


| Basic Information | |
|---|---|
| Family ID | F047762 |
| Family Type | Metagenome |
| Number of Sequences | 149 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VHPTGGSLRVFKQFAWLEAGSVKAALSRPAHQRVTQAVGWLTF |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.13 % |
| % of genes near scaffold ends (potentially truncated) | 72.48 % |
| % of genes from short scaffolds (< 2000 bps) | 73.15 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.020 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.792 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.886 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.597 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.35% β-sheet: 0.00% Coil/Unstructured: 74.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 1.34 |
| PF13302 | Acetyltransf_3 | 1.34 |
| PF13279 | 4HBT_2 | 1.34 |
| PF03100 | CcmE | 1.34 |
| PF13711 | DUF4160 | 1.34 |
| PF08241 | Methyltransf_11 | 1.34 |
| PF01230 | HIT | 0.67 |
| PF12847 | Methyltransf_18 | 0.67 |
| PF00106 | adh_short | 0.67 |
| PF01882 | DUF58 | 0.67 |
| PF05193 | Peptidase_M16_C | 0.67 |
| PF00873 | ACR_tran | 0.67 |
| PF04199 | Cyclase | 0.67 |
| PF13847 | Methyltransf_31 | 0.67 |
| PF03795 | YCII | 0.67 |
| PF00293 | NUDIX | 0.67 |
| PF13350 | Y_phosphatase3 | 0.67 |
| PF07859 | Abhydrolase_3 | 0.67 |
| PF13472 | Lipase_GDSL_2 | 0.67 |
| PF01042 | Ribonuc_L-PSP | 0.67 |
| PF13646 | HEAT_2 | 0.67 |
| PF05015 | HigB-like_toxin | 0.67 |
| PF14319 | Zn_Tnp_IS91 | 0.67 |
| PF14355 | Abi_C | 0.67 |
| PF13565 | HTH_32 | 0.67 |
| PF04229 | GrpB | 0.67 |
| PF02371 | Transposase_20 | 0.67 |
| PF04191 | PEMT | 0.67 |
| PF09037 | Sulphotransf | 0.67 |
| PF06271 | RDD | 0.67 |
| PF03446 | NAD_binding_2 | 0.67 |
| PF01135 | PCMT | 0.67 |
| PF13671 | AAA_33 | 0.67 |
| PF13391 | HNH_2 | 0.67 |
| PF12773 | DZR | 0.67 |
| PF13181 | TPR_8 | 0.67 |
| PF02452 | PemK_toxin | 0.67 |
| PF02517 | Rce1-like | 0.67 |
| PF00990 | GGDEF | 0.67 |
| PF07676 | PD40 | 0.67 |
| PF14329 | DUF4386 | 0.67 |
| PF13649 | Methyltransf_25 | 0.67 |
| PF01872 | RibD_C | 0.67 |
| PF12850 | Metallophos_2 | 0.67 |
| PF07883 | Cupin_2 | 0.67 |
| PF12697 | Abhydrolase_6 | 0.67 |
| PF06185 | YecM | 0.67 |
| PF12710 | HAD | 0.67 |
| PF10604 | Polyketide_cyc2 | 0.67 |
| PF00326 | Peptidase_S9 | 0.67 |
| PF12867 | DinB_2 | 0.67 |
| PF10047 | DUF2281 | 0.67 |
| PF13407 | Peripla_BP_4 | 0.67 |
| PF00849 | PseudoU_synth_2 | 0.67 |
| PF13495 | Phage_int_SAM_4 | 0.67 |
| PF03061 | 4HBT | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 1.34 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.67 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.67 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.67 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.67 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.67 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.67 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.67 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.67 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.67 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.67 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG3102 | Uncharacterized conserved protein YecM, predicted metalloenzyme | General function prediction only [R] | 0.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.67 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG4424 | LPS sulfotransferase NodH | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.02 % |
| Unclassified | root | N/A | 46.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_114390113 | Not Available | 725 | Open in IMG/M |
| 3300004024|Ga0055436_10139538 | Not Available | 734 | Open in IMG/M |
| 3300004058|Ga0055498_10113520 | Not Available | 561 | Open in IMG/M |
| 3300004061|Ga0055487_10026912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1107 | 832 | Open in IMG/M |
| 3300004282|Ga0066599_100651073 | Not Available | 716 | Open in IMG/M |
| 3300004282|Ga0066599_101113985 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005294|Ga0065705_10153372 | Not Available | 1908 | Open in IMG/M |
| 3300005294|Ga0065705_10493860 | Not Available | 784 | Open in IMG/M |
| 3300005294|Ga0065705_10574306 | Not Available | 716 | Open in IMG/M |
| 3300005294|Ga0065705_10633985 | Not Available | 674 | Open in IMG/M |
| 3300005294|Ga0065705_10953341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300005471|Ga0070698_101278210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 684 | Open in IMG/M |
| 3300005617|Ga0068859_102884534 | Not Available | 527 | Open in IMG/M |
| 3300005617|Ga0068859_103055392 | Not Available | 511 | Open in IMG/M |
| 3300005719|Ga0068861_101230244 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300006844|Ga0075428_100881816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Coprobacillaceae → Catenibacterium | 949 | Open in IMG/M |
| 3300006845|Ga0075421_101255994 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006865|Ga0073934_10280117 | Not Available | 1077 | Open in IMG/M |
| 3300006876|Ga0079217_10481718 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006880|Ga0075429_100045848 | All Organisms → cellular organisms → Bacteria | 3803 | Open in IMG/M |
| 3300006880|Ga0075429_100634825 | Not Available | 936 | Open in IMG/M |
| 3300006880|Ga0075429_100927640 | Not Available | 762 | Open in IMG/M |
| 3300006880|Ga0075429_100950226 | All Organisms → cellular organisms → Bacteria → PVC group | 752 | Open in IMG/M |
| 3300006880|Ga0075429_101018210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300006880|Ga0075429_101761248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 538 | Open in IMG/M |
| 3300006880|Ga0075429_101804215 | Not Available | 531 | Open in IMG/M |
| 3300006954|Ga0079219_12344077 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006969|Ga0075419_10359258 | Not Available | 992 | Open in IMG/M |
| 3300006969|Ga0075419_10408452 | Not Available | 931 | Open in IMG/M |
| 3300009081|Ga0105098_10136313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1091 | Open in IMG/M |
| 3300009081|Ga0105098_10172181 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300009100|Ga0075418_10866813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 976 | Open in IMG/M |
| 3300009100|Ga0075418_11185981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 827 | Open in IMG/M |
| 3300009100|Ga0075418_12357527 | Not Available | 581 | Open in IMG/M |
| 3300009131|Ga0115027_11695260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 525 | Open in IMG/M |
| 3300009147|Ga0114129_10427537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1741 | Open in IMG/M |
| 3300009147|Ga0114129_10663410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1345 | Open in IMG/M |
| 3300009147|Ga0114129_11318896 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300009147|Ga0114129_11515687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
| 3300009148|Ga0105243_11819100 | Not Available | 640 | Open in IMG/M |
| 3300009157|Ga0105092_10167425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfolunaceae → Desulfoluna → Desulfoluna butyratoxydans | 1224 | Open in IMG/M |
| 3300009168|Ga0105104_10145460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria → unclassified Parcubacteria → Candidatus Parcubacteria bacterium | 1281 | Open in IMG/M |
| 3300009168|Ga0105104_10239395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 990 | Open in IMG/M |
| 3300009168|Ga0105104_10353215 | Not Available | 813 | Open in IMG/M |
| 3300009168|Ga0105104_10354880 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300009168|Ga0105104_10660479 | Not Available | 599 | Open in IMG/M |
| 3300009179|Ga0115028_10305287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1072 | Open in IMG/M |
| 3300009179|Ga0115028_10631614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 805 | Open in IMG/M |
| 3300009789|Ga0126307_11175029 | Not Available | 621 | Open in IMG/M |
| 3300010037|Ga0126304_11111053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium 35-46-9 | 541 | Open in IMG/M |
| 3300010040|Ga0126308_10072076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 2059 | Open in IMG/M |
| 3300010040|Ga0126308_10211776 | Not Available | 1248 | Open in IMG/M |
| 3300010040|Ga0126308_11013922 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010040|Ga0126308_11027719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 578 | Open in IMG/M |
| 3300010042|Ga0126314_11270694 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010044|Ga0126310_10653050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 791 | Open in IMG/M |
| 3300010166|Ga0126306_11429806 | Not Available | 573 | Open in IMG/M |
| 3300010399|Ga0134127_13553595 | Not Available | 511 | Open in IMG/M |
| 3300011413|Ga0137333_1000038 | All Organisms → cellular organisms → Bacteria | 29110 | Open in IMG/M |
| 3300011422|Ga0137425_1027594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → unclassified Ectothiorhodospiraceae → Ectothiorhodospiraceae bacterium | 1218 | Open in IMG/M |
| 3300011433|Ga0137443_1240823 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300011436|Ga0137458_1185635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 630 | Open in IMG/M |
| 3300012040|Ga0137461_1256323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Candidatus Vecturithrix → Candidatus Vecturithrix granuli | 509 | Open in IMG/M |
| 3300012157|Ga0137353_1020215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1108 | Open in IMG/M |
| 3300012204|Ga0137374_10413177 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300012204|Ga0137374_10483953 | Not Available | 965 | Open in IMG/M |
| 3300012204|Ga0137374_10542282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 896 | Open in IMG/M |
| 3300012227|Ga0137449_1066714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 758 | Open in IMG/M |
| 3300012228|Ga0137459_1089860 | Not Available | 888 | Open in IMG/M |
| 3300012353|Ga0137367_10036791 | All Organisms → cellular organisms → Bacteria | 3751 | Open in IMG/M |
| 3300012353|Ga0137367_10211033 | Not Available | 1404 | Open in IMG/M |
| 3300012353|Ga0137367_11129733 | Not Available | 528 | Open in IMG/M |
| 3300012355|Ga0137369_10155480 | Not Available | 1811 | Open in IMG/M |
| 3300012355|Ga0137369_10447694 | Not Available | 922 | Open in IMG/M |
| 3300012355|Ga0137369_10701368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 696 | Open in IMG/M |
| 3300012358|Ga0137368_10030493 | All Organisms → cellular organisms → Bacteria | 4891 | Open in IMG/M |
| 3300012358|Ga0137368_10322040 | Not Available | 1038 | Open in IMG/M |
| 3300012358|Ga0137368_10574220 | Not Available | 719 | Open in IMG/M |
| 3300012360|Ga0137375_10302862 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300012360|Ga0137375_11390169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 523 | Open in IMG/M |
| 3300012532|Ga0137373_10895296 | Not Available | 652 | Open in IMG/M |
| 3300012964|Ga0153916_10692686 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300013760|Ga0120188_1001809 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300014309|Ga0075317_1157221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 536 | Open in IMG/M |
| 3300014867|Ga0180076_1023504 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300014867|Ga0180076_1058988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 694 | Open in IMG/M |
| 3300014870|Ga0180080_1063956 | Not Available | 627 | Open in IMG/M |
| 3300014885|Ga0180063_1177954 | Not Available | 680 | Open in IMG/M |
| 3300015252|Ga0180075_1062582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium atlanticum | 634 | Open in IMG/M |
| 3300015259|Ga0180085_1171509 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300015259|Ga0180085_1181169 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018053|Ga0184626_10129874 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300018059|Ga0184615_10013239 | Not Available | 4504 | Open in IMG/M |
| 3300018059|Ga0184615_10171902 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300018059|Ga0184615_10208256 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300018059|Ga0184615_10502844 | Not Available | 652 | Open in IMG/M |
| 3300018429|Ga0190272_10984832 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300021090|Ga0210377_10100340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1935 | Open in IMG/M |
| 3300021090|Ga0210377_10332429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_57_11 | 921 | Open in IMG/M |
| 3300025164|Ga0209521_10415258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 729 | Open in IMG/M |
| 3300025165|Ga0209108_10031415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2989 | Open in IMG/M |
| 3300025289|Ga0209002_10310868 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300025310|Ga0209172_10012479 | All Organisms → cellular organisms → Bacteria | 7093 | Open in IMG/M |
| 3300025313|Ga0209431_10614877 | Not Available | 813 | Open in IMG/M |
| 3300025959|Ga0210116_1074658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 659 | Open in IMG/M |
| 3300027713|Ga0209286_1020208 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300027722|Ga0209819_10042018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1562 | Open in IMG/M |
| 3300027792|Ga0209287_10165625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis flos-aquae | 840 | Open in IMG/M |
| 3300027792|Ga0209287_10173149 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300027886|Ga0209486_10287670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 963 | Open in IMG/M |
| 3300027909|Ga0209382_11603831 | Not Available | 643 | Open in IMG/M |
| 3300027909|Ga0209382_12063095 | Not Available | 545 | Open in IMG/M |
| 3300031364|Ga0307445_10163356 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031576|Ga0247727_10169183 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300031995|Ga0307409_102881412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 508 | Open in IMG/M |
| 3300032013|Ga0310906_11155271 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300033418|Ga0316625_100675923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 860 | Open in IMG/M |
| 3300033483|Ga0316629_11021965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium RBG_16_71_46 | 651 | Open in IMG/M |
| 3300033521|Ga0316616_101498749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 874 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 18.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 11.41% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.40% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.68% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.01% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.01% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.01% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.34% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.34% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.34% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.67% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.67% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.67% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.67% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004061 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014309 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025154 | Soil microbial communities from Rifle, Colorado, USA - Groundwater F2 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031364 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-30 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1143901132 | 3300000956 | Soil | HPTGGSLRVFRQFAWLQIGSDKIALSRSTLQRVTQAVGLLTN* |
| C687J26631_100830281 | 3300002124 | Soil | HSVHPTGGSLRVFGQFVWLEVSTGKIALSRPAHQRVTQAVGPPVSASFGSWLIIEH* |
| JGI25406J46586_100349251 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MTRHHSKVHPTSGTLRVFKLFSWLEVDSNKFALSQPAQPPVTQAV |
| JGI25406J46586_102488722 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MTPRHAGVHPTGGSRRVFKQFAWLEAGSAKVALPHPAHQRVTP |
| Ga0055436_101395383 | 3300004024 | Natural And Restored Wetlands | AQHSVHPTGGSRRVFKHFAWLEVDSGKMALSRPTHQRVTRAVRRLIIKDARP* |
| Ga0055498_101135201 | 3300004058 | Natural And Restored Wetlands | HSVHPTGGSLRVFEQFSWLEVDSVKVALSRPTHQRVTQTVRQLVV* |
| Ga0055487_100269121 | 3300004061 | Natural And Restored Wetlands | SVHPTGGSLRVFRQFAWLEAGSGKVALSRPAHQRVTPAVGRFLPK* |
| Ga0062590_1024181132 | 3300004157 | Soil | AAQHSVHLTGGSLRVFKRFRRLEVNSDKMALSRPAHQQVTPTVGRLNN* |
| Ga0066599_1006510732 | 3300004282 | Freshwater | HSVHPTSGILRVFKHFAWLEVDSAKMALPRPAHLPVTQAVGWLRVKQKHK* |
| Ga0066599_1011139851 | 3300004282 | Freshwater | PTGGSLRVFRQFAWLEIGSVKVALSHPTHQPVTQAVSHPFPKRS* |
| Ga0062382_105706542 | 3300004782 | Wetland Sediment | MGAACVAKHAQHSVHPTGGSLRVFRHFVWLEVGSGKMALSRPTHPRVT |
| Ga0065705_101533721 | 3300005294 | Switchgrass Rhizosphere | AQHSVHPTGGSRRVFRQFAWLGVGSDKIALSHPTHQRVTQTVGPLEGFFYQ* |
| Ga0065705_104938602 | 3300005294 | Switchgrass Rhizosphere | AQQSVHPTGGSRRVFKHFVWLGVDSVKAALSRPTHQRVTQAVGRLLILG* |
| Ga0065705_105743062 | 3300005294 | Switchgrass Rhizosphere | HLTGGSLRVFKQFAWLEVGSDKVALSRPAHQRVTPAVSPDI* |
| Ga0065705_106339852 | 3300005294 | Switchgrass Rhizosphere | PTGGSLRVFKQFVWLEVGSGKKALSRPTHQRVTHTVGRSSAELSK* |
| Ga0065705_109533412 | 3300005294 | Switchgrass Rhizosphere | HPTGGSRRVFKHFVWLEIGSGKMALSRPAHQRVTQTVSWIGEIWI* |
| Ga0065705_109787871 | 3300005294 | Switchgrass Rhizosphere | GSLRVFKHLAWLGVDAVKVALHRPTHQRVTQTVGTPIQNWDLK* |
| Ga0070698_1012782102 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HSVHPTGGSLRVFGQFAWLRAGSVKIAFSRPARQRVTQAVGCFLGGNA* |
| Ga0068859_1028845341 | 3300005617 | Switchgrass Rhizosphere | AAQHSVHLTGGSLRVFKGFWWLGVGSDKMALSLPAHQQVTHTVGQFLNQGPK* |
| Ga0068859_1030553922 | 3300005617 | Switchgrass Rhizosphere | KTAQHSVHLTGGSLRVFKHFARLGAGSDKLAFSRPAHQQVTQAVGQ* |
| Ga0068861_1012302441 | 3300005719 | Switchgrass Rhizosphere | GSLRVFRRFAWLGVGSNKMALSRPTHLRVTQAVRLKELEES* |
| Ga0081539_101402141 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VHPTSGTLRVFKLFSWLEVDSNKFALSQPAQPPVTQAVSPPDVLK* |
| Ga0075427_100711721 | 3300006194 | Populus Rhizosphere | AQHSVHPTGGTLRVFKHFLWLEVDSVKTALSRLAHQRVTQAVSTLKITGA* |
| Ga0075428_1008818161 | 3300006844 | Populus Rhizosphere | HSVHPTGGSLRVFRQFVWLEADSGNAALSRPAHQRVTPAVGQFIYKTK* |
| Ga0075421_1012559941 | 3300006845 | Populus Rhizosphere | AQHSVHPTGGSLRVFKHFAWLEVGSVKMALSRLTHQRVTRAVSPLLATEIT* |
| Ga0075421_1022931971 | 3300006845 | Populus Rhizosphere | VFAAQQGVHPTGGSLRVFEQFAWLEVGSGKVALSRPTHQRVT |
| Ga0073934_102801172 | 3300006865 | Hot Spring Sediment | VHPTGGSLRVFRQFSWLEVGSGKMAFSQPAQPPVTQAVGQLSTQI* |
| Ga0079217_104817181 | 3300006876 | Agricultural Soil | VQPTGGSLRVFEAFSWLEVGSGKVALSRPTHQRVTRAV |
| Ga0075429_1000458481 | 3300006880 | Populus Rhizosphere | HSVHPTGGSRRVFKPFAWLEVGSVKMAVSRPTHQRVTQTVGRFYDRNS* |
| Ga0075429_1006348251 | 3300006880 | Populus Rhizosphere | SVHPTGGSLRVFRQFVWLEAGSVKTALSRPTHQRVTRAVGWLVSKL* |
| Ga0075429_1008074052 | 3300006880 | Populus Rhizosphere | VHPTNGTLRVFRQFAWLEVGSGKAVLSRPAHQRVTPAVGRLPSKEGKHEE* |
| Ga0075429_1009276402 | 3300006880 | Populus Rhizosphere | SVHPTGGTLRVFRQFAWLEAGSVKVALSRPTHQRVRPAVGLLR* |
| Ga0075429_1009502261 | 3300006880 | Populus Rhizosphere | AQHSVHLTGGSLRVFKQFSWLQVVSVTMALSRPAHQQVTQAVGQFIVGRK* |
| Ga0075429_1010182102 | 3300006880 | Populus Rhizosphere | PTGGSLRVFKQFAWLEAGSGKTASPRPAHQRVTPAVGPLGGSLR* |
| Ga0075429_1012504832 | 3300006880 | Populus Rhizosphere | TAQHSVHPTGGSLRVFRQFAWLEADSVKTALSRPAHQPVTQTVRLLKS* |
| Ga0075429_1017612481 | 3300006880 | Populus Rhizosphere | AQHSVHPTGGSLRVFRHFAWLEVGSSKAALSRPAHQRVTQAVGRLIRMHK* |
| Ga0075429_1018042152 | 3300006880 | Populus Rhizosphere | HSVHPTGGSLRVFKQFAWLEVGSDKMTLSQPAHQRVTHTVGLP* |
| Ga0079219_123440772 | 3300006954 | Agricultural Soil | MTTRHAGVHLTGGSLRVFKHFARLRVDSDKIALPRLAHQQV |
| Ga0075419_103592581 | 3300006969 | Populus Rhizosphere | PTGVSLRVFRQFVWLEADSGNAALSRPAHQRVTPAVSLLIAVRNH* |
| Ga0075419_104084521 | 3300006969 | Populus Rhizosphere | MVGLLLRSVRVFKQFPWLGVGSGKVALSHPAHQRVTRAVSWLLVKL* |
| Ga0105090_101967791 | 3300009075 | Freshwater Sediment | GGSLRIFKQFVWLEVDSVKMALPRPAHQQVTQAVSPSSLTLNL* |
| Ga0105098_101363132 | 3300009081 | Freshwater Sediment | PTGGSLRVFKQFARLGVGSGKMAFSRPAHPRVMQAVGRQGNKT* |
| Ga0105098_101721813 | 3300009081 | Freshwater Sediment | AQHSVHPTGGSLRVFRQVAWLEVGSVKVALPRPTRQQVTQTVGQSFAL* |
| Ga0075418_102892683 | 3300009100 | Populus Rhizosphere | MVRQSSLAFIGVAQHSVHLTSGSLRVFKHFAWLGVGSVKAALSRPTHQRVTPAVGQFKKC |
| Ga0075418_108668132 | 3300009100 | Populus Rhizosphere | VQPTGGSLRVFEHFAWLEVDSVKAALSRPAHQPVTRPVGWFFDDNE* |
| Ga0075418_111859812 | 3300009100 | Populus Rhizosphere | TGGSLRVFRQFAWLEVGSGKAALFRPTHQRVTPAVGRLNAEKKTI* |
| Ga0075418_123575271 | 3300009100 | Populus Rhizosphere | VHPTGGSLRVFKQFAWLEAGSVKAALSRPAHQRVTQAVGWLTF |
| Ga0115027_116952601 | 3300009131 | Wetland | VHPTGGSRRVFRQFSGLEVGSGKMVLSPPTHPRVTQAVG |
| Ga0114129_104275374 | 3300009147 | Populus Rhizosphere | VHPTCGSLRVFKLFAWLEVGSIKAALSRPAHQRVTPTVSLPTWLE* |
| Ga0114129_106634101 | 3300009147 | Populus Rhizosphere | MILYDKKAAQHSVHPTWGMRRVFKQFSWLEVGSVKATLSRPAHQRVTPAVGR |
| Ga0114129_111019871 | 3300009147 | Populus Rhizosphere | SVHPTGGSLRVFGQFVWLEVDSVKIAFSRLAHQRVTQTVGQHYQMTIDFL* |
| Ga0114129_113188961 | 3300009147 | Populus Rhizosphere | VFAAQQGVHPTGGSLRVFEQFAWLEVGSGKAALSRPTHQRVTPAVRRLHK* |
| Ga0114129_115156871 | 3300009147 | Populus Rhizosphere | LTGGSLRVFRQFAWLGVGSGKAALSRPSHQRVTPDVSLLVLK* |
| Ga0105243_118191001 | 3300009148 | Miscanthus Rhizosphere | VHPTGGSLRVFKQFVWLEVGSGKKALSRPTHQRVTHTVGRS |
| Ga0105092_100526621 | 3300009157 | Freshwater Sediment | VKQQSAQHSVHPTGGSRRVFEQFVWLAVGSGKMALSRPAHPRVTLTVGLQINNI* |
| Ga0105092_101674252 | 3300009157 | Freshwater Sediment | VHPTGGSLRVFKQFAWLGVGSGKVAFSPPAHPRVTQAVGLLRFIVKRVNDE* |
| Ga0075423_108776411 | 3300009162 | Populus Rhizosphere | HSVHLTGGSLRGFRHFVWLEVDSAKMAFSRLAHQQVTQTVRQVLRS* |
| Ga0105104_101454603 | 3300009168 | Freshwater Sediment | TGGSLRVFRQFAWLQTGSGKVAFSRPAHPRVTLAVGRKEGKSE* |
| Ga0105104_102393951 | 3300009168 | Freshwater Sediment | RVHPTGGSRRVFRQVVWLEAGSGKAALSRPAHPQVTHTVGQAL* |
| Ga0105104_103532151 | 3300009168 | Freshwater Sediment | TGGSRRVFRQFPWLEVGSGKAALPRPAHPRVTHTVGRSIYNLL* |
| Ga0105104_103548801 | 3300009168 | Freshwater Sediment | VPLENQEAAQHSVHPTGGSLRVFRQFAWLEAGSVKMALSRPAHPQVTHTVG |
| Ga0105104_106604791 | 3300009168 | Freshwater Sediment | QHSVHPTGGSLRVFWQVVWLEAGSGKMAFSPPAHPRVTQTVGRLIFNSAI* |
| Ga0115028_103052871 | 3300009179 | Wetland | TQHSVHPTGGSRRVFRQFAWLEVGSGKVALSRPAHPRVTLTVGRLIRKEKR* |
| Ga0115028_106316141 | 3300009179 | Wetland | MSASTSSLVFNAQHSVHPTGGSLRVFRQFLWLEVGSGKMALSRPAHQHVTQTVRQPNLAT |
| Ga0126307_111750291 | 3300009789 | Serpentine Soil | VHPTGGSLRVFKQFVWLEVDSVKVALSRPTHQRVTQTVGRAVIHIQDLR* |
| Ga0126304_111110532 | 3300010037 | Serpentine Soil | AQHSVHPTGGSLRVFRQFVWLGVGSVKAALSRPTHQRVTQAVSLFLA* |
| Ga0126308_100720763 | 3300010040 | Serpentine Soil | VHPTGGSLRVFKHFAWLEAGSAKVALSRLAHQPVTPAVGRLPKNDDMGA* |
| Ga0126308_102117761 | 3300010040 | Serpentine Soil | MHPTGGSRRVFGQFLWLEVGSGKMALSRPTHPRVTQIVSLLVLQMEKE* |
| Ga0126308_110139221 | 3300010040 | Serpentine Soil | VHLTGGSLRVFRQFAWLEAGSGKAALSRPAHQRVTQAVSLLATKK |
| Ga0126308_110277191 | 3300010040 | Serpentine Soil | MLSAQQAAQHSVHPTGGSLRVFRQFSWLGVGSVKATLSRLAHQRVTHTVRR |
| Ga0126314_112706941 | 3300010042 | Serpentine Soil | MNTAQHSVHPTGGSLRVFRQFVWLEVGSVKVALSHPTHLRVTHTVGCLLKDNILY |
| Ga0126310_104239211 | 3300010044 | Serpentine Soil | VHPTGGSLRVFRQFVWLEVDSGKAALSRPTHQRVTQAVGQFLAKVKSLCSNVNN* |
| Ga0126310_106530501 | 3300010044 | Serpentine Soil | VNNNNAQHSVHPTGGSLRVFRQFAWLGVGSVKMVLSRPTHQRVTQAV |
| Ga0126311_109426223 | 3300010045 | Serpentine Soil | VVKREYKGAQHSVHPTGGTLRVFRHFAWLEVGSGKVVFSRPTHQRV |
| Ga0126311_117279441 | 3300010045 | Serpentine Soil | HPTGGSLRVFKQFVWLEVDSVKMALSRPAHQRVTQAVRRYFGDYVQ* |
| Ga0126306_114298062 | 3300010166 | Serpentine Soil | AQHSVHPTGGSLRVFRQFAWLEVDSDKMAFSRPAHQRVTQAVGRL* |
| Ga0134127_135535952 | 3300010399 | Terrestrial Soil | MTPAQHSVHPTGGSRRVFKHFTRLEADSGKMALSRPAHQRVTQTVG |
| Ga0137333_100003824 | 3300011413 | Soil | MHPTGGSLRVFERFAWLEVGSGKMALSRPAHQRVTLTVSPLSKFVGDYW* |
| Ga0137425_10275943 | 3300011422 | Soil | MKAKTAQHSVHPTGGSLRVFRPFAWLEASSGKVASSRPTHPRVTQAV |
| Ga0137443_12408232 | 3300011433 | Soil | MSAAQHSVHPTGGSLRVFKLFAWLEANSAKIALSRPAHQQVTQAVGRLVS |
| Ga0137458_11856352 | 3300011436 | Soil | MNVQAAQHSVHPTGGSLRVFKPFAWLEVGSVKMALPRPAHQPVTQAVGQ* |
| Ga0137461_12563231 | 3300012040 | Soil | TGGSLRVFWQFAWLEAGSGKMALSRPAHQRVTPAVGRLMARE* |
| Ga0137353_10202153 | 3300012157 | Soil | AQHSVHPTGGSLRVFKQFVWLEVGSVKMALSRPTHPRVTQAVGQPRAKS* |
| Ga0137357_10102601 | 3300012168 | Soil | MHPTGGSLRVFERFAWLEVGSGKMALSRPAHQRVTLTVETVE* |
| Ga0137374_104131771 | 3300012204 | Vadose Zone Soil | VHPTGGSRRVFELFLWLKAGSGKVALSRPTHQRVTQTVGRRPQKL |
| Ga0137374_104839532 | 3300012204 | Vadose Zone Soil | VHPTGGSRRVFRQFVWLQAGSVKMAFSRPTHPRVTPTVRRADRCPRGGD |
| Ga0137374_105422822 | 3300012204 | Vadose Zone Soil | VHPTGGSLRVFKQVAWLEAGSGKAALSPPAHQRVTPAVSPLSL |
| Ga0137434_10240171 | 3300012225 | Soil | MKNAAQQSVHPTSGSLRVFKPLFWLEVGSVKKALSRPAHLPLTQAVG |
| Ga0137449_10667141 | 3300012227 | Soil | HSVHPTGGTLRVFGQFAWLEVDSVKMALPHPAHQPVTQAVRCLTNKKG* |
| Ga0137459_10898601 | 3300012228 | Soil | HPTGGSLRVFRHFSWLEVGSGKTAFSRPTHQRVTQAVGLLHDHCIEIR* |
| Ga0137367_100367913 | 3300012353 | Vadose Zone Soil | VHPTGGSLRVFKQFVWLEVGSGKMALSRPAHQRVTQAVGLLVFFQ* |
| Ga0137367_102110331 | 3300012353 | Vadose Zone Soil | VHPTGGSRRVFRQVVWLEVGSVKMALSRPTHQRVTPAVRR |
| Ga0137367_111297331 | 3300012353 | Vadose Zone Soil | MDASTKTTQHSVHPTGGSRRVFRQFLWLEADSVEMALSRPAHQRVTQAVGQF |
| Ga0137369_101554803 | 3300012355 | Vadose Zone Soil | HSVHPTGGSLRVFRQFARLEVGSVKVASPRPAHQRVTPTVGRLRR* |
| Ga0137369_104476942 | 3300012355 | Vadose Zone Soil | VHPTGGSLRVFGLFVWLEVGSAKMALSRPAHQRVTQAVGRLVDKDGGYGFI* |
| Ga0137369_107013681 | 3300012355 | Vadose Zone Soil | VHPTGGSLRVFKQVAWLEAGSGKAALSPPAHQRVTP |
| Ga0137368_100304931 | 3300012358 | Vadose Zone Soil | SVHPTGGSLRVFKRFLWLKVGSVKAASSRPAHQRVTQTVGQFLDEMV* |
| Ga0137368_103220401 | 3300012358 | Vadose Zone Soil | HSVHPTGGTRRVFRQFSGLEVGSGKVALPRRPTHQRVTQAVGQIDR* |
| Ga0137368_105742201 | 3300012358 | Vadose Zone Soil | VHPTGGSRSVFKQFAWLEVGSGKAALSRPAHQRVTPTVGRLSRIQAG* |
| Ga0137375_103028621 | 3300012360 | Vadose Zone Soil | PTGGSLRVFRQFAWLEVGSGKVVLSRPAHQRVTPAVGQKEHIGN* |
| Ga0137375_107131321 | 3300012360 | Vadose Zone Soil | SVHPTGGSLRVFKQFAWLEVGSGKVKLPCPAHQRVTQTVSPLFQDYFVESHDNL* |
| Ga0137375_113901692 | 3300012360 | Vadose Zone Soil | AAQHSVHPTGGSLRVFEQFAWLEADSGKVALSRPTHQRVTPAVRRFMRISLNVDD* |
| Ga0137373_108952961 | 3300012532 | Vadose Zone Soil | QHSVHPTGGSRRVFRQFAWLEADSDKMVLPRPTHQRVTQAVGLPF* |
| Ga0153916_106926861 | 3300012964 | Freshwater Wetlands | QHSVHPTGGTRRVFRQVSRLEAGSAKMALPHPAHQRVTQAVSQLSYGYWK* |
| Ga0120188_10018091 | 3300013760 | Terrestrial | VFAAQQGVHPTGGSLRVFEQFAWLEVGSGKVALSHPAHQRVTQAVGWL |
| Ga0075315_11160682 | 3300014258 | Natural And Restored Wetlands | LDKTYPTGGSPHVFRQFSWLQVGSDKVAFSRPAHPRVTQAVRRFEKT* |
| Ga0075317_11572211 | 3300014309 | Natural And Restored Wetlands | VHPTGGSRRVFRQFAWLGVGSGKIAFSRPTHPRVTHTVGQLNELISY |
| Ga0180076_10235041 | 3300014867 | Soil | PTGGSLRVFKQFAWLEVGSGKMALSRPAHQPVTQAVGQPLHEFQKL* |
| Ga0180076_10589882 | 3300014867 | Soil | GGSLRVFRQFAWLEAGSVKVASSRPAHQRVTPTVSLPFHNRKQNKKDL* |
| Ga0180080_10639561 | 3300014870 | Soil | QHSVHPTSGTLRVFRHFAWLEVGSVKAALSRPAHQRVTQAIGRAKRVSIE* |
| Ga0180063_11779542 | 3300014885 | Soil | MKSAQHSVHPTGGTHRVFKQFPWLEVDSVKAALPRPTHQRVTP |
| Ga0180075_10625821 | 3300015252 | Soil | VHPTGGSLRVFKHFAWLEVGSVKAALSRPAHQRLTLTVGLHCGS |
| Ga0180085_11715091 | 3300015259 | Soil | HSVHPTGGSLRVFRHLAWLEVDSVKAALSRPTHQRVTQAVGRLSDNPKAKTE* |
| Ga0180085_11811691 | 3300015259 | Soil | SVHPTGGTLRVFKQFAWLEAGSGKEALSRPANQLVTQAVGQLLDDL* |
| Ga0184626_101298741 | 3300018053 | Groundwater Sediment | HSVHPTGGSLRVFRQFAWLEVGSAKMALSRPAHQRVTHTVGWLT |
| Ga0184615_100132391 | 3300018059 | Groundwater Sediment | SVHPTGGSRRVFEHFSWLEVGSVKMALSRPTHQRVTQAVRRFILDSK |
| Ga0184615_100874001 | 3300018059 | Groundwater Sediment | MARESNLVCAQHSVHPTGGSLRVFKHFAWLEVGSGKVVLSRPAHQRVTQAV |
| Ga0184615_101719021 | 3300018059 | Groundwater Sediment | PTGGSLRVFKQFFWLEVGSVKATLSRPTHQRVTQAVRQFLMINF |
| Ga0184615_102082561 | 3300018059 | Groundwater Sediment | TGGSLRVFGHFAWLEVGSVKMAFSRPARQRVTPAVGRLDLDSGHQAK |
| Ga0184615_102948901 | 3300018059 | Groundwater Sediment | MEAAQQSVHPTGGSLRVFKQFVWLGAGSGKMALSRPAHQRVTQAVGRPASA |
| Ga0184615_105028442 | 3300018059 | Groundwater Sediment | MIDARAKNAQHSVHPTGGSLRVFGQFAWLEVGSVKVALSRPTHQRVTPAVGR |
| Ga0190272_109848322 | 3300018429 | Soil | QPTGGSLRVFRQFVWLEADFGKVALSRPAHQRVTQAVRLKEFEES |
| Ga0210377_100241191 | 3300021090 | Groundwater Sediment | PTGGSRRVFEHFSWLEVGSVKMALSRPTHQRVTQAVRRFILDSK |
| Ga0210377_101003401 | 3300021090 | Groundwater Sediment | ANCAQHSVHPTGGSLRVFRQVVWLEVGSVKMALSGPAHQRVTQAVRRQKKNQ |
| Ga0210377_103324292 | 3300021090 | Groundwater Sediment | VHPTGGSLRVFRQFVWTEVGSVKIALSRPAHQRVTQAVRRIERLIGLGRAG |
| Ga0210377_104422981 | 3300021090 | Groundwater Sediment | PTGGSRRVFKLFPWLEVGSVKVALSRPTHQRVTQAVGLP |
| Ga0209417_10535591 | 3300025154 | Soil | MWQSVLRKAAQHIVHPTGGSRRVFGQFSWLGVVSVKAALSRLAHQRVTLTVSHFN |
| Ga0209521_104152583 | 3300025164 | Soil | VHPTGGTLRVFKQFARLEVGSVKSAASHLAHQRVTPAVGRLYINASVPYE |
| Ga0209108_100314151 | 3300025165 | Soil | HPTGGSLRVFKRFLWLGVDSGKVALSRPTHQRVTQAVGRTFMMKEGL |
| Ga0209002_103108682 | 3300025289 | Soil | MIIAAQHSVHPTGGSLRVFKQFLWLKAGSVKAALSRPTHQRVTP |
| Ga0209172_100124791 | 3300025310 | Hot Spring Sediment | SWVHPTGGSLRVFRQFSWLEVGSGKMAFSQPAQPPVTQAVGQLSTQI |
| Ga0209431_106148771 | 3300025313 | Soil | VHPTGGSLRVFRQFAWLEVGFVKVALTRPPHQRVTPAVRRLKF |
| Ga0210116_10746582 | 3300025959 | Natural And Restored Wetlands | MKTSQHSVHPTGGSLRVFKQFAWLEVGSGKAAASRPTHQRVTPAV |
| Ga0209286_10202081 | 3300027713 | Freshwater Sediment | VHPTGGSLRVFKHFVWLEVGSGKMTLPRPAHQRVTPAVRFP |
| Ga0209819_100420183 | 3300027722 | Freshwater Sediment | AQHSVHPTGGSLRVFRQFAWLEVNSVKAAASPPTHPRVTHTVGRLYVNKDRRVENL |
| Ga0209287_101656251 | 3300027792 | Freshwater Sediment | PTGGSLRVFRQFSWLGVGSVKTAFSRPAHQRVTPAVGLPFDNL |
| Ga0209287_101731492 | 3300027792 | Freshwater Sediment | VHPTGRSLRVFKQFAWLEVGSVKAALSRPAHQRVTQTVGLLDIRIVC |
| Ga0209486_102876702 | 3300027886 | Agricultural Soil | VHPTGGSLRVFKQFAGLEVGSGKAALSRPAHQRVTRAVGREGYKVNI |
| Ga0209254_108206271 | 3300027897 | Freshwater Lake Sediment | RVFKLVAWLKAGSVKMALSRPAHQRVPQTVERLAYINRAIYD |
| Ga0209382_105376521 | 3300027909 | Populus Rhizosphere | VHPTGGILRVFRHFARLEVVSDKIPLSHLTHQRVTLTVSRTKAN |
| Ga0209382_116038311 | 3300027909 | Populus Rhizosphere | HPTGGSRRVFRQFAWLEASSGKMALSHPAHQRVTPAVRRLEKRKT |
| Ga0209382_120630952 | 3300027909 | Populus Rhizosphere | MILYDKKAAQHSVHPTWGMRRVFKQFSWLEVGSVKATLSRPAHQRVTPAVGRFT |
| Ga0307445_101633561 | 3300031364 | Salt Marsh | VPLESQEAAQHSVHPTGGSLRVFRQFAWLEVGSGKMAPSRPAHPRVTLTV |
| Ga0247727_101691831 | 3300031576 | Biofilm | SVHPTGGSLRVFRQFSWLEVGSGKAALSCPTHQRVTRAVSPPLAK |
| Ga0307409_1028814121 | 3300031995 | Rhizosphere | MTTMISKGNAAQHSVHPTGGSLRVFKQFTWLEAGSGKIALSRPTHQPVTQT |
| Ga0310906_111552713 | 3300032013 | Soil | RPTGGSLRVFEQFAWLEASSVRAAVSPPTYQRVTQTVQRLFVLKE |
| Ga0316625_1006759231 | 3300033418 | Soil | IFGQRIGKSETAQHSVHPTGGSRRVFRHLAWLEAGSVKAASSRPAHPRVTLTVGR |
| Ga0316629_110219651 | 3300033483 | Soil | VHPTGGSLRVFRQFAWLEVGSGKVALSRPTHQRLTQAVRLVIQIRA |
| Ga0316616_1014987491 | 3300033521 | Soil | VAAQHSVHPTGGSRRVFKQFAWLGVGSGKAALPRPAHPRVTLTVSRITQEV |
| ⦗Top⦘ |