEMLSGVYRRHAIAC |
| Ga0209803_13692401 | 3300026332 | Soil | NFESVKTSVNRVLNALWELLSSLCRRHAIACQNLV |
| Ga0209377_10650311 | 3300026334 | Soil | SDAERKILNSFVNKHNFESVKASVNRVLEALWKMLSGVCRRHAIAY |
| Ga0257156_10500823 | 3300026498 | Soil | KMLSSYIDNHNFESVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0209808_12855351 | 3300026523 | Soil | KHSADEREMLGSYVDDRNIDNVRTSVHRVLDALWQMLSGVCRRHAIAC |
| Ga0209059_11737702 | 3300026527 | Soil | TEREMLNRYIDDRNFESVKASVSRVLDALWEMLSGVCRRHAIAC |
| Ga0209806_11545161 | 3300026529 | Soil | HSAAERKMLREHVGSQNLESVKASVNRVLDALWEMLSGVYRRHAIAC |
| Ga0209807_10573401 | 3300026530 | Soil | NRYVNERNFESVKASVNRILDALWEMLSGVCRRHAIAC |
| Ga0209056_102080442 | 3300026538 | Soil | REHVGSQNLESVKASVNRVLDALWEMLSGVYRRHAIAC |
| Ga0179587_108653292 | 3300026557 | Vadose Zone Soil | HVGNQNLESVKASVKRVLDALWEMLSGVCRRHAIAC |
| Ga0209220_10995311 | 3300027587 | Forest Soil | KMLSTKIDDGNFENVKASVNRVLEALWEMLSGVCRRHAIAC |
| Ga0209625_10952792 | 3300027635 | Forest Soil | HIHDDNASSASAAVDRVLDALWEMLSGVCRRHAIAC |
| Ga0209011_10113091 | 3300027678 | Forest Soil | SSYLDNGNFENVKASANRVLDALWEMLSGVCRRHAIAC |
| Ga0209590_100161071 | 3300027882 | Vadose Zone Soil | SAAERTMLSAYIDNHNIDKVRAAAQRVLDALWEMLSGVCRRHAIAC |
| Ga0307291_10028425 | 3300028707 | Soil | QMLSEYVNNDNAAPVSAAVNRVLDALWEMLSGVCRRHAIAC |
| Ga0307307_103001712 | 3300028718 | Soil | EQKLLGGYVGNQNFESVRASANRVLDALWEMLSGVCRRHAIAC |
| Ga0307282_100739191 | 3300028784 | Soil | RYLGVHNFESVKVSVNRVLDALWDMLSGVCRRQAIAC |
| Ga0307299_103938581 | 3300028793 | Soil | LAEHIGTQNFEHVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0307287_103804212 | 3300028796 | Soil | MLRRYLDAHNFESVKVSVNRVLDALWDMLSGVCRRHAIAC |
| Ga0307308_103646542 | 3300028884 | Soil | AVERKMLAGYIDNHNFESVKASVTRILDALWEMLSGVCGRHAIAC |
| Ga0075373_115985432 | 3300030945 | Soil | EHAAAERKMLSSYIDNHNFESVKATVNRVLDALWEMLSGISRSHAIA |
| Ga0170824_1018293231 | 3300031231 | Forest Soil | TYVDDGNFNSVKTSVNRVLDALWEMLSGVCRRHAIAC |
| Ga0170819_173143812 | 3300031469 | Forest Soil | REHAAAERKMLSSYIDNHNFESVKATVNRVLDALREMLSGASRRHAIA |
| Ga0310915_109756882 | 3300031573 | Soil | QRLLGGYVSNQNFGSVTVSVNRVLDALWEMLSGVCRRHAIAC |
| Ga0306917_104208141 | 3300031719 | Soil | REHAAAERKLLAEHVDETNFESVKASVHGVLDALWSLLTGVCQRHAIACWL |
| Ga0318553_107004341 | 3300032068 | Soil | AYIDNQNVDNVRMSANRVLDALWEMLSGICRRHAVVC |
| Ga0306924_124504572 | 3300032076 | Soil | TEQRLLRRYVSNQNFESVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0335085_113954662 | 3300032770 | Soil | EREMLSDKIDNRNIDNVRASVNRVLDALWEMLSGVCRRHAIAC |
| Ga0310810_103936682 | 3300033412 | Soil | YVDNQNFESVRASVNRVLNALWEMLSGVCRRHAIAC |
| Ga0310810_105790591 | 3300033412 | Soil | YVDKQNFEFVRESVNRVLDALWEMLSGVCRRHAIA |
| ⦗Top⦘ |