


| Basic Information | |
|---|---|
| Family ID | F047584 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 149 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FAALTVSVDKALAYFATHPETVLGLFGRYCEESGLELKQAA |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.05 % |
| % of genes near scaffold ends (potentially truncated) | 87.25 % |
| % of genes from short scaffolds (< 2000 bps) | 91.95 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.772 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.805 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.174 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.940 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 3.36 |
| PF13358 | DDE_3 | 2.68 |
| PF01609 | DDE_Tnp_1 | 2.01 |
| PF04055 | Radical_SAM | 1.34 |
| PF13751 | DDE_Tnp_1_6 | 1.34 |
| PF10282 | Lactonase | 1.34 |
| PF01051 | Rep_3 | 1.34 |
| PF13191 | AAA_16 | 0.67 |
| PF01420 | Methylase_S | 0.67 |
| PF00496 | SBP_bac_5 | 0.67 |
| PF04392 | ABC_sub_bind | 0.67 |
| PF01145 | Band_7 | 0.67 |
| PF13426 | PAS_9 | 0.67 |
| PF00122 | E1-E2_ATPase | 0.67 |
| PF05681 | Fumerase | 0.67 |
| PF00583 | Acetyltransf_1 | 0.67 |
| PF05016 | ParE_toxin | 0.67 |
| PF00534 | Glycos_transf_1 | 0.67 |
| PF13482 | RNase_H_2 | 0.67 |
| PF13610 | DDE_Tnp_IS240 | 0.67 |
| PF05598 | DUF772 | 0.67 |
| PF13439 | Glyco_transf_4 | 0.67 |
| PF09130 | DUF1932 | 0.67 |
| PF00578 | AhpC-TSA | 0.67 |
| PF03050 | DDE_Tnp_IS66 | 0.67 |
| PF00892 | EamA | 0.67 |
| PF01927 | Mut7-C | 0.67 |
| PF14319 | Zn_Tnp_IS91 | 0.67 |
| PF09863 | DUF2090 | 0.67 |
| PF13565 | HTH_32 | 0.67 |
| PF13701 | DDE_Tnp_1_4 | 0.67 |
| PF07238 | PilZ | 0.67 |
| PF02371 | Transposase_20 | 0.67 |
| PF00848 | Ring_hydroxyl_A | 0.67 |
| PF00211 | Guanylate_cyc | 0.67 |
| PF16927 | HisKA_7TM | 0.67 |
| PF13517 | FG-GAP_3 | 0.67 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.67 |
| PF00528 | BPD_transp_1 | 0.67 |
| PF01408 | GFO_IDH_MocA | 0.67 |
| PF13551 | HTH_29 | 0.67 |
| PF00464 | SHMT | 0.67 |
| PF00239 | Resolvase | 0.67 |
| PF11794 | HpaB_N | 0.67 |
| PF13613 | HTH_Tnp_4 | 0.67 |
| PF03631 | Virul_fac_BrkB | 0.67 |
| PF12773 | DZR | 0.67 |
| PF00296 | Bac_luciferase | 0.67 |
| PF13384 | HTH_23 | 0.67 |
| PF00413 | Peptidase_M10 | 0.67 |
| PF12760 | Zn_Tnp_IS1595 | 0.67 |
| PF02738 | MoCoBD_1 | 0.67 |
| PF01192 | RNA_pol_Rpb6 | 0.67 |
| PF08241 | Methyltransf_11 | 0.67 |
| PF00857 | Isochorismatase | 0.67 |
| PF04545 | Sigma70_r4 | 0.67 |
| PF01797 | Y1_Tnp | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.01 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.01 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.01 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.01 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.01 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.01 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.34 |
| COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 1.34 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.67 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.67 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.67 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.67 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.67 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.67 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.67 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.67 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.67 |
| COG1951 | Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain | Energy production and conversion [C] | 0.67 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.67 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.67 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.67 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.67 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.67 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.67 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.67 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.77 % |
| Unclassified | root | N/A | 34.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10191823 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300000787|JGI11643J11755_11773129 | All Organisms → cellular organisms → Bacteria → Thermodesulfobacteria → Thermodesulfobacteria → Thermodesulfobacteriales → Thermodesulfobacteriaceae → Thermodesulfatator → Thermodesulfatator indicus | 1048 | Open in IMG/M |
| 3300002120|C687J26616_10016264 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10020763 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300002908|JGI25382J43887_10288389 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004633|Ga0066395_10835334 | Not Available | 555 | Open in IMG/M |
| 3300005294|Ga0065705_10232044 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005294|Ga0065705_10504675 | Not Available | 771 | Open in IMG/M |
| 3300005332|Ga0066388_101293771 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300005332|Ga0066388_101581487 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300005332|Ga0066388_102962974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300005332|Ga0066388_108117781 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 524 | Open in IMG/M |
| 3300005446|Ga0066686_11038079 | Not Available | 530 | Open in IMG/M |
| 3300005540|Ga0066697_10355810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter aalborgensis | 852 | Open in IMG/M |
| 3300005552|Ga0066701_10137741 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1460 | Open in IMG/M |
| 3300005557|Ga0066704_10310713 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005559|Ga0066700_10033154 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
| 3300005713|Ga0066905_101026293 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005764|Ga0066903_101414280 | Not Available | 1308 | Open in IMG/M |
| 3300005764|Ga0066903_104307462 | Not Available | 761 | Open in IMG/M |
| 3300005764|Ga0066903_104574786 | Not Available | 737 | Open in IMG/M |
| 3300006032|Ga0066696_10229052 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300006041|Ga0075023_100041632 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300006797|Ga0066659_10396506 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300006844|Ga0075428_100284718 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1778 | Open in IMG/M |
| 3300006844|Ga0075428_100376480 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300006844|Ga0075428_101851521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300006845|Ga0075421_101100556 | Not Available | 893 | Open in IMG/M |
| 3300006852|Ga0075433_11551734 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006854|Ga0075425_100676614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1185 | Open in IMG/M |
| 3300006880|Ga0075429_101677461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300007076|Ga0075435_101611066 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009012|Ga0066710_100580030 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1699 | Open in IMG/M |
| 3300009038|Ga0099829_10496025 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300009038|Ga0099829_10588203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → Candidatus Methylomirabilis → Candidatus Methylomirabilis oxyfera | 925 | Open in IMG/M |
| 3300009100|Ga0075418_10154637 | Not Available | 2441 | Open in IMG/M |
| 3300009100|Ga0075418_10236209 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300009100|Ga0075418_12433429 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 571 | Open in IMG/M |
| 3300009100|Ga0075418_12899028 | Not Available | 523 | Open in IMG/M |
| 3300009137|Ga0066709_101137425 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300009137|Ga0066709_102082179 | Not Available | 785 | Open in IMG/M |
| 3300009137|Ga0066709_103069235 | Not Available | 611 | Open in IMG/M |
| 3300009137|Ga0066709_103472504 | Not Available | 572 | Open in IMG/M |
| 3300009147|Ga0114129_10272213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2265 | Open in IMG/M |
| 3300009147|Ga0114129_10498334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1591 | Open in IMG/M |
| 3300009147|Ga0114129_10588370 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300009147|Ga0114129_12964728 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 559 | Open in IMG/M |
| 3300009156|Ga0111538_10291419 | Not Available | 2065 | Open in IMG/M |
| 3300009162|Ga0075423_10409286 | Not Available | 1424 | Open in IMG/M |
| 3300009176|Ga0105242_12000322 | Not Available | 622 | Open in IMG/M |
| 3300009553|Ga0105249_12139822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 632 | Open in IMG/M |
| 3300009691|Ga0114944_1126670 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300009691|Ga0114944_1192315 | Not Available | 813 | Open in IMG/M |
| 3300009789|Ga0126307_11599071 | Not Available | 529 | Open in IMG/M |
| 3300009801|Ga0105056_1057147 | Not Available | 558 | Open in IMG/M |
| 3300009817|Ga0105062_1009908 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300010039|Ga0126309_11251297 | Not Available | 512 | Open in IMG/M |
| 3300010046|Ga0126384_10382840 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300010047|Ga0126382_10553128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 937 | Open in IMG/M |
| 3300010047|Ga0126382_12193176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → Micavibrio aeruginosavorus | 531 | Open in IMG/M |
| 3300010047|Ga0126382_12304438 | Not Available | 521 | Open in IMG/M |
| 3300010047|Ga0126382_12336016 | Not Available | 518 | Open in IMG/M |
| 3300010359|Ga0126376_11834143 | Not Available | 645 | Open in IMG/M |
| 3300010362|Ga0126377_11631771 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010366|Ga0126379_10098469 | Not Available | 2593 | Open in IMG/M |
| 3300010366|Ga0126379_10733774 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300010398|Ga0126383_12089638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin222 | 653 | Open in IMG/M |
| 3300010398|Ga0126383_13688109 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012096|Ga0137389_11366262 | Not Available | 603 | Open in IMG/M |
| 3300012096|Ga0137389_11786492 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012199|Ga0137383_10673165 | Not Available | 756 | Open in IMG/M |
| 3300012199|Ga0137383_10753079 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012199|Ga0137383_10767857 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012199|Ga0137383_10876220 | Not Available | 655 | Open in IMG/M |
| 3300012202|Ga0137363_11813299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 503 | Open in IMG/M |
| 3300012205|Ga0137362_10822766 | Not Available | 795 | Open in IMG/M |
| 3300012206|Ga0137380_11409154 | Not Available | 582 | Open in IMG/M |
| 3300012206|Ga0137380_11526432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300012207|Ga0137381_11556437 | Not Available | 552 | Open in IMG/M |
| 3300012209|Ga0137379_10209697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Ae2-Chloro-G1 | 1862 | Open in IMG/M |
| 3300012209|Ga0137379_10302219 | Not Available | 1511 | Open in IMG/M |
| 3300012349|Ga0137387_10467132 | Not Available | 916 | Open in IMG/M |
| 3300012351|Ga0137386_10400036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 989 | Open in IMG/M |
| 3300012351|Ga0137386_10558068 | Not Available | 824 | Open in IMG/M |
| 3300012351|Ga0137386_10985666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 600 | Open in IMG/M |
| 3300012356|Ga0137371_11224092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ardenticatenia | 559 | Open in IMG/M |
| 3300012359|Ga0137385_10152923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2029 | Open in IMG/M |
| 3300012361|Ga0137360_11487645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter ferrugineus | 581 | Open in IMG/M |
| 3300012362|Ga0137361_10450256 | Not Available | 1182 | Open in IMG/M |
| 3300012363|Ga0137390_10559819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1114 | Open in IMG/M |
| 3300012391|Ga0134035_1180378 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 684 | Open in IMG/M |
| 3300012469|Ga0150984_118784098 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012477|Ga0157336_1028127 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012685|Ga0137397_10323367 | Not Available | 1150 | Open in IMG/M |
| 3300012923|Ga0137359_11321641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 609 | Open in IMG/M |
| 3300012929|Ga0137404_10067565 | Not Available | 2793 | Open in IMG/M |
| 3300012929|Ga0137404_11699424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 586 | Open in IMG/M |
| 3300012971|Ga0126369_12614897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 589 | Open in IMG/M |
| 3300012975|Ga0134110_10184845 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300013306|Ga0163162_11507588 | Not Available | 766 | Open in IMG/M |
| 3300014154|Ga0134075_10057041 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300016319|Ga0182033_11641116 | Not Available | 582 | Open in IMG/M |
| 3300016341|Ga0182035_10203970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1566 | Open in IMG/M |
| 3300016371|Ga0182034_11174569 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300016445|Ga0182038_10968331 | Not Available | 752 | Open in IMG/M |
| 3300018031|Ga0184634_10110485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1208 | Open in IMG/M |
| 3300018084|Ga0184629_10028038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2410 | Open in IMG/M |
| 3300021560|Ga0126371_13247148 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300022563|Ga0212128_10323491 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300025149|Ga0209827_10218274 | Not Available | 2004 | Open in IMG/M |
| 3300025149|Ga0209827_10394105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Alicyclobacillaceae → Alicyclobacillus | 2105 | Open in IMG/M |
| 3300025149|Ga0209827_11467346 | Not Available | 695 | Open in IMG/M |
| 3300026118|Ga0207675_100268307 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300026118|Ga0207675_100576221 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300026296|Ga0209235_1160833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 873 | Open in IMG/M |
| 3300027577|Ga0209874_1044370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1172 | Open in IMG/M |
| 3300027846|Ga0209180_10577357 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027873|Ga0209814_10066019 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300027873|Ga0209814_10226360 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300027873|Ga0209814_10232682 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300027882|Ga0209590_10206837 | Not Available | 1242 | Open in IMG/M |
| 3300027903|Ga0209488_10737008 | Not Available | 703 | Open in IMG/M |
| 3300027952|Ga0209889_1038732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1021 | Open in IMG/M |
| 3300028587|Ga0247828_10043619 | Not Available | 1907 | Open in IMG/M |
| 3300028597|Ga0247820_10474591 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300028796|Ga0307287_10362040 | Not Available | 547 | Open in IMG/M |
| 3300028828|Ga0307312_10898676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300030006|Ga0299907_10593940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 862 | Open in IMG/M |
| 3300030830|Ga0308205_1002005 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1584 | Open in IMG/M |
| 3300030902|Ga0308202_1125634 | Not Available | 552 | Open in IMG/M |
| 3300030989|Ga0308196_1057499 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031123|Ga0308195_1063963 | Not Available | 558 | Open in IMG/M |
| 3300031543|Ga0318516_10396974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 795 | Open in IMG/M |
| 3300031744|Ga0306918_11470023 | Not Available | 521 | Open in IMG/M |
| 3300031781|Ga0318547_10409160 | Not Available | 833 | Open in IMG/M |
| 3300031910|Ga0306923_10107159 | All Organisms → cellular organisms → Bacteria | 3159 | Open in IMG/M |
| 3300031942|Ga0310916_11427561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 566 | Open in IMG/M |
| 3300032001|Ga0306922_10255976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1882 | Open in IMG/M |
| 3300032001|Ga0306922_10540530 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300032001|Ga0306922_12038381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 558 | Open in IMG/M |
| 3300032068|Ga0318553_10220511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 990 | Open in IMG/M |
| 3300032174|Ga0307470_11347651 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032261|Ga0306920_100451721 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300032261|Ga0306920_101793480 | Not Available | 866 | Open in IMG/M |
| 3300032261|Ga0306920_103349428 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300034643|Ga0370545_088593 | Not Available | 658 | Open in IMG/M |
| 3300034660|Ga0314781_050508 | Not Available | 745 | Open in IMG/M |
| 3300034666|Ga0314788_101705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 647 | Open in IMG/M |
| 3300034669|Ga0314794_007073 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.70% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.01% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.34% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.34% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.34% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_101918231 | 3300000550 | Soil | MLTASVDKALAYFAMHSETVLCLFGLYCEESGLALKQAA* |
| JGI11643J11755_117731292 | 3300000787 | Soil | MNVSYTLVSTDKALAYFAAHPEMVLDLFGLYCKESAFELKQVA* |
| C687J26616_100162641 | 3300002120 | Soil | IIVSVDKALAYFAQQADAVLGLFGLYCREVGLAK* |
| JGIcombinedJ43975_100207633 | 3300002899 | Soil | LRNNSNKYFKEFATLTVSVDQALAYFATHPEEVLGLFGRYCEES |
| JGI25382J43887_102883892 | 3300002908 | Grasslands Soil | KYFKEFIALTVSVDKALAYFATHPDTVLGLFGRYCEESGLALKQAA* |
| Ga0066395_108353342 | 3300004633 | Tropical Forest Soil | EFIQLTVSVDKALAYFAMHPDTVLGLFGRYCEESGLELKQAA* |
| Ga0065705_102320443 | 3300005294 | Switchgrass Rhizosphere | CKALVELTVSVEKALAYGATPPETVLGLFGRYCEESGLELKQAA* |
| Ga0065705_105046752 | 3300005294 | Switchgrass Rhizosphere | FAVLTASVDKALAYFATHSETVLCLFGLYCEESGLALKQAA* |
| Ga0066388_1012937711 | 3300005332 | Tropical Forest Soil | LSDSDKLSDQYFEEFALLTVSVDKALAYFATHPDTVLGLFGLYCEESGLTLKQAA* |
| Ga0066388_1015814874 | 3300005332 | Tropical Forest Soil | FKEFAALTVSVEKALAYFATHPDTVLGLFGRYCEESGLELKQAA* |
| Ga0066388_1029629742 | 3300005332 | Tropical Forest Soil | EEFALLTVSVDKALAYFATHPETVLGLFGLYCEESGLTLKQAA* |
| Ga0066388_1081177812 | 3300005332 | Tropical Forest Soil | LALTVAVDKALAYFATHPDTVLGLFGRYCEESGLGLKQAA* |
| Ga0066686_110380791 | 3300005446 | Soil | THNKYFKEFAAVVVSVDKALAYFAAHPEMVLDLFGLYCKESDFALKQAA* |
| Ga0066697_103558102 | 3300005540 | Soil | ELTVSVEKALVYFTTHPDTVFGLFGRYCEESGLELKQAA* |
| Ga0066701_101377411 | 3300005552 | Soil | SVDKALAYFATHPEMVLGLFGLYCEESGFELKQAA* |
| Ga0066704_103107132 | 3300005557 | Soil | VSRFKWILALTVSVEKALAYFATPPEEMVSLFGRYCEESGLELKQVA* |
| Ga0066700_100331548 | 3300005559 | Soil | KYFKEFVELTVSVEKALVYFTTHPDTVFGLFGRYCEESGLELKQAA* |
| Ga0066905_1010262932 | 3300005713 | Tropical Forest Soil | KEVAAVVVSADKALAYFAAHPEMVLELLGLYCKESAFELKQVA* |
| Ga0066903_1014142801 | 3300005764 | Tropical Forest Soil | YFKEFLALTVSVDKALAYFATHPDTVLGLFGRYCEDSGLELKQAA* |
| Ga0066903_1043074623 | 3300005764 | Tropical Forest Soil | VSVEKALAYFAAHPDTVLGLFGLYCEESGLELKQAA* |
| Ga0066903_1045747861 | 3300005764 | Tropical Forest Soil | MALTVSVDKALAHCVTTPDMPVGLFGLYCEASGWERKQAA* |
| Ga0066696_102290521 | 3300006032 | Soil | GAVEKALAYFATHPETVLGLFGRYCEESGLELAQAA* |
| Ga0075023_1000416321 | 3300006041 | Watersheds | NKYFKEFAELTVSVEKALASFATHSEILLGLFGLSCEESGLELKQAA* |
| Ga0066659_103965062 | 3300006797 | Soil | LLTVSVDKALVYFATHPETVLGLFGLYCEESGLALKQAA* |
| Ga0075428_1002847181 | 3300006844 | Populus Rhizosphere | ADKALAYFAAHPEMVLELLGLYCKESAFELKQVA* |
| Ga0075428_1003764801 | 3300006844 | Populus Rhizosphere | VSVEKALAYFATHPDTVFGLFGRYCEESGVELQQAA* |
| Ga0075428_1018515213 | 3300006844 | Populus Rhizosphere | FKEFAALTVSVDKALAYFATHPDTVLALFGLYCEESDLELKQAA* |
| Ga0075421_1011005562 | 3300006845 | Populus Rhizosphere | LTVSVEKALAYFATHPDTVLGLFGRYCKESGLELQRAA* |
| Ga0075433_115517342 | 3300006852 | Populus Rhizosphere | ATYNKYFKEFAAVVISADKALVYFAAHPEMVLELLRLYCKESAFELKQVA* |
| Ga0075425_1006766142 | 3300006854 | Populus Rhizosphere | VLTASVDKALVYFATHSETVLCLFGLYCEESGLALKQAA* |
| Ga0075429_1016774613 | 3300006880 | Populus Rhizosphere | TLTVSVDQALADFATHPEEVLGLFGRYCEESGLELKQAA* |
| Ga0075435_1016110662 | 3300007076 | Populus Rhizosphere | VDKALASFATHPDTVLGLFGLYCEESGLVLKQAA* |
| Ga0066710_1005800301 | 3300009012 | Grasslands Soil | NKYFKEFAELTVSVEKALAYFATHSETVLGLFGRYCEESGLELKQAA |
| Ga0099829_104960251 | 3300009038 | Vadose Zone Soil | KEFAAMTVSVEKALAYFATHPETVFGLFGRYCEESGLELKQAA* |
| Ga0099829_105882032 | 3300009038 | Vadose Zone Soil | TVSVDKALAYVAVHLETVSGLFGLYCQESGLELKQAA* |
| Ga0075418_101546373 | 3300009100 | Populus Rhizosphere | HNKYFKEFATLTVSVDQALAYFATHSKEVLGLFGRYCEESGLELKQAA* |
| Ga0075418_102362091 | 3300009100 | Populus Rhizosphere | FKEFIVLTVSVDKALAYFATHPDTVLGLFGRYCEESGLKLKQAA* |
| Ga0075418_124334292 | 3300009100 | Populus Rhizosphere | VALTVSVEKALAYFATHPEEIVSLFGRYCEESGLELKQVA* |
| Ga0075418_128990281 | 3300009100 | Populus Rhizosphere | FKEFAALTVSVEKALAYFATHPDTVLDLFGCYCEESGLELQQAA* |
| Ga0066709_1011374253 | 3300009137 | Grasslands Soil | VELTVSVEKALAYFATHPDTVFGLFGRYCEESGLELKQAA* |
| Ga0066709_1020821791 | 3300009137 | Grasslands Soil | EFGALTVSVDKALANFATHPDTVLGLFGRYCEESGLELQQAA* |
| Ga0066709_1030692351 | 3300009137 | Grasslands Soil | MISVDKALAHFASHSETVFGLFGRYCEESGLELNQAA* |
| Ga0066709_1034725041 | 3300009137 | Grasslands Soil | FAVLTVSVDKALTYFATHVDTVLGLFGLYWEESGLALKHAA* |
| Ga0114129_102722134 | 3300009147 | Populus Rhizosphere | ALTVSVDKALASFATHPDTVLGLFGLYCEESGLVLKQAA* |
| Ga0114129_104983343 | 3300009147 | Populus Rhizosphere | AAVVVSVDKALAYFAAHPEMVLDLFGLYCKESAFELKQAA* |
| Ga0114129_105883703 | 3300009147 | Populus Rhizosphere | SVEKALAYFATHPDTVLGLFGRYCEESGLELKQAA* |
| Ga0114129_129647281 | 3300009147 | Populus Rhizosphere | EFAALTVSVDNALAYIATHPEEVLGLFGRYCEESGLERKQAA* |
| Ga0111538_102914191 | 3300009156 | Populus Rhizosphere | YFKEFALLTVSVEKALAYFAVHPEMVLGLFGRYCEDSGLELAQAA* |
| Ga0075423_104092862 | 3300009162 | Populus Rhizosphere | VLTVSVDKALTYFATHPDTVLGLFGLYCEESGLELKQAA* |
| Ga0105242_120003221 | 3300009176 | Miscanthus Rhizosphere | AALTVSVEKALAYFATHPDTVLGLFGRYCKESGLALQQAA* |
| Ga0105249_121398221 | 3300009553 | Switchgrass Rhizosphere | FKEFAAVVVSVDKALAYFAAHPEMVLDLFGLYCKESAFELKQAA* |
| Ga0114944_11266702 | 3300009691 | Thermal Springs | LTVSVDKALAYFATHPEEVLGLFGRYCEESGLELRQAA* |
| Ga0114944_11923151 | 3300009691 | Thermal Springs | VLTVSVDKALAYFATHPEDVLGLFGRYCEESGLELKQAA* |
| Ga0126307_115990711 | 3300009789 | Serpentine Soil | VSVEKALAYFATHPDTVFGLFGRYCEESGLELQQAA* |
| Ga0105056_10571472 | 3300009801 | Groundwater Sand | KEFAALTVSVDKALAYFATHPETVSGLFGLYCQESGLELKQAA* |
| Ga0105062_10099082 | 3300009817 | Groundwater Sand | ALTVSVDKALAYFATHPDTVLGLFGLYCEESGLELKQAA* |
| Ga0126309_112512971 | 3300010039 | Serpentine Soil | EHIDRKSQAFAALTVSVEKALAYFATHPEEIASLFGRYCEESGLELKQVA* |
| Ga0126384_103828401 | 3300010046 | Tropical Forest Soil | QYFEEFALLTVSVDKALAYFATHPDTVLGLFGLYCKESGLTLKQAA* |
| Ga0126382_105531283 | 3300010047 | Tropical Forest Soil | KYFKEFITLTVSVDKALAYFATHPDTVLGLFGRYCEESGLELKQAA* |
| Ga0126382_121931761 | 3300010047 | Tropical Forest Soil | ALTASVDQALAYFATHPDTVCGLFGRYCEESGLELKQAA* |
| Ga0126382_123044381 | 3300010047 | Tropical Forest Soil | EFEALTVSVDKALAYFAMHLEIALELFRLYYEESGLKLKQTV* |
| Ga0126382_123360162 | 3300010047 | Tropical Forest Soil | ISVEKALAYFATHPEEVLGLFGRYCKESGLELKQAA* |
| Ga0126376_118341431 | 3300010359 | Tropical Forest Soil | YFKEFATLTVSVDKALAYFATHPDTMLGLFGLYCEESGLVLKQAA* |
| Ga0126377_116317712 | 3300010362 | Tropical Forest Soil | HNPYFKEFALLTVSVEKALAYFATHPDTVLGPCGFFCEESGLELEQGA* |
| Ga0126379_100984691 | 3300010366 | Tropical Forest Soil | THNKYFKEFTELTVSVEKALAYFATHAETVAGLFGRYCEESGLELKQAA* |
| Ga0126379_107337742 | 3300010366 | Tropical Forest Soil | YFKEFAALTVSVEKALAYFATHPDTVLGLFGLYCEESGLTLKQAA* |
| Ga0126383_120896381 | 3300010398 | Tropical Forest Soil | YFKEFATLTVSVDKALAYFATHPDTMLGLFGLYCQESGLVVKQAA* |
| Ga0126383_136881092 | 3300010398 | Tropical Forest Soil | MSVDKALAYFATHPDTVLGLFGLYCEESGLELKRAY |
| Ga0137389_113662622 | 3300012096 | Vadose Zone Soil | FKEFAAVVVSVDKALAYFAAHPEMVLDRFGRYWKESDLALKQAA* |
| Ga0137389_117864921 | 3300012096 | Vadose Zone Soil | VEKALAYFAMHPETVFGLFGRYCEESGLELKQAA* |
| Ga0137383_106731652 | 3300012199 | Vadose Zone Soil | ALTVSVDKALAYFATHPDTVLGLCGLYCEESGLELKQAA* |
| Ga0137383_107530792 | 3300012199 | Vadose Zone Soil | SGDKALAYFATHAETVLCLWGLYCDESGLALKQAA* |
| Ga0137383_107678572 | 3300012199 | Vadose Zone Soil | EFAVLTASGDKALAYFATHAETVLCLWGLYCDESGLALKQAT* |
| Ga0137383_108762202 | 3300012199 | Vadose Zone Soil | VSVDKALASFATHPDMVLELFGLYCEDSGLELKQAA* |
| Ga0137363_118132991 | 3300012202 | Vadose Zone Soil | FAALTVSVDKALAYFATHPDTVLGLFGLYCEESGLELKQAA* |
| Ga0137362_108227662 | 3300012205 | Vadose Zone Soil | NQYFKEFAALTVSVDKALAYFATHPDMVLGLFGLYCEESGLELKQAA* |
| Ga0137380_114091541 | 3300012206 | Vadose Zone Soil | QYFKEFAALTVSVDKALASFATHPDMVLELFGLYCEDSGLELKQAA* |
| Ga0137380_115264321 | 3300012206 | Vadose Zone Soil | VDKALTYFAAHPETVLGLFGRYCEESGLELKQAA* |
| Ga0137381_115564372 | 3300012207 | Vadose Zone Soil | SVDKALAYFATHPEMVLGLFGLYCEESSLELKQAA* |
| Ga0137379_102096971 | 3300012209 | Vadose Zone Soil | ASGDKALAYFATHAETVLCLWGLYCDESSLALKQAA* |
| Ga0137379_103022192 | 3300012209 | Vadose Zone Soil | SVDKALAYFATHPDTVLGLFGLYCEESDMELKQAA* |
| Ga0137387_104671321 | 3300012349 | Vadose Zone Soil | QYFKEFAALTVSVDKALAYFATHPDTVLGLFGLYCEESDMELKQAA* |
| Ga0137386_104000362 | 3300012351 | Vadose Zone Soil | MWFAALTISVEKALAYFATHPEEVLGLLGRYCEESGLELKQAA* |
| Ga0137386_105580681 | 3300012351 | Vadose Zone Soil | FVALTVSVDKALAYFATHAETVLGLFGRYCEESGLALQQAA* |
| Ga0137386_109856662 | 3300012351 | Vadose Zone Soil | LRIEFKEFVDLTMSVEKGLAYFATHPETVFGLFGRYCEESGLELKQAA* |
| Ga0137371_112240921 | 3300012356 | Vadose Zone Soil | KYFKEFAELTVSVEKALAYFATHPDTVLGLFGRYCEESGLELQQAA* |
| Ga0137385_101529233 | 3300012359 | Vadose Zone Soil | AELTVSVEKALAYFATHSETVLGLFGRYCEESGLELKQAA* |
| Ga0137360_114876451 | 3300012361 | Vadose Zone Soil | QYFKEFAALTVSVDKALAYCATPPAMVLGLFGLYCEESGLELKQAA* |
| Ga0137361_104502563 | 3300012362 | Vadose Zone Soil | FKEFAAVVVSVDKALTYFAAHPEMVLDLFGLYCKESDFALKQAA* |
| Ga0137390_105598191 | 3300012363 | Vadose Zone Soil | ECAALTVSVEQALTYVAPHPDTVLGLFGRYGEESGLALQQAT* |
| Ga0134035_11803781 | 3300012391 | Grasslands Soil | TGAVEKALAYFATHPETVLGLFGRYCEESGLELAQAA* |
| Ga0150984_1187840981 | 3300012469 | Avena Fatua Rhizosphere | FKEFATLTVSVDKALAYFATHPEEVLGLFGRYCEESGLELKQAA* |
| Ga0157336_10281271 | 3300012477 | Arabidopsis Rhizosphere | LTVSVDKALAFFATHADEVLGLFGRYCEESGLELKQAA* |
| Ga0137397_103233672 | 3300012685 | Vadose Zone Soil | QYFKGFAVLTASGDKALASFATHSETVLCLFGLYCEESGLALKQAA* |
| Ga0137359_113216412 | 3300012923 | Vadose Zone Soil | ISVEQALAYCATPPEAVLGLFGCYCEESGLELQQAA* |
| Ga0137404_100675652 | 3300012929 | Vadose Zone Soil | MHTKYFKEFIALTVSVDKALAYFATHPDTVFGLFGRYCEESGLALKQAA* |
| Ga0137404_116994242 | 3300012929 | Vadose Zone Soil | TVSVDKALAYFATHPEEVLGLFGRYCEESGLELKQAA* |
| Ga0126369_126148972 | 3300012971 | Tropical Forest Soil | VSVEKALAYFATHPDTVLGLFGRYCEESGLALQQAA* |
| Ga0134110_101848451 | 3300012975 | Grasslands Soil | NKYFKEFAAVVVSVDKVLAYFAAHPEMVLDLFGLYCKESDFAFKQAA* |
| Ga0163162_115075881 | 3300013306 | Switchgrass Rhizosphere | KEFAVLTVSVDKALTYFATHPDTVLGLFGLYCEESGLELQQAA* |
| Ga0134075_100570412 | 3300014154 | Grasslands Soil | LTMSVDKALAYFATHPEMVLGLFGLYCEESGFELKQAA* |
| Ga0182033_116411161 | 3300016319 | Soil | KEFAALTVSVDKALAYFATHPDTVLGLFGLYCAESDLELKQAA |
| Ga0182035_102039701 | 3300016341 | Soil | IELTVSVDKALAYFATHPETVLGLFRRYCEESGLELQQAA |
| Ga0182034_111745692 | 3300016371 | Soil | VSVDKALAYFATHPEEVFGLFGRYCEESGLELKQAT |
| Ga0182038_109683312 | 3300016445 | Soil | VSVDKALAYFATHPDTALGLFGLYCEESDLELKQAA |
| Ga0184634_101104851 | 3300018031 | Groundwater Sediment | ATHNKYFKEFAALTISVEKALAYFATHPEEVLGLFGRYCEESGLELKQAA |
| Ga0184629_100280381 | 3300018084 | Groundwater Sediment | TVSGDKALAYFATHPDMVLGLFGRYREESGLALKQAA |
| Ga0126371_132471481 | 3300021560 | Tropical Forest Soil | KYFKEFTALTVSVDKALAYFAMHPDTVLGLFGRYCEESGLELKQAA |
| Ga0212128_103234911 | 3300022563 | Thermal Springs | AVLTVSVDTALAYFATHPDMVLGLFGLYGEESGLALKQAA |
| Ga0209827_102182742 | 3300025149 | Thermal Springs | LTVSVDKALAYFATHPEEVLGLFGRYCEESGLELRQAA |
| Ga0209827_103941055 | 3300025149 | Thermal Springs | VTLTVSVDKALAYFATHPEEVLGLFGRYCEESGLELRQAA |
| Ga0209827_114673461 | 3300025149 | Thermal Springs | VLTVSVDKALAYFATHPEDVLGLFGRYCEESGLELKQAA |
| Ga0207675_1002683073 | 3300026118 | Switchgrass Rhizosphere | FAVLTVSVDKALTYFATHPDTVLGLFGLYCEENGLELQQAA |
| Ga0207675_1005762211 | 3300026118 | Switchgrass Rhizosphere | FAVLTVSVDKALTYFATHPDTVLGLFGLYCEESGLELQQAA |
| Ga0209235_11608331 | 3300026296 | Grasslands Soil | FQEFATLTVSVDKALAYFATHPEEVVGLFGRYCEESGLELKQAA |
| Ga0209874_10443701 | 3300027577 | Groundwater Sand | FAVLTASVDKALAYFATHSETVLCLFGLYCEESGLALKQAA |
| Ga0209180_105773572 | 3300027846 | Vadose Zone Soil | THNKYFKEFIALTVSVDKALVYFATHPETVFGLFGRYCEESGLELQQAA |
| Ga0209814_100660191 | 3300027873 | Populus Rhizosphere | FKEFAVLTASVDKALVYFATHSETVLCLFGLYCEESGLALKQAA |
| Ga0209814_102263601 | 3300027873 | Populus Rhizosphere | VLTVSVAKALTYFATHPDTVLGLLGLYCEESGLELKQAA |
| Ga0209814_102326821 | 3300027873 | Populus Rhizosphere | VISADKALVYFAAHPEMVLELLRLYGKESAFELKQVA |
| Ga0209590_102068371 | 3300027882 | Vadose Zone Soil | NKYFKEFAAMTVSVEKALAYFATHPDTVLGLFGSYCEESGLELTQAA |
| Ga0209488_107370081 | 3300027903 | Vadose Zone Soil | LTVSVEKALTYVAPHPDTVLGLFGRYGEESGLALQQAA |
| Ga0209889_10387321 | 3300027952 | Groundwater Sand | RECGKPDDKYFKKFAAWTVSGDKALAYFATHPETVLGLFGLYCEESGVEK |
| Ga0247828_100436192 | 3300028587 | Soil | EFTELTVSVEKALAYFAAHPDTVFGLFGRYCEESGLELQQAA |
| Ga0247820_104745912 | 3300028597 | Soil | VSVEKALAYGATHSETVLGLFGRYCEESGLELKQAA |
| Ga0307287_103620402 | 3300028796 | Soil | QYFKEFAALTVSVDKALAYFATHPETVLGLFGRYCEESGLELKQAA |
| Ga0307312_108986761 | 3300028828 | Soil | FKEFAALTVSVDKALAYFARHPETVLGLFGLYCEESGLELKQAA |
| Ga0299907_105939401 | 3300030006 | Soil | VELTVSVEKALAYFATHPDTVLGLFGRYCEENGFECKQAA |
| Ga0308205_10020053 | 3300030830 | Soil | FAALTVSVDKALAYFATHPETVLGLFGRYCEESGLELKQAA |
| Ga0308202_11256342 | 3300030902 | Soil | FKEFTALTVSVDKALAYFATHPDTVLGLFGRYCEESGLELKQAA |
| Ga0308196_10574992 | 3300030989 | Soil | SVEKALAYFATHSEILLGLFGRYCEESGLELKQAA |
| Ga0308195_10639631 | 3300031123 | Soil | KEFAALTVSVEKALAYFATHPDTVLGLFGCYREESGLELTQAA |
| Ga0318516_103969741 | 3300031543 | Soil | ELTVSVDKALAYFATHPEMVLGLFGRYCEESGLPLKQAV |
| Ga0306918_114700231 | 3300031744 | Soil | TVSVDKALAYFATHPEEVLGLFGCYCEESGLECKQAA |
| Ga0318547_104091602 | 3300031781 | Soil | FTALMVSVEQALAYFAMHPDTVFSLFGRYCEESGLELTQAA |
| Ga0306923_101071592 | 3300031910 | Soil | LVNKYFKEFAELTVSVDKALAYFATHPEMVLGLFGRYCEESGLPLKQAV |
| Ga0310916_114275612 | 3300031942 | Soil | ALTVSVDKALACFATHADEVLELCGRYCEESGLDLQQAA |
| Ga0306922_102559761 | 3300032001 | Soil | FAMLTASVDKALAYFAMHSETVLCLFGLYCEESGLALQQAA |
| Ga0306922_105405301 | 3300032001 | Soil | LVNKYFKEFAELTVSVDKALAYFATHPEMVLGLFGRYCEESGLPLKQAA |
| Ga0306922_120383812 | 3300032001 | Soil | RGAECASVDKALAYFAMHPDTVLGLFGRYCEESGLELKQAA |
| Ga0318553_102205113 | 3300032068 | Soil | VSVDKALAYCATHPEEVLGLFGCYCEESGLECKQAA |
| Ga0307470_113476512 | 3300032174 | Hardwood Forest Soil | VVVSVDKALAYFAAHPEMVLELLGLYCKESAFELKQVA |
| Ga0306920_1004517213 | 3300032261 | Soil | FKELATLTVSVDKALAYCATHPEEVLGLLGCYCEESGLECKQAA |
| Ga0306920_1017934801 | 3300032261 | Soil | VSVDKALAYFATHPDTVLGLFGRYCEESGLELPQAA |
| Ga0306920_1033494282 | 3300032261 | Soil | LKQIPVSVEKALAYFATHPEAVLGLFGRYCEESGLELKQAA |
| Ga0370545_088593_338_448 | 3300034643 | Soil | VSGDKALAYFATHPDMVLGLFGRYREESGLELKQAA |
| Ga0314781_050508_3_149 | 3300034660 | Soil | HNKYFKEFATLPVSVDQALAYFATHSKEVLGLFGRYCEESGLELKQAA |
| Ga0314788_101705_528_647 | 3300034666 | Soil | ALTVSVEKALAYFATHPEEIVSLFGRYCEESGLELKQVA |
| Ga0314794_007073_1346_1492 | 3300034669 | Soil | HNKYFKEFATLTVSVDQALAYFATHSKEVLGLFGRYCEESGLELKQAA |
| ⦗Top⦘ |