


| Basic Information | |
|---|---|
| Family ID | F047631 |
| Family Type | Metagenome |
| Number of Sequences | 149 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKYKFKVTEDGKPEEEKEAMSFKKLLKSLVTPNPKWTGLL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 58.39 % |
| % of genes near scaffold ends (potentially truncated) | 99.33 % |
| % of genes from short scaffolds (< 2000 bps) | 97.99 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.993 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (72.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (96.644 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.289 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.24% β-sheet: 20.59% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 3.36 |
| PF05063 | MT-A70 | 1.34 |
| PF00961 | LAGLIDADG_1 | 0.67 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 2.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.01 % |
| Unclassified | root | N/A | 48.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000260|LP_A_09_P20_500DRAFT_1009958 | Not Available | 1557 | Open in IMG/M |
| 3300001731|JGI24514J20073_1016238 | Not Available | 712 | Open in IMG/M |
| 3300001971|GOS2215_10069483 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300002484|JGI25129J35166_1082902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 577 | Open in IMG/M |
| 3300005427|Ga0066851_10249914 | Not Available | 552 | Open in IMG/M |
| 3300005593|Ga0066837_10128541 | Not Available | 924 | Open in IMG/M |
| 3300005603|Ga0066853_10280723 | Not Available | 547 | Open in IMG/M |
| 3300005604|Ga0066852_10240893 | Not Available | 615 | Open in IMG/M |
| 3300005605|Ga0066850_10265100 | Not Available | 610 | Open in IMG/M |
| 3300006736|Ga0098033_1069967 | Not Available | 1016 | Open in IMG/M |
| 3300006736|Ga0098033_1077492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 957 | Open in IMG/M |
| 3300006736|Ga0098033_1079480 | Not Available | 943 | Open in IMG/M |
| 3300006736|Ga0098033_1147397 | All Organisms → cellular organisms → Eukaryota | 660 | Open in IMG/M |
| 3300006736|Ga0098033_1166967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300006738|Ga0098035_1124191 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300006738|Ga0098035_1237251 | All Organisms → cellular organisms → Eukaryota | 602 | Open in IMG/M |
| 3300006738|Ga0098035_1245969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 590 | Open in IMG/M |
| 3300006738|Ga0098035_1299762 | Not Available | 524 | Open in IMG/M |
| 3300006750|Ga0098058_1188804 | Not Available | 538 | Open in IMG/M |
| 3300006751|Ga0098040_1036725 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1552 | Open in IMG/M |
| 3300006752|Ga0098048_1042411 | Not Available | 1448 | Open in IMG/M |
| 3300006752|Ga0098048_1192860 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006752|Ga0098048_1206068 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006752|Ga0098048_1249439 | Not Available | 519 | Open in IMG/M |
| 3300006753|Ga0098039_1181878 | Not Available | 714 | Open in IMG/M |
| 3300006753|Ga0098039_1205596 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006754|Ga0098044_1196758 | All Organisms → Viruses | 794 | Open in IMG/M |
| 3300006754|Ga0098044_1201089 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300006754|Ga0098044_1228484 | Not Available | 725 | Open in IMG/M |
| 3300006754|Ga0098044_1232339 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 718 | Open in IMG/M |
| 3300006754|Ga0098044_1242709 | All Organisms → cellular organisms → Eukaryota | 699 | Open in IMG/M |
| 3300006789|Ga0098054_1082914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1208 | Open in IMG/M |
| 3300006793|Ga0098055_1126772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 989 | Open in IMG/M |
| 3300006793|Ga0098055_1290619 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006921|Ga0098060_1094050 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006922|Ga0098045_1086423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 747 | Open in IMG/M |
| 3300006923|Ga0098053_1035167 | Not Available | 1057 | Open in IMG/M |
| 3300006923|Ga0098053_1085300 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006923|Ga0098053_1128737 | Not Available | 507 | Open in IMG/M |
| 3300006924|Ga0098051_1047634 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1190 | Open in IMG/M |
| 3300006924|Ga0098051_1211486 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006926|Ga0098057_1092966 | Not Available | 735 | Open in IMG/M |
| 3300006927|Ga0098034_1202398 | Not Available | 554 | Open in IMG/M |
| 3300006927|Ga0098034_1219935 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006929|Ga0098036_1137309 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006929|Ga0098036_1259074 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006990|Ga0098046_1098234 | Not Available | 651 | Open in IMG/M |
| 3300007963|Ga0110931_1186735 | Not Available | 620 | Open in IMG/M |
| 3300008050|Ga0098052_1090817 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1255 | Open in IMG/M |
| 3300008050|Ga0098052_1095207 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300008050|Ga0098052_1120764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1054 | Open in IMG/M |
| 3300008050|Ga0098052_1133191 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 993 | Open in IMG/M |
| 3300008050|Ga0098052_1245905 | Not Available | 685 | Open in IMG/M |
| 3300008050|Ga0098052_1393778 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300008217|Ga0114899_1059348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1346 | Open in IMG/M |
| 3300008219|Ga0114905_1132821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 842 | Open in IMG/M |
| 3300008219|Ga0114905_1230732 | Not Available | 588 | Open in IMG/M |
| 3300009173|Ga0114996_10371865 | Not Available | 1102 | Open in IMG/M |
| 3300009412|Ga0114903_1014104 | Not Available | 2181 | Open in IMG/M |
| 3300009428|Ga0114915_1219591 | Not Available | 518 | Open in IMG/M |
| 3300009593|Ga0115011_11802574 | Not Available | 552 | Open in IMG/M |
| 3300009602|Ga0114900_1175414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 539 | Open in IMG/M |
| 3300009604|Ga0114901_1161089 | Not Available | 668 | Open in IMG/M |
| 3300009605|Ga0114906_1067646 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300009605|Ga0114906_1240266 | Not Available | 593 | Open in IMG/M |
| 3300009613|Ga0105228_122836 | Not Available | 583 | Open in IMG/M |
| 3300009619|Ga0105236_1012132 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300009790|Ga0115012_11667757 | Not Available | 554 | Open in IMG/M |
| 3300010150|Ga0098056_1215128 | Not Available | 640 | Open in IMG/M |
| 3300010151|Ga0098061_1095808 | Not Available | 1109 | Open in IMG/M |
| 3300010151|Ga0098061_1121581 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300010151|Ga0098061_1132364 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300010151|Ga0098061_1145484 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300010151|Ga0098061_1273487 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010155|Ga0098047_10142274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 929 | Open in IMG/M |
| 3300010155|Ga0098047_10165488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 853 | Open in IMG/M |
| 3300011261|Ga0151661_1201726 | Not Available | 661 | Open in IMG/M |
| 3300013098|Ga0164320_10368619 | Not Available | 706 | Open in IMG/M |
| 3300017703|Ga0181367_1057229 | Not Available | 683 | Open in IMG/M |
| 3300017704|Ga0181371_1051270 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300017705|Ga0181372_1017736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1227 | Open in IMG/M |
| 3300017705|Ga0181372_1031434 | Not Available | 899 | Open in IMG/M |
| 3300017718|Ga0181375_1069394 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300017752|Ga0181400_1145704 | Not Available | 673 | Open in IMG/M |
| 3300017775|Ga0181432_1186028 | Not Available | 648 | Open in IMG/M |
| 3300017775|Ga0181432_1256133 | Not Available | 552 | Open in IMG/M |
| 3300020353|Ga0211613_1022915 | Not Available | 1445 | Open in IMG/M |
| 3300020449|Ga0211642_10383986 | Not Available | 604 | Open in IMG/M |
| 3300022225|Ga0187833_10510999 | Not Available | 615 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10001706 | All Organisms → cellular organisms → Bacteria | 3145 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10605538 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025042|Ga0207889_1029451 | Not Available | 518 | Open in IMG/M |
| 3300025045|Ga0207901_1054372 | Not Available | 527 | Open in IMG/M |
| 3300025046|Ga0207902_1031979 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300025052|Ga0207906_1047124 | Not Available | 580 | Open in IMG/M |
| 3300025070|Ga0208667_1043883 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300025070|Ga0208667_1055942 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025078|Ga0208668_1064092 | All Organisms → cellular organisms → Eukaryota | 666 | Open in IMG/M |
| 3300025078|Ga0208668_1085586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300025084|Ga0208298_1050801 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300025097|Ga0208010_1053182 | Not Available | 896 | Open in IMG/M |
| 3300025103|Ga0208013_1077736 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300025103|Ga0208013_1135229 | Not Available | 598 | Open in IMG/M |
| 3300025108|Ga0208793_1053642 | Not Available | 1233 | Open in IMG/M |
| 3300025108|Ga0208793_1080840 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300025109|Ga0208553_1099257 | Not Available | 675 | Open in IMG/M |
| 3300025109|Ga0208553_1123140 | Not Available | 586 | Open in IMG/M |
| 3300025110|Ga0208158_1042158 | All Organisms → Viruses | 1139 | Open in IMG/M |
| 3300025112|Ga0209349_1097741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 842 | Open in IMG/M |
| 3300025112|Ga0209349_1165212 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025114|Ga0208433_1037279 | Not Available | 1329 | Open in IMG/M |
| 3300025118|Ga0208790_1085468 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300025118|Ga0208790_1121776 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300025118|Ga0208790_1136066 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300025122|Ga0209434_1127342 | Not Available | 707 | Open in IMG/M |
| 3300025131|Ga0209128_1084027 | All Organisms → Viruses | 1061 | Open in IMG/M |
| 3300025133|Ga0208299_1092914 | Not Available | 1035 | Open in IMG/M |
| 3300025133|Ga0208299_1125715 | Not Available | 834 | Open in IMG/M |
| 3300025133|Ga0208299_1158053 | Not Available | 706 | Open in IMG/M |
| 3300025133|Ga0208299_1203910 | Not Available | 585 | Open in IMG/M |
| 3300025133|Ga0208299_1223669 | Not Available | 544 | Open in IMG/M |
| 3300025133|Ga0208299_1233876 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300025133|Ga0208299_1234453 | Not Available | 525 | Open in IMG/M |
| 3300025141|Ga0209756_1277810 | Not Available | 601 | Open in IMG/M |
| 3300025141|Ga0209756_1316442 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025260|Ga0207895_1030836 | Not Available | 915 | Open in IMG/M |
| 3300025267|Ga0208179_1035974 | Not Available | 1201 | Open in IMG/M |
| 3300025268|Ga0207894_1029697 | All Organisms → Viruses | 978 | Open in IMG/M |
| 3300025268|Ga0207894_1035155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 890 | Open in IMG/M |
| 3300025280|Ga0208449_1058521 | All Organisms → Viruses | 1007 | Open in IMG/M |
| 3300025293|Ga0208934_1007806 | All Organisms → Viruses | 2487 | Open in IMG/M |
| 3300025296|Ga0208316_1029823 | Not Available | 1285 | Open in IMG/M |
| 3300025305|Ga0208684_1169180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 502 | Open in IMG/M |
| 3300025873|Ga0209757_10154177 | Not Available | 720 | Open in IMG/M |
| 3300026103|Ga0208451_1017550 | Not Available | 783 | Open in IMG/M |
| 3300026115|Ga0208560_1034276 | Not Available | 507 | Open in IMG/M |
| 3300026209|Ga0207989_1036008 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300026267|Ga0208278_1063608 | Not Available | 883 | Open in IMG/M |
| 3300026268|Ga0208641_1179612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 561 | Open in IMG/M |
| 3300026279|Ga0208411_1195638 | Not Available | 508 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10556254 | Not Available | 563 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10126123 | Not Available | 1407 | Open in IMG/M |
| 3300028022|Ga0256382_1168113 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028192|Ga0257107_1072377 | Not Available | 1047 | Open in IMG/M |
| 3300032006|Ga0310344_11450411 | Not Available | 561 | Open in IMG/M |
| 3300032006|Ga0310344_11451694 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300034628|Ga0326755_026810 | Not Available | 578 | Open in IMG/M |
| 3300034655|Ga0326746_016699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300034656|Ga0326748_048710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 596 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 72.48% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 11.41% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 2.68% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.68% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.01% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 2.01% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.01% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.34% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.67% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
| 3300001731 | Marine viral communities from the Pacific Ocean - LP-37 | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005604 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV63 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009613 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020353 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998) | Environmental | Open in IMG/M |
| 3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025042 | Marine viral communities from the Pacific Ocean - LP-47 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025260 | Marine viral communities from the Deep Pacific Ocean - MSP112 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025268 | Marine viral communities from the Deep Pacific Ocean - MSP-114 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025293 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026267 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV259 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LP_A_09_P20_500DRAFT_10099587 | 3300000260 | Marine | MKYKFQVTEDGKKEEKESMSFKKLLKSLVTPNPKWTGFISYENKKGR |
| JGI24514J20073_10162381 | 3300001731 | Marine | MKYKFKVTEDGKPEEEKESMSFKKLLKSLVEPNPKWTG |
| GOS2215_100694835 | 3300001971 | Marine | MKYKFKVKEDGKEEEEKESMSFKKLLKSLAITNPKWTGTLSYINKKGK |
| JGI25129J35166_10829021 | 3300002484 | Marine | MKYKFKIQEENKEIEEKEGMSYKKTLKSLVTPNPKWTGWIAYKNKKD |
| Ga0066851_102499142 | 3300005427 | Marine | MKYTFKVREEGKEDMEKEEMSYKKLLKSLVTGNPKWTGWITYKN |
| Ga0066837_101285411 | 3300005593 | Marine | MKGKMKYKFKVREEGKEDEEKEAMSYKKLLKSLVTLNPKWTGWIT |
| Ga0066853_102807231 | 3300005603 | Marine | MKEKMKYTFKIREEGKEDIEKEGMSFKRILKSLVELNPKW |
| Ga0066852_102408933 | 3300005604 | Marine | MKYKFKIQEEDKETEEKEGMSYKKTLKSLVTPNPKWT |
| Ga0066850_102651003 | 3300005605 | Marine | MKYKFKIQEDGKEVEEKEGMSYKKTLKSLVTPNPKWTGW |
| Ga0098033_10699675 | 3300006736 | Marine | MKYKFKIQEEDKETEEKEGMSYKKTLKSLVTPNPK |
| Ga0098033_10774924 | 3300006736 | Marine | MRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWT |
| Ga0098033_10794804 | 3300006736 | Marine | MKYKFKIQEENKETEEKEGMSYKKTLKSLVTLNPKWTGWIAYKN |
| Ga0098033_11473973 | 3300006736 | Marine | MRYKFKVYEEGKEIEDKEAMSFKKLLKSLVNPNPKW |
| Ga0098033_11669674 | 3300006736 | Marine | MKGKMKYKFKVREEGKEDEEKEAMSYKKLLKSLVTLNPKW |
| Ga0098035_11241914 | 3300006738 | Marine | MKYKFKVTEDGKPEEEKESMSFKKVLKSLVSTNPKW |
| Ga0098035_12372513 | 3300006738 | Marine | MRYKFKIQEENKEIEEKEGMSYKKTLKSLVTPNPKWTGWIAY |
| Ga0098035_12459694 | 3300006738 | Marine | VRYKFKVTEDGKPEEEKESMSFKKLLKSLVTLNPKWTGLLNYTNKK |
| Ga0098035_12997622 | 3300006738 | Marine | MRYKFKVTEDGKPEVEKEAMSFKKLLKSLVIPNPKWT |
| Ga0098058_11888043 | 3300006750 | Marine | MKYKFKIQEENKEIEEKEGMSYKKTLKSLVTPNPKWTGWIA |
| Ga0098040_10367251 | 3300006751 | Marine | MKYKFTVTEEGKEPEEKESMSFKKLLKSLVTPNPKWTGLLNY |
| Ga0098048_10424111 | 3300006752 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVSTNPKWTGF |
| Ga0098048_11928602 | 3300006752 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVSTNPKWTGFLHYTNK |
| Ga0098048_12060683 | 3300006752 | Marine | MKYKFTVIEEGKEPEEKESMSFKKILKSLVNTNPKWTGFMSYE |
| Ga0098048_12494392 | 3300006752 | Marine | MRYKFKVTEDGKAEEEKESMSFKKLLKSLVTLNPKWTGLLNYTN |
| Ga0098039_11818781 | 3300006753 | Marine | MKYTFTVTEEGKEPEQKESMSFKKLLKSLVTPNPKWTGL |
| Ga0098039_12055963 | 3300006753 | Marine | MKYKFTVAEEGKPAEEKESMSFKKLFKSLININPKWTGSLTYDNKKG |
| Ga0098044_11967581 | 3300006754 | Marine | MRYKFKVTEDGKLEEEKEAMSFKKVLKSLVTPNPKWTG |
| Ga0098044_12010894 | 3300006754 | Marine | MKYKFTVTEEGKEPEEKDSMSFKKLLKSIVNTNPKWTGSL |
| Ga0098044_12284843 | 3300006754 | Marine | MKYTFTVTEEGKEPEQKESMSFKKLLKSLVTPNPKWTGLLNYNNKKG |
| Ga0098044_12323393 | 3300006754 | Marine | MKYTFTVTEEGKEPEQKESMSFKKLLKSLITPNPKWTGLLNYN |
| Ga0098044_12427094 | 3300006754 | Marine | MRYKFKVTEDGKEEIEKESMSFKKLLKSLVTPNPKWTGLLN |
| Ga0098054_10829141 | 3300006789 | Marine | MKYKFKINEEGKPEEEKEGMSFKKILKSLVSTNPKWTGF |
| Ga0098055_11267725 | 3300006793 | Marine | MKYKFTVIEEGKEPEEKESMSFKRLLKSIVNTNPKWTGSLNYNNK |
| Ga0098055_12906194 | 3300006793 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVSTNPKWTGFLH |
| Ga0098060_10940504 | 3300006921 | Marine | MKYKFKITEEGKPEEEKEAMSFKKILKSLVEPNPNWTGSLEYTNKKG |
| Ga0098045_10864231 | 3300006922 | Marine | MKYKFKIQEDGKEVEEKEGMSYKKTLKSLVTLNPKWTG |
| Ga0098053_10351676 | 3300006923 | Marine | MKYKFKITEDGKPEEEKEGMSFKKILKSLVEPNPKWT |
| Ga0098053_10853001 | 3300006923 | Marine | VRYTFRVIELDKPEEEKKAMSFKKLLKSLVTPNPKWTGM |
| Ga0098053_11287371 | 3300006923 | Marine | MKYKFKIQEDGKEVEEKEGMSYKKTLKSLVTPNPKWTGWIAY |
| Ga0098051_10476345 | 3300006924 | Marine | MKYKFKVIEDGKPEEEKEAMSFKKLLKSLVTPNPKWTGFM |
| Ga0098051_12114863 | 3300006924 | Marine | MKYKFKITEDGKPEEEKEGMSFKKILKSLVNTNPKWTGFMSYENKKG |
| Ga0098057_10929663 | 3300006926 | Marine | MKYKFKIREEGKEDIEKEGMSFKRILKSLVELNPKWTGWIAYKN |
| Ga0098034_12023983 | 3300006927 | Marine | MRYKFKIQEENKEIEEKEGMSYKKTLKSLVTPNPKWTGWIAYKNK |
| Ga0098034_12199353 | 3300006927 | Marine | MKHKFTVTEEGKEPEEKESMSFKKILKSLVTTNPKWT |
| Ga0098036_11373094 | 3300006929 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVSTNPKW |
| Ga0098036_12590743 | 3300006929 | Marine | MRYKFKVSEDGKTMVEKEAMSFKKLKKSLFITNPKWS |
| Ga0098046_10982343 | 3300006990 | Marine | MKYTFTVTEEGKESEQKESMSFKKLLKSLITPNPKWTGSL |
| Ga0110931_11867351 | 3300007963 | Marine | MRYKFKVTEDGKPEEEKEAMSFKKLLKSLVIPNSKWTGWIV |
| Ga0098052_10908175 | 3300008050 | Marine | MKYKFTVTEEGKEPEEKESMSFKKLLKSLVTPNPKWTGLLNYN |
| Ga0098052_10952071 | 3300008050 | Marine | MRYKFKVYEEGKEIEDKEAMSFKKLLKSLVNPNPKWTG |
| Ga0098052_11207644 | 3300008050 | Marine | MKYKFKVIEDGKPEEEKEAMSFKKLLKSLVTPNPKWTGFMSY |
| Ga0098052_11331915 | 3300008050 | Marine | MKYRFKVIEDGKPEEEKEAMSFKKLLKSLVTPNPKWSGSIEYRNKKS |
| Ga0098052_12459051 | 3300008050 | Marine | MRYKFKVTEDGKEEIEKEAMSFKKLLKSLVTPNPKWTG |
| Ga0098052_13937781 | 3300008050 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVSTNPKWTG |
| Ga0114899_10593485 | 3300008217 | Deep Ocean | MKYKFKINEDDKPTIEKEGMSFKKVLKSLINQNPKWSGTIR |
| Ga0114905_11328215 | 3300008219 | Deep Ocean | MRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWTGW |
| Ga0114905_12307321 | 3300008219 | Deep Ocean | VKKVCGILKMRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWT |
| Ga0114996_103718651 | 3300009173 | Marine | MKYKFKVTEDGKPEEEKESMSFKRLLKSLVEPNPKWTG |
| Ga0114903_10141041 | 3300009412 | Deep Ocean | MKEKMRYKFKVYEEGKEVEDKEAMSYKKLLKSLVTPNPKWTGW |
| Ga0114915_12195911 | 3300009428 | Deep Ocean | MKYKFQVTQDGKKEEKESMSYKKLLKSLVTPNPKWTGFI |
| Ga0115011_118025743 | 3300009593 | Marine | MRYTFKIQEEGQGEEEKEGMSYKKILKSLTTANPKW |
| Ga0114900_11754143 | 3300009602 | Deep Ocean | MGKKKEEMRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWT |
| Ga0114901_11610893 | 3300009604 | Deep Ocean | MRYKFKVYEEGKEIEDKEAMSFKKLLKSLVNPNPKWAGWIAYKNKKG |
| Ga0114906_10676461 | 3300009605 | Deep Ocean | MRYKFKVTEDGKPEVEKEAMSFKKLLKSLVNPNPKWTGFM |
| Ga0114906_12402662 | 3300009605 | Deep Ocean | VKKVCGILKMRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWTGFMS |
| Ga0105228_1228361 | 3300009613 | Marine Oceanic | MRYKFKVTEDGKPEVEKEAMSFKKLLKSLVNPNPKWTGWIAYQN |
| Ga0105236_10121323 | 3300009619 | Marine Oceanic | MKYKFQVTENGKKEEKESMSFKKLLKSLVTPNPKWTGFI |
| Ga0115012_116677571 | 3300009790 | Marine | MKYKFKVTEDGKPEEEKEAMSFKKLLKSLVIPNPKWTGF |
| Ga0098056_12151281 | 3300010150 | Marine | MRYKFKVTEDGKEEIEKESMSFKKLLKSLVTPNPKWTGFMS |
| Ga0098061_10958081 | 3300010151 | Marine | MKYKFTVIEEGKEPEEKESMSFKKLLKSIVNTNPKWTGSLN |
| Ga0098061_11215815 | 3300010151 | Marine | MKYKFTVIEEGKEPEEKESMSFKKLLKSIVNTNPKWTGSLNYNNKKG |
| Ga0098061_11323641 | 3300010151 | Marine | MKYKFKVIEDGKPEEEKEAMSFKKLLKSLVTPNPK |
| Ga0098061_11454845 | 3300010151 | Marine | MKYKFKITEDGKPEEEKEGMSFKKILKSLVEPNPKWTGFLNY |
| Ga0098061_12734871 | 3300010151 | Marine | MKYKFKINEEGKPEEEKEGMSFKKILKSLVNTNPKWTGFLHY |
| Ga0098047_101422745 | 3300010155 | Marine | MKYKFKVTEDGKEEIEKEAMSFKKVLKSLVTPNPKWTGWI |
| Ga0098047_101654885 | 3300010155 | Marine | MKEKMRYKFKVYEEGKEIEDKEAMSYKKLLKSLVTPNPKWTGWIAYKNK |
| Ga0151661_12017261 | 3300011261 | Marine | MKYKFKVTEDGKPEEEKESMSFKKLLKSLVEPNPKW |
| Ga0164320_103686193 | 3300013098 | Marine Sediment | MKYTFTVTEEGKEPEEKESMSFKKLLKSLVTPNPKWT |
| Ga0181367_10572291 | 3300017703 | Marine | MKYKFKIQEEDKETEEKEGMSYKKTLKSLVTLNPKWTGWIAYTNKKDK |
| Ga0181371_10512701 | 3300017704 | Marine | MKYKFKIQEDGKEVEEKEGMSFKRTLKSLVTPNPKW |
| Ga0181372_10177361 | 3300017705 | Marine | MKYKFKITEDGKPEVEKEGMSFKKILKSLVEPNPKWT |
| Ga0181372_10314342 | 3300017705 | Marine | MKYTFTVTEEGKESEQKESMSFKKLLKSLITPNPKWTGSLN |
| Ga0181375_10693944 | 3300017718 | Marine | MKYKFTVIEEGKEPEEKESMSFKKLLKSIVNTNPK |
| Ga0181400_11457042 | 3300017752 | Seawater | MRYKFKIYEDGKEIEDKEAMSFKKLLKSLVIPNSKWTGWIAYKNKKG |
| Ga0181432_11860281 | 3300017775 | Seawater | MRYKFKVYEEGKDIEDKEAMSFKKLLKSLVNPNSKWTGL |
| Ga0181432_12561331 | 3300017775 | Seawater | MRYKFKITEDGKPEIEKEAMSFKKLLKSLVNPNPKWTGFMSYENKKGIP |
| Ga0211613_10229155 | 3300020353 | Marine | MKYKFKIKEEGKEEEEKESMSFKKMLKSLAITKPQWTGTLSYVNKKGKHT |
| Ga0211642_103839861 | 3300020449 | Marine | MKYKFKIQEENKEIEEKEGMSFKKTLKSLVMTNPEWNGIIEYINKK |
| Ga0187833_105109994 | 3300022225 | Seawater | MKEKMKYTFKIREEGKEDIEKEGMSFKRILKSLVEL |
| (restricted) Ga0255050_100017061 | 3300024052 | Seawater | MKYKFKVTEDGKPEEEKESMSFKKLLKSLVALNPKWTGF |
| (restricted) Ga0255048_106055381 | 3300024518 | Seawater | MKYKFTVAEEGKPTEEKESMSFKKLFKSLININPKWTG |
| Ga0207889_10294512 | 3300025042 | Marine | MKYKFQVTQDGKKEEKESMSFKKLLKSLVTPNPKWTGFISY |
| Ga0207901_10543723 | 3300025045 | Marine | MKEKRRYKFKVTEDGKPEEEKEAMSFKKLLKSLVIPNPKWTGFMSYENK |
| Ga0207902_10319793 | 3300025046 | Marine | MRYKFKVYEEGKEIENKEAMSFKRLLKSLVASNPKWAGWIAYKNKKDN |
| Ga0207906_10471241 | 3300025052 | Marine | MKYKFKVTEDGKPEEEKESMSYKKLLKSLVEPNPKWTGF |
| Ga0208667_10438831 | 3300025070 | Marine | MKYKFKVTEDGKPEEEKESMSFKKVLKSLVSTNPKWTGF |
| Ga0208667_10559424 | 3300025070 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVSTNPK |
| Ga0208668_10640921 | 3300025078 | Marine | MRYKFKIQEGDKEIEEKEGMSYKKTLKSLVTPNPKWSGWIAYKN |
| Ga0208668_10855862 | 3300025078 | Marine | MKYKFKIQEENKEIEEKEGMSYKKTLKSLVTPNPKWSGWIA |
| Ga0208298_10508014 | 3300025084 | Marine | MKYKFTVTEEGKEPEEKDSMSFKKLLKSIVNTNPKWTGSLN |
| Ga0208010_10531824 | 3300025097 | Marine | MRYKFKVYEEGKEIEDKEAMSFKKLLKSLVTPNPKWTGW |
| Ga0208013_10777364 | 3300025103 | Marine | MKYKFTVTEEGKEPEEKDSMSFKKLLKSIVNTNPKWTG |
| Ga0208013_11352292 | 3300025103 | Marine | MKYKFKVTEDGKEEIEKEAMSFKKLFKSLVTPNPK |
| Ga0208793_10536425 | 3300025108 | Marine | MKYKFTVTEEGKEPEEKESMSFKKLLKSIVNTNPKWTGSLN |
| Ga0208793_10808404 | 3300025108 | Marine | MKYKFKITEDGKPEEEKDGMSFKKILKSLVSTNPKWTGFLN |
| Ga0208553_10992571 | 3300025109 | Marine | MKYKFKITKDGVESEEKEAMSYKKLLKSLVTGEPKWSGTIK |
| Ga0208553_11231403 | 3300025109 | Marine | MRYKFKVYEDGKEIEDKEAMSFKKLLKSLVTPNPKWA |
| Ga0208158_10421586 | 3300025110 | Marine | MKYKFTVIEEGKEPEEKESMSFKKLLKSIVNTNPKWTGSLNY |
| Ga0209349_10977415 | 3300025112 | Marine | MKYKFKIQEEDKETEEKEGMSYKKTLKSLVTPNPKWTGWIAYKNKK |
| Ga0209349_11652123 | 3300025112 | Marine | MKYKFKITEDGKPEEEKEGMSFKKILKSLVNTNPKW |
| Ga0208433_10372791 | 3300025114 | Marine | MRYKFKVYEDGKEIEDKEAMSFKKLLKSLVIPNPKWTGWIAYQNK |
| Ga0208790_10854686 | 3300025118 | Marine | MKYKFKITEDGKPEEEKEGMSFKKILKSLVEPNPKWTGFLN |
| Ga0208790_11217761 | 3300025118 | Marine | MKYKFTVTEEGKEPEEKDSMSFKKLLKSIVNTNPKWTGSLNYNNKK |
| Ga0208790_11360661 | 3300025118 | Marine | MKYKFKITEEGKPEEEKEGMSFKKILKSLVEPNPKWT |
| Ga0209434_11273422 | 3300025122 | Marine | MRYKFKITEDGKEEIEKEAMSFKKLLKSLVTPNPKWTGFMSY |
| Ga0209128_10840275 | 3300025131 | Marine | MKYKFKITEDGKPEEEKEGMSFKKILKSLVNANPKWTGFL |
| Ga0208299_10929144 | 3300025133 | Marine | MKYKFKVTEDGKPEEEKEAMSFKKLLKSLVTPNPKWTGLL |
| Ga0208299_11257151 | 3300025133 | Marine | MKYTFTVTEEGKEPEQKESMSFKKLLKSLVIPNPKWTGLLNYNNKK |
| Ga0208299_11580533 | 3300025133 | Marine | MRYKFKVTEDGKEEIEKEAMSFKKLLKSLVTPNPKWTGFMSYENKK |
| Ga0208299_12039103 | 3300025133 | Marine | MRYKFKIQEEDKEIEEKEGMSYKKILKSLVTLNPKWTGWIAYKNKKDR |
| Ga0208299_12236693 | 3300025133 | Marine | MKYKFKVTEDGKEEIEKEAMSFKKLLKSLVTPNPKWTG |
| Ga0208299_12338763 | 3300025133 | Marine | MKYKFTVAEEGKPTEEKESMSFKKLFKSLITTNPKWTGSL |
| Ga0208299_12344531 | 3300025133 | Marine | MKEKMRYKFKVYEEGKDIEDKEAMSFKKLLKSLVNPNPKWTGWIAYKNKK |
| Ga0209756_12778101 | 3300025141 | Marine | MRYKFKITEDNKPAVEKEAMSFKKLKKSLFIVNPKWSGVVGYKNKKD |
| Ga0209756_13164421 | 3300025141 | Marine | MKYTFTVTEEGKEPEEKESMSFKKLLKSIVNTNPKWT |
| Ga0207895_10308361 | 3300025260 | Deep Ocean | MRYKFKVSEDGKDDEEKEAMSYKKVLKSLITSNPK |
| Ga0208179_10359746 | 3300025267 | Deep Ocean | MGKKKEEMRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWTGFM |
| Ga0207894_10296971 | 3300025268 | Deep Ocean | MKEKMKYTFKIREEGKEDIEKEGMSFKRILKSLVELNPKWTGWIAYKNKK |
| Ga0207894_10351551 | 3300025268 | Deep Ocean | MKYKFKIQEDGKEVEEKEGMSYKKTLKSLVTLNPKWTGW |
| Ga0208449_10585213 | 3300025280 | Deep Ocean | MRYKFKVYEEGKEIEDKEAMSFKKLLKSLVNPNPKWTGWIAYKNKK |
| Ga0208934_10078061 | 3300025293 | Deep Ocean | MKEKMRYKFKVYEEGKEVEDKEAMSYKKLLKSLVTPNPKW |
| Ga0208316_10298235 | 3300025296 | Deep Ocean | MGKKKEEMRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWTGW |
| Ga0208684_11691803 | 3300025305 | Deep Ocean | MGKKKEEMRYKFKVTEDGKPEVEKEAMSFKKLLKSLVTPNPKWTGWIAYK |
| Ga0209757_101541772 | 3300025873 | Marine | MRYKFKVTEDGKPEEEKEEMSFKKLLKSLVIPNPKWTG |
| Ga0208451_10175504 | 3300026103 | Marine Oceanic | MRYKFKVYEEGKEIKDKEAMSYKKVLKSLITGNPKWTGWI |
| Ga0208560_10342761 | 3300026115 | Marine Oceanic | MRYKFKVTEDGKEEIEKEAMSFKKVLKSLVTPNPKWTGWI |
| Ga0207989_10360087 | 3300026209 | Marine | MKYKFKIQEDGKEVEEKEGMSFKRTLKSLVTPNPKWTGWIA |
| Ga0208278_10636081 | 3300026267 | Marine | MKYKFKIQEEDKEIEEKEGMSYKKTLKSLVTPNPKW |
| Ga0208641_11796123 | 3300026268 | Marine | MRYKFKIREEGKEDEEKEDMSFKKILKSLVELNPKWTGWIAYK |
| Ga0208411_11956381 | 3300026279 | Marine | MKYKFKIQEDGKEVEEKEGMSYKKTLKSLVTPNPKWTGWIAYKNKKD |
| (restricted) Ga0255052_105562542 | 3300027865 | Seawater | MKYKFKVTEVDKPEEEKEAMSFKKLLKSLVTPNPKWTG |
| (restricted) Ga0255055_101261231 | 3300027881 | Seawater | MKYKFQVTELDKPEEEKEAMSFKKLLKSLVTPNPKWTGMILYKNK |
| Ga0256382_11681133 | 3300028022 | Seawater | MKYKFKITEDGKPEEEKDGMSFKKILKSLVSTNPKWTGFLNYTNKT |
| Ga0257107_10723773 | 3300028192 | Marine | MKYKFQVTEDGKKEEKESMSYKKLLKSLVTPNPKWTGFIS |
| Ga0310344_114504112 | 3300032006 | Seawater | MRYKFKVTEDGKEGIEKEAMSFKKVLKSLVTPNPKW |
| Ga0310344_114516943 | 3300032006 | Seawater | MKYKFTVTEEGKEPEEKESMSFKKLLKSIVNTNPKWT |
| Ga0326755_026810_443_577 | 3300034628 | Filtered Seawater | MKYKFKVSEDGKDDEEKEAMSYKKVLKSLITSNPKWNGIIEYINK |
| Ga0326746_016699_3_122 | 3300034655 | Filtered Seawater | MRYKFKVSEDGKGDEEKEAMSYKKVLKSLITSNPKWNGII |
| Ga0326748_048710_470_595 | 3300034656 | Filtered Seawater | MRYKFKVHEEGKGDEEKEAMSYKKLLKSLVTSNPKWTGWIAY |
| ⦗Top⦘ |