


| Basic Information | |
|---|---|
| Family ID | F047519 |
| Family Type | Metagenome |
| Number of Sequences | 149 |
| Average Sequence Length | 40 residues |
| Representative Sequence | AGGCVARRLRIDLDMRPPRALPAAHFERNDVIIICETVH |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 149 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.66 % |
| % of genes from short scaffolds (< 2000 bps) | 84.56 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.691 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.255 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.886 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.772 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 149 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 2.68 |
| PF00005 | ABC_tran | 2.68 |
| PF00171 | Aldedh | 2.68 |
| PF13701 | DDE_Tnp_1_4 | 2.01 |
| PF01804 | Penicil_amidase | 1.34 |
| PF06240 | COXG | 1.34 |
| PF03167 | UDG | 1.34 |
| PF02698 | DUF218 | 1.34 |
| PF09822 | ABC_transp_aux | 1.34 |
| PF14520 | HHH_5 | 0.67 |
| PF04365 | BrnT_toxin | 0.67 |
| PF00190 | Cupin_1 | 0.67 |
| PF00472 | RF-1 | 0.67 |
| PF05635 | 23S_rRNA_IVP | 0.67 |
| PF13458 | Peripla_BP_6 | 0.67 |
| PF02660 | G3P_acyltransf | 0.67 |
| PF09992 | NAGPA | 0.67 |
| PF00293 | NUDIX | 0.67 |
| PF13426 | PAS_9 | 0.67 |
| PF12802 | MarR_2 | 0.67 |
| PF00583 | Acetyltransf_1 | 0.67 |
| PF01569 | PAP2 | 0.67 |
| PF02775 | TPP_enzyme_C | 0.67 |
| PF00571 | CBS | 0.67 |
| PF05977 | MFS_3 | 0.67 |
| PF13483 | Lactamase_B_3 | 0.67 |
| PF13493 | DUF4118 | 0.67 |
| PF00155 | Aminotran_1_2 | 0.67 |
| PF00400 | WD40 | 0.67 |
| PF00507 | Oxidored_q4 | 0.67 |
| PF02492 | cobW | 0.67 |
| PF01656 | CbiA | 0.67 |
| PF08379 | Bact_transglu_N | 0.67 |
| PF00535 | Glycos_transf_2 | 0.67 |
| PF06831 | H2TH | 0.67 |
| PF13565 | HTH_32 | 0.67 |
| PF00270 | DEAD | 0.67 |
| PF13302 | Acetyltransf_3 | 0.67 |
| PF05050 | Methyltransf_21 | 0.67 |
| PF14486 | DUF4432 | 0.67 |
| PF02463 | SMC_N | 0.67 |
| PF07724 | AAA_2 | 0.67 |
| PF14579 | HHH_6 | 0.67 |
| PF02826 | 2-Hacid_dh_C | 0.67 |
| PF08819 | DUF1802 | 0.67 |
| PF01850 | PIN | 0.67 |
| PF01075 | Glyco_transf_9 | 0.67 |
| PF01408 | GFO_IDH_MocA | 0.67 |
| PF01590 | GAF | 0.67 |
| PF02537 | CRCB | 0.67 |
| PF13460 | NAD_binding_10 | 0.67 |
| PF03721 | UDPG_MGDP_dh_N | 0.67 |
| PF02653 | BPD_transp_2 | 0.67 |
| PF14023 | DUF4239 | 0.67 |
| PF00330 | Aconitase | 0.67 |
| PF08402 | TOBE_2 | 0.67 |
| PF01547 | SBP_bac_1 | 0.67 |
| PF01965 | DJ-1_PfpI | 0.67 |
| PF01526 | DDE_Tnp_Tn3 | 0.67 |
| PF01726 | LexA_DNA_bind | 0.67 |
| PF17131 | LolA_like | 0.67 |
| PF13520 | AA_permease_2 | 0.67 |
| PF10282 | Lactonase | 0.67 |
| PF02517 | Rce1-like | 0.67 |
| PF00480 | ROK | 0.67 |
| PF00291 | PALP | 0.67 |
| PF09347 | DUF1989 | 0.67 |
| PF04028 | DUF374 | 0.67 |
| PF01878 | EVE | 0.67 |
| PF06182 | ABC2_membrane_6 | 0.67 |
| PF03747 | ADP_ribosyl_GH | 0.67 |
| PF07963 | N_methyl | 0.67 |
| PF03466 | LysR_substrate | 0.67 |
| PF13365 | Trypsin_2 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.68 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.68 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.68 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.34 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 1.34 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.34 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.34 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.34 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 1.34 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 1.34 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.34 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.67 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.67 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
| COG0344 | Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase | Lipid transport and metabolism [I] | 0.67 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.67 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.67 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.67 |
| COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 0.67 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.67 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.67 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.67 |
| COG3694 | ABC-type uncharacterized transport system, permease component | General function prediction only [R] | 0.67 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.67 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.03 % |
| Unclassified | root | N/A | 44.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10320388 | Not Available | 755 | Open in IMG/M |
| 3300002906|JGI25614J43888_10130964 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 659 | Open in IMG/M |
| 3300002914|JGI25617J43924_10163519 | Not Available | 754 | Open in IMG/M |
| 3300002917|JGI25616J43925_10025750 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300003219|JGI26341J46601_10029624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1782 | Open in IMG/M |
| 3300003368|JGI26340J50214_10041607 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300005467|Ga0070706_101250266 | Not Available | 681 | Open in IMG/M |
| 3300005467|Ga0070706_101260094 | Not Available | 679 | Open in IMG/M |
| 3300005467|Ga0070706_101280600 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005468|Ga0070707_100021771 | All Organisms → cellular organisms → Bacteria | 6060 | Open in IMG/M |
| 3300005712|Ga0070764_10422664 | Not Available | 790 | Open in IMG/M |
| 3300005712|Ga0070764_11086122 | Not Available | 506 | Open in IMG/M |
| 3300005764|Ga0066903_100853409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1639 | Open in IMG/M |
| 3300005764|Ga0066903_101407899 | Not Available | 1310 | Open in IMG/M |
| 3300005764|Ga0066903_101946024 | Not Available | 1127 | Open in IMG/M |
| 3300005764|Ga0066903_102687392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300005764|Ga0066903_105673110 | Not Available | 656 | Open in IMG/M |
| 3300006028|Ga0070717_11835427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 548 | Open in IMG/M |
| 3300006893|Ga0073928_10378457 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300006893|Ga0073928_10450849 | Not Available | 931 | Open in IMG/M |
| 3300010043|Ga0126380_10380802 | Not Available | 1040 | Open in IMG/M |
| 3300010046|Ga0126384_10403020 | Not Available | 1155 | Open in IMG/M |
| 3300010048|Ga0126373_12121831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C8FEB | 624 | Open in IMG/M |
| 3300010358|Ga0126370_10388533 | Not Available | 1142 | Open in IMG/M |
| 3300010359|Ga0126376_10731872 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300010360|Ga0126372_12691927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300010360|Ga0126372_12977183 | Not Available | 525 | Open in IMG/M |
| 3300010366|Ga0126379_12598785 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010376|Ga0126381_103073179 | Not Available | 662 | Open in IMG/M |
| 3300010376|Ga0126381_103076581 | Not Available | 661 | Open in IMG/M |
| 3300010398|Ga0126383_10741421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1062 | Open in IMG/M |
| 3300010398|Ga0126383_12565697 | Not Available | 593 | Open in IMG/M |
| 3300012205|Ga0137362_10690180 | Not Available | 877 | Open in IMG/M |
| 3300012205|Ga0137362_11784475 | Not Available | 502 | Open in IMG/M |
| 3300012361|Ga0137360_10296601 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300012362|Ga0137361_11502330 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012582|Ga0137358_10070418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2348 | Open in IMG/M |
| 3300012582|Ga0137358_11086157 | Not Available | 511 | Open in IMG/M |
| 3300012918|Ga0137396_10732585 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 728 | Open in IMG/M |
| 3300016270|Ga0182036_10590574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300016294|Ga0182041_10300117 | Not Available | 1331 | Open in IMG/M |
| 3300016294|Ga0182041_11661607 | Not Available | 591 | Open in IMG/M |
| 3300016319|Ga0182033_11108573 | Not Available | 707 | Open in IMG/M |
| 3300016341|Ga0182035_10799148 | Not Available | 827 | Open in IMG/M |
| 3300016371|Ga0182034_10828391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 793 | Open in IMG/M |
| 3300016387|Ga0182040_10031487 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
| 3300016404|Ga0182037_10026845 | All Organisms → cellular organisms → Bacteria | 3612 | Open in IMG/M |
| 3300016404|Ga0182037_10402214 | Not Available | 1128 | Open in IMG/M |
| 3300016404|Ga0182037_12173904 | Not Available | 500 | Open in IMG/M |
| 3300016422|Ga0182039_10708230 | Not Available | 888 | Open in IMG/M |
| 3300016445|Ga0182038_10795164 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 829 | Open in IMG/M |
| 3300020199|Ga0179592_10066538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1647 | Open in IMG/M |
| 3300020582|Ga0210395_10155921 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff | 1705 | Open in IMG/M |
| 3300020582|Ga0210395_10596106 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300020583|Ga0210401_10028997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 5276 | Open in IMG/M |
| 3300021046|Ga0215015_10299384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 6227 | Open in IMG/M |
| 3300021046|Ga0215015_10309607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1258 | Open in IMG/M |
| 3300021181|Ga0210388_10008092 | All Organisms → cellular organisms → Bacteria | 8317 | Open in IMG/M |
| 3300021362|Ga0213882_10052507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Kuenenia → Candidatus Kuenenia stuttgartiensis | 1613 | Open in IMG/M |
| 3300021372|Ga0213877_10006382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2849 | Open in IMG/M |
| 3300021372|Ga0213877_10070371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1031 | Open in IMG/M |
| 3300021402|Ga0210385_10043557 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2968 | Open in IMG/M |
| 3300021402|Ga0210385_10190138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1489 | Open in IMG/M |
| 3300021402|Ga0210385_10679385 | Not Available | 787 | Open in IMG/M |
| 3300021403|Ga0210397_10046714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2762 | Open in IMG/M |
| 3300021403|Ga0210397_10158942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1585 | Open in IMG/M |
| 3300021403|Ga0210397_10252633 | Not Available | 1280 | Open in IMG/M |
| 3300021403|Ga0210397_10322066 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300021403|Ga0210397_10967102 | Not Available | 660 | Open in IMG/M |
| 3300021403|Ga0210397_11093357 | Not Available | 619 | Open in IMG/M |
| 3300021405|Ga0210387_10262700 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300021405|Ga0210387_10418885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300021405|Ga0210387_10671130 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300021405|Ga0210387_10713534 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021406|Ga0210386_10032797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 4083 | Open in IMG/M |
| 3300021406|Ga0210386_10124956 | Not Available | 2131 | Open in IMG/M |
| 3300021406|Ga0210386_10135657 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300021406|Ga0210386_10236833 | Not Available | 1554 | Open in IMG/M |
| 3300021406|Ga0210386_10381035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300021406|Ga0210386_11635649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300021407|Ga0210383_10674092 | Not Available | 889 | Open in IMG/M |
| 3300021432|Ga0210384_11774018 | Not Available | 523 | Open in IMG/M |
| 3300021433|Ga0210391_10176469 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae | 1682 | Open in IMG/M |
| 3300021441|Ga0213871_10002816 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
| 3300021474|Ga0210390_10009390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 8021 | Open in IMG/M |
| 3300021474|Ga0210390_11123830 | Not Available | 637 | Open in IMG/M |
| 3300021478|Ga0210402_11822755 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021479|Ga0210410_10210343 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300021559|Ga0210409_11087926 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 674 | Open in IMG/M |
| 3300021560|Ga0126371_12138909 | Not Available | 675 | Open in IMG/M |
| 3300024288|Ga0179589_10294516 | Not Available | 729 | Open in IMG/M |
| 3300025918|Ga0207662_11173602 | Not Available | 546 | Open in IMG/M |
| 3300025922|Ga0207646_10817593 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 829 | Open in IMG/M |
| 3300025929|Ga0207664_10699189 | Not Available | 912 | Open in IMG/M |
| 3300026322|Ga0209687_1059027 | Not Available | 1245 | Open in IMG/M |
| 3300026356|Ga0257150_1005722 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1652 | Open in IMG/M |
| 3300026359|Ga0257163_1008417 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300026498|Ga0257156_1062503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300026508|Ga0257161_1032475 | Not Available | 1028 | Open in IMG/M |
| 3300026514|Ga0257168_1057918 | Not Available | 852 | Open in IMG/M |
| 3300026557|Ga0179587_10002320 | All Organisms → cellular organisms → Bacteria | 9002 | Open in IMG/M |
| 3300026557|Ga0179587_10084872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1890 | Open in IMG/M |
| 3300027050|Ga0209325_1007220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1202 | Open in IMG/M |
| 3300028047|Ga0209526_10040698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3269 | Open in IMG/M |
| 3300028047|Ga0209526_10242368 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1236 | Open in IMG/M |
| 3300028047|Ga0209526_10356429 | Not Available | 979 | Open in IMG/M |
| 3300031573|Ga0310915_10032844 | All Organisms → cellular organisms → Bacteria | 3255 | Open in IMG/M |
| 3300031719|Ga0306917_10866901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 707 | Open in IMG/M |
| 3300031754|Ga0307475_10095633 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2311 | Open in IMG/M |
| 3300031754|Ga0307475_11534457 | Not Available | 510 | Open in IMG/M |
| 3300031823|Ga0307478_10895405 | Not Available | 743 | Open in IMG/M |
| 3300031833|Ga0310917_10705259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 683 | Open in IMG/M |
| 3300031833|Ga0310917_11063506 | Not Available | 541 | Open in IMG/M |
| 3300031879|Ga0306919_10179452 | Not Available | 1563 | Open in IMG/M |
| 3300031879|Ga0306919_10434862 | Not Available | 1009 | Open in IMG/M |
| 3300031890|Ga0306925_10410594 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300031890|Ga0306925_11124208 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031890|Ga0306925_12034789 | Not Available | 540 | Open in IMG/M |
| 3300031910|Ga0306923_10430385 | Not Available | 1499 | Open in IMG/M |
| 3300031910|Ga0306923_11470484 | Not Available | 714 | Open in IMG/M |
| 3300031912|Ga0306921_10758930 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300031912|Ga0306921_11369694 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031941|Ga0310912_10088282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2264 | Open in IMG/M |
| 3300031941|Ga0310912_10796092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300031941|Ga0310912_11088016 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031942|Ga0310916_10565564 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031942|Ga0310916_11529923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300031945|Ga0310913_10026822 | Not Available | 3638 | Open in IMG/M |
| 3300031945|Ga0310913_10501687 | Not Available | 862 | Open in IMG/M |
| 3300031945|Ga0310913_10584709 | Not Available | 792 | Open in IMG/M |
| 3300031945|Ga0310913_10611318 | Not Available | 773 | Open in IMG/M |
| 3300031947|Ga0310909_10364474 | Not Available | 1213 | Open in IMG/M |
| 3300031947|Ga0310909_10367454 | Not Available | 1208 | Open in IMG/M |
| 3300031947|Ga0310909_10466689 | Not Available | 1059 | Open in IMG/M |
| 3300031947|Ga0310909_11421688 | Not Available | 554 | Open in IMG/M |
| 3300031954|Ga0306926_10383868 | Not Available | 1735 | Open in IMG/M |
| 3300031954|Ga0306926_10644652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1290 | Open in IMG/M |
| 3300031954|Ga0306926_11452624 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031954|Ga0306926_11495707 | Not Available | 779 | Open in IMG/M |
| 3300031954|Ga0306926_11629036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300032001|Ga0306922_10601122 | Not Available | 1165 | Open in IMG/M |
| 3300032035|Ga0310911_10656313 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300032059|Ga0318533_10265273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
| 3300032059|Ga0318533_10872682 | Not Available | 660 | Open in IMG/M |
| 3300032160|Ga0311301_11770824 | Not Available | 738 | Open in IMG/M |
| 3300032180|Ga0307471_100579695 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1279 | Open in IMG/M |
| 3300032180|Ga0307471_104268516 | Not Available | 505 | Open in IMG/M |
| 3300033289|Ga0310914_10092396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis | 2588 | Open in IMG/M |
| 3300033289|Ga0310914_11217705 | Not Available | 655 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.01% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.34% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.34% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.34% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.34% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_103203881 | 3300001661 | Forest Soil | MARQLRAGSDMRHPSANPARTALHAAHFERNDVTTICETAH* |
| JGI25614J43888_101309641 | 3300002906 | Grasslands Soil | RRLRIDLDMRPPXASPARTALPAAHFERNAVTIICETVH* |
| JGI25617J43924_101635192 | 3300002914 | Grasslands Soil | GCVARRLQIDSDMRPPSASPARTALPAAYFERNDVTIICETVH* |
| JGI25616J43925_100257501 | 3300002917 | Grasslands Soil | VARRLRIDSDMRPPRALPAVHFERNDVIIICETVHYPSAA* |
| JGI26341J46601_100296241 | 3300003219 | Bog Forest Soil | KWAGGCVARRLRIDSDMRPPRALPAAHFERNDITIICETVH* |
| JGI26340J50214_100416071 | 3300003368 | Bog Forest Soil | VALKRAGGCVARRLRIDLDMRPPHALPTAHFERNDIAIICETVHES* |
| Ga0070706_1012502661 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGCVARRLRIDLDMRPPRALPAAHFERNDVIIICETVH* |
| Ga0070706_1012600941 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GGCVARRLRIDSDMRPPSASPARTALPTAHFEHNDVTIICETVH* |
| Ga0070706_1012806002 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGGVARRLRIDSDMRPPRALPAAHFERNHMSDTYETMH* |
| Ga0070707_1000217712 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LNLAAIRRLPDRLRIDSAMRPPSANPARTALPAAHFERNVVTIICKTVH* |
| Ga0070764_104226641 | 3300005712 | Soil | VALKRAGGCVARRLLIDSDMRPPRALPSAHFQRNHMPATYETMH* |
| Ga0070764_110861221 | 3300005712 | Soil | VARRLRIDSDMRPPRALPTAHFERNHMPATYETVH* |
| Ga0066903_1008534095 | 3300005764 | Tropical Forest Soil | AGGRVARRLRIDLDMRPPRALPAAHFERNDITTICETVH* |
| Ga0066903_1014078991 | 3300005764 | Tropical Forest Soil | GGRVARRLRIDLDMRPPRALPAAHFERNDITTICETVH* |
| Ga0066903_1019460241 | 3300005764 | Tropical Forest Soil | VARRLRIHSDMRPPRALPAVHFERNDVIIICETVH* |
| Ga0066903_1026873922 | 3300005764 | Tropical Forest Soil | AGGCVARRLRIDLDMRPPRALPTAHFERNDVTIICETVH* |
| Ga0066903_1056731101 | 3300005764 | Tropical Forest Soil | AAAQRVALKRAGGYVARRLRIDLDMRPPRALPAAHFERNDITTICETVH* |
| Ga0070717_118354271 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRIDLDMRPPRALPAAHFERNDITTICETVHLAFRYSQTPF* |
| Ga0073928_103784571 | 3300006893 | Iron-Sulfur Acid Spring | KWAGGRVARRLRIDSDMRPPRALPAAHFERNDVTIICETVH* |
| Ga0073928_104508491 | 3300006893 | Iron-Sulfur Acid Spring | AGGRVARRLRINLDMRPPRALPTAHFERNDTTIICETVH* |
| Ga0126380_103808022 | 3300010043 | Tropical Forest Soil | AGDRVARRLRIDLDMRPPRALSAAHFECNDITITCETVH* |
| Ga0126384_104030202 | 3300010046 | Tropical Forest Soil | CVARRLRIDLDMRPPRALPTAHFERNDVTIICETVHQFKQKDRKNDVCS* |
| Ga0126373_121218311 | 3300010048 | Tropical Forest Soil | CVARRLHIDLDMRPPRALPTAHFEPNDVIIICETVH* |
| Ga0126370_103885331 | 3300010358 | Tropical Forest Soil | DRVARRLRIDLDMRPPRALSAAHFECNDITITCETVH* |
| Ga0126376_107318723 | 3300010359 | Tropical Forest Soil | ARRLHIDLDMRPPRALPAAHFERNDVIIICETAH* |
| Ga0126372_126919272 | 3300010360 | Tropical Forest Soil | GRVARRLRIDLDMRPPRALPAAHFERNDVIIICETVH* |
| Ga0126372_129771831 | 3300010360 | Tropical Forest Soil | KWAGGRVARRLRIDLDMRPPRALPAAHLERNDVIITRETVH* |
| Ga0126379_125987852 | 3300010366 | Tropical Forest Soil | GGCVARRLRIDSDMRPPRALPAAHFERNVVIIICETAH* |
| Ga0126381_1030731791 | 3300010376 | Tropical Forest Soil | VARRLHVDLDMRPPRALPAAHFERNDVTIICETVH* |
| Ga0126381_1030765811 | 3300010376 | Tropical Forest Soil | ARRLRIDLDMRPPRALPAAHFERNDITTICETVH* |
| Ga0126383_107414211 | 3300010398 | Tropical Forest Soil | VARRLRIDLDMRPPRALPAAHFERNDITIICETMH* |
| Ga0126383_125656971 | 3300010398 | Tropical Forest Soil | WAGGHVARRLRINLDMRPPRALPAAHFERNDVIIICETVH* |
| Ga0137362_106901801 | 3300012205 | Vadose Zone Soil | VARRLQIDSDMRPPPALPAAHFERNDVTIICETVH* |
| Ga0137362_117844752 | 3300012205 | Vadose Zone Soil | AGGCVARRLRIALDMRPPRASPAAHFQRNDVTIIRETVH* |
| Ga0137360_102966011 | 3300012361 | Vadose Zone Soil | MRLPSASPARTALPAARFERNDITIICETVDLRGRAS |
| Ga0137361_115023301 | 3300012362 | Vadose Zone Soil | VARRLRINLDMRPPRALPTAHFERNDVIIICETVH* |
| Ga0137358_100704181 | 3300012582 | Vadose Zone Soil | WAGGGVARRLRIDSDMRPPRALPAVHFERNDVIIICETVH* |
| Ga0137358_110861572 | 3300012582 | Vadose Zone Soil | KWAGGCVARRLRIDLDMRPPRALPAAHFERNDVTIICETVH* |
| Ga0137396_107325852 | 3300012918 | Vadose Zone Soil | VARRLRIDSDIRPPSASRAWTALPAAHFERNDVTIICETVH* |
| Ga0182036_105905742 | 3300016270 | Soil | VARRLRIDLDMRPPRALPAAHFERNDITTICETVH |
| Ga0182041_103001172 | 3300016294 | Soil | GRVARRLRIDLDMRPPRALPAAHFERNDVIIICETVH |
| Ga0182041_116616072 | 3300016294 | Soil | LRIDLDMRPLSASPARTALPTAHFERNDVIIIYETVH |
| Ga0182033_111085731 | 3300016319 | Soil | GGCVARRLRIDLDMRPLTASPARTALPAAHFERNDVTIIRDTVHY |
| Ga0182035_107991481 | 3300016341 | Soil | GGCVARRLRIDLDMRPLSASPARTALPAAHFERNDVIIICETVH |
| Ga0182034_108283911 | 3300016371 | Soil | PPTASPARTALPAAHFERNDIITICETAHYNIQDRG |
| Ga0182040_100314876 | 3300016387 | Soil | RLRIDLDIRPPTASPARTALPAAHFERNDVIIIYETVH |
| Ga0182037_100268455 | 3300016404 | Soil | CVARRLRINLDMRPPRALPAAHFERNDVIIICETVH |
| Ga0182037_104022142 | 3300016404 | Soil | IDLDMRPPTASPARTALPTAHFERNDVIIICETVH |
| Ga0182037_121739041 | 3300016404 | Soil | MRPLTVSPARTAWPPAHFERNDVIIIYETGHQERNP |
| Ga0182039_107082301 | 3300016422 | Soil | VARRLRIDLDMRPPRALPAAHFECNDVIIICETVH |
| Ga0182038_107951643 | 3300016445 | Soil | CVARRLRIDLDMRPPRALSAAHFERNDVTIICETVH |
| Ga0179592_100665381 | 3300020199 | Vadose Zone Soil | KWAGGCVARRLRIDLDMRPPNASPARTALPAAHFERNDATIICEMVH |
| Ga0210395_101559213 | 3300020582 | Soil | AGGCVARRLLIDSDMRPPRALPTAHFEPNHMPATYETMH |
| Ga0210395_105961062 | 3300020582 | Soil | CVARRLRIDSDMRPPRALPTAHFQRNHIPATYETMH |
| Ga0210401_100289971 | 3300020583 | Soil | RVARRLRIDLDMRPPRALPAAHFERNDITIICETVH |
| Ga0215015_102993841 | 3300021046 | Soil | KWAGGCVARRLRIDSDMRPPNASPARTALPTAHFERNDVTIICETVH |
| Ga0215015_103096073 | 3300021046 | Soil | LRIDSDMRPPTASPARTALPTAHFERNDVTIIRERVH |
| Ga0210388_100080929 | 3300021181 | Soil | GRVARRLRIDSDMRLSRALPTAHFERNDVTIICETVH |
| Ga0213882_100525071 | 3300021362 | Exposed Rock | WAGGGVARRSRIDSDMLPPRALPTAHFDRNNIPLI |
| Ga0213877_100063821 | 3300021372 | Bulk Soil | GGCVARRLRIDLDMRPPRALPTAHFDRNDVAIICETVH |
| Ga0213877_100703713 | 3300021372 | Bulk Soil | WAGGCVARRLRIDLDMRPPRALPTAHFERNDVTIICETVH |
| Ga0210385_100435575 | 3300021402 | Soil | GGCVARRLLIDSDMRPPRALPTAHFQRNHMPATYETMH |
| Ga0210385_101901381 | 3300021402 | Soil | GGCVARRLLIDSDMRPPRALPTAHFERNHMPATYETMH |
| Ga0210385_106793853 | 3300021402 | Soil | WAGGCVARRLLIDSDMRPPRALPTAHFERNHMPATYETMH |
| Ga0210397_100467145 | 3300021403 | Soil | KWAGGCVARRLLIDSDMRPPRALPTAHFERNHMPATYETVH |
| Ga0210397_101589421 | 3300021403 | Soil | AGGCVARRLRIDSDMRPARALPAAHFERNHMSATYETMH |
| Ga0210397_102526331 | 3300021403 | Soil | KWAGGCVARRLRIDSDMRPPRALPTAHFERNHMSATYETMH |
| Ga0210397_103220661 | 3300021403 | Soil | WAGGRVARRLRIDSDMRPPRALPTAHFERNDVTIIYETVH |
| Ga0210397_109671021 | 3300021403 | Soil | KWAGGCVARRLLIDSDMRPPRALPTTHFERNHMPATYETMH |
| Ga0210397_110933571 | 3300021403 | Soil | LVARRLRIDSDMRPSRALPTAHFERNDVTIICETVH |
| Ga0210387_102627001 | 3300021405 | Soil | MRPRTASPARTALPAAHFERNDVTIICETVHKLTTP |
| Ga0210387_104188851 | 3300021405 | Soil | KRAGGCVARRLRIDSGMRPPRALPTAHFEPNHMPATYETMH |
| Ga0210387_106711301 | 3300021405 | Soil | KWACGRVARRLRIDSDMRPPRALPTAHFERNDVTIIYETVH |
| Ga0210387_107135342 | 3300021405 | Soil | KWAGGCVARRLRIDSDMRPPRALPSAHFERNHMPATYETMH |
| Ga0210386_100327971 | 3300021406 | Soil | QLPGARRVALKWAGGCVARRLRIDSDMRPPRALPSAHFERNHMPAKYETMH |
| Ga0210386_101249561 | 3300021406 | Soil | GRVARRLRIDSDMRPSRALPTAHFERNDVTIICETVH |
| Ga0210386_101356571 | 3300021406 | Soil | GCVARRLLIDSDMRPPRALPTAHFEPNHMPATYETMH |
| Ga0210386_102368333 | 3300021406 | Soil | GGCVARRLRIDSDMRPPRALPTVHFERNHMPATYETMH |
| Ga0210386_103810353 | 3300021406 | Soil | KWAGGCVARRLLIDSDMRPPRALPTAHFERNHMPATYETMH |
| Ga0210386_116356492 | 3300021406 | Soil | IRRLRIDSDMHPLTASPARTALPAAHFERNDVIIIPEKAH |
| Ga0210383_106740921 | 3300021407 | Soil | KWAGGRVARRLRIDSDMRPSRALPTAHFERNDVTIICETVH |
| Ga0210384_117740181 | 3300021432 | Soil | WAGGRVARRLRINLDMRPPRALPTAHFERNDVIIICETVH |
| Ga0210391_101764691 | 3300021433 | Soil | KWAGGRVARRLRIDLDMRPPRALPAAHFERNDITIICETVH |
| Ga0213871_100028161 | 3300021441 | Rhizosphere | VARRLRIDLDMRPPTASPARTALPTAHFERNDVTIICETVH |
| Ga0210390_100093901 | 3300021474 | Soil | KWAGGRVARRLRIDSDMRPPRALPTAHFERNDVTIICETVH |
| Ga0210390_111238302 | 3300021474 | Soil | AGGCVARRLLIDSDMRPPRALPSAHFERNHMPATYETMH |
| Ga0210402_118227551 | 3300021478 | Soil | GGRVARRLRIDLDMRPPRALPAAHFERNEITIICETVH |
| Ga0210410_102103431 | 3300021479 | Soil | WAGGRVARRLRIDSDMRPSRALPTAHFERNDVTIICETVH |
| Ga0210409_110879261 | 3300021559 | Soil | KWAGGCVARRLRIDLDMRPPRALPAAHFERNDITIICETVH |
| Ga0126371_121389091 | 3300021560 | Tropical Forest Soil | VARRLRINLDMRPPRALPAAHFERNDVITICETVH |
| Ga0179589_102945162 | 3300024288 | Vadose Zone Soil | ARRLQIDSDMRPPNASPARTALPAAHFERNDVTIICETVH |
| Ga0207662_111736021 | 3300025918 | Switchgrass Rhizosphere | AGGCVARRLRIDLDMRPLSASPARTALPAAHFERNDIIILCETAH |
| Ga0207646_108175933 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KWAGGCVARRLRIDLDMRPPNASPARTALPAAHFERNDVSIICETVH |
| Ga0207664_106991892 | 3300025929 | Agricultural Soil | VARRLQIDSDMRSPHALPAAHFERNDAIIICDTVH |
| Ga0209687_10590271 | 3300026322 | Soil | VARRLQIHSDMRPPRALPTAHFERNDGTIICETVH |
| Ga0257150_10057221 | 3300026356 | Soil | RIDLDMRPPNASPARTALPAAHFERNDATIICEMVH |
| Ga0257163_10084171 | 3300026359 | Soil | VARRLQIDSDMRPPNASPARTALPAAHFERNDVTIICETVH |
| Ga0257156_10625031 | 3300026498 | Soil | CVARRLQIDSDMRPPNASPARTALPAAHFERNDLTIICETAH |
| Ga0257161_10324751 | 3300026508 | Soil | ARRLQIDSDMRPPNASPARTALPAAHFERNDVTMICETVH |
| Ga0257168_10579183 | 3300026514 | Soil | VRRPPDRLRINLDMRPLNAGPARTALPAAHFERNDITIICETVH |
| Ga0179587_100023201 | 3300026557 | Vadose Zone Soil | GVARRLRIDSDMRPPRALPAVHFERNDVIIICETVH |
| Ga0179587_100848722 | 3300026557 | Vadose Zone Soil | GCVARRLQIDSDMRPPNASPARTALPAAHFERNDLTIICETAH |
| Ga0209325_10072202 | 3300027050 | Forest Soil | GRVARRLRINLDMRPSRALPAAHFERNDVIIIGETVH |
| Ga0209526_100406984 | 3300028047 | Forest Soil | WAGGCVARRLRIDSDMRPPSASPARTALPAAYFERNHMPATHETMHQVQLLHAE |
| Ga0209526_102423681 | 3300028047 | Forest Soil | AGGRVARRLRINLDMRPPRALPTAHFERNDLIIICETVH |
| Ga0209526_103564291 | 3300028047 | Forest Soil | MGRRRVARRLRINLDMRPPRALPTAHFERNDVIIIC |
| Ga0310915_100328441 | 3300031573 | Soil | GIDLDMRPLTASPARTALLAAHFERNDVVIKCETAH |
| Ga0306917_108669011 | 3300031719 | Soil | KWAGGCVARRLGIDLDMRPLTASPARTALLAAHFERNDVVIKCETAH |
| Ga0307475_100956331 | 3300031754 | Hardwood Forest Soil | EGCVEKWAGGCVARRLRIDLDMRPPRALSTAHFERNDVIIICETVHWNP |
| Ga0307475_115344571 | 3300031754 | Hardwood Forest Soil | GGVARRLRIDSDMRPPRALPAVHFERNDVIIICETVHYTSPA |
| Ga0307478_108954052 | 3300031823 | Hardwood Forest Soil | RVARRLRINLDMRPLTAGPARTALPAAHFERNDVIIICETVH |
| Ga0310917_107052592 | 3300031833 | Soil | GLRLKWAGDRVARRLRIDLDLRPPRALSAAHFERNDITIICETVH |
| Ga0310917_110635061 | 3300031833 | Soil | VARWLHIDLDMRPPTASPARTALPTAHFERNDVIIICETVH |
| Ga0306919_101794521 | 3300031879 | Soil | KWAGDCVARRLHIDLDMRPPHALPTAHFERNDVIIICETVH |
| Ga0306919_104348621 | 3300031879 | Soil | CVARRLHIDLDMRPLTASPARTALPAAHFERNDVIIICETVH |
| Ga0306925_104105941 | 3300031890 | Soil | WAGGCVARRLRIDLDMRPPRALPAAHFERNDVTTICETVH |
| Ga0306925_111242082 | 3300031890 | Soil | AGGCVARRLRIDLDMRPLTASPARTALPAAHFERNDVIIICETVH |
| Ga0306925_120347892 | 3300031890 | Soil | AGGCVARRLRIDLDMRPPRVLPAAHFERNDITTICETVR |
| Ga0306923_104303851 | 3300031910 | Soil | LPDRLHIDLDMRPPTASPARTALPTAHFERNDVIIICETVH |
| Ga0306923_114704842 | 3300031910 | Soil | VTRRLHIDLDMRPPRTLPTAHFERNDVIIICETVHQGERDFAPS |
| Ga0306921_107589303 | 3300031912 | Soil | KWAGDCVARRLRIDLDMRPPRALSAAHFERNDITIICETVH |
| Ga0306921_113696941 | 3300031912 | Soil | GGCVARRLRIDLDMRPPRALLTAHFERNDVIIIYETVH |
| Ga0310912_100882825 | 3300031941 | Soil | GCVPRRLRIDLDMRPPRALPAAHFERNDVIIICETVH |
| Ga0310912_107960922 | 3300031941 | Soil | AGGCVARRLRIDLDMRPPRALPAAHFERNDAIIICETMH |
| Ga0310912_110880161 | 3300031941 | Soil | CVARRLHIDLDMRPPRALPAAHFERNDVIIICETVH |
| Ga0310916_105655641 | 3300031942 | Soil | RRPSDRLRIDLDMRPLTASPARTALPAAHFERNDVIIICETVH |
| Ga0310916_115299232 | 3300031942 | Soil | GGCVARRLRIDQDMRPPRALPAAHFERNDIIIICETVH |
| Ga0310913_100268221 | 3300031945 | Soil | GYVARRLRIDLDMRPPRALPAAHFERNDVPTICETVH |
| Ga0310913_105016871 | 3300031945 | Soil | GCVARRLRIDLDMRPLTASPARTALPAAHFERNDVIIICETVH |
| Ga0310913_105847091 | 3300031945 | Soil | SWLIFHVAHSLRIDLDMRPPRALPAAHFECNDVIIICETVH |
| Ga0310913_106113182 | 3300031945 | Soil | GGCVARRLRIDLDMRPPRALPTAHFERNDVIIIYETVH |
| Ga0310909_103644741 | 3300031947 | Soil | WAGGCVARRLRIDLDMRPPRALPAAHFECNDVIIICETVH |
| Ga0310909_103674541 | 3300031947 | Soil | VARRLRIDSDMRPPRALPAAHFERNGVIIICETAH |
| Ga0310909_104666894 | 3300031947 | Soil | AGGCVARRLRIALDMRPLTASPARTALPAAHFERNDVIIICETVH |
| Ga0310909_114216881 | 3300031947 | Soil | KWAGGCVARRLRIDLDMRPPRALPAAHFERNDVVIICETVH |
| Ga0306926_103838681 | 3300031954 | Soil | KWVGGCVARRLRIALDMRPPRALPAAHFEPNDVIIICETVH |
| Ga0306926_106446521 | 3300031954 | Soil | VARRLRIDLDMRPPRALPAAHFERNDIIIICETVH |
| Ga0306926_114526242 | 3300031954 | Soil | GGCVARRLRIDLDMRPPRALPAAHFERNDITIICETVH |
| Ga0306926_114957071 | 3300031954 | Soil | KWAGGFVARRLRIALDMCPPRALPAAHFERNDVIIICETVH |
| Ga0306926_116290362 | 3300031954 | Soil | AGDCVARRLRIDLDMRPPRALSAAHFERNDITIICETVH |
| Ga0306922_106011221 | 3300032001 | Soil | KWAGGCVPRRLRIDLDMRPPRALPAAHFERNDVIIICETVH |
| Ga0310911_106563131 | 3300032035 | Soil | CVARRLRIDLDMRPLTASPARTALPVAHFDRNDVIIICETVHQIA |
| Ga0318533_102652731 | 3300032059 | Soil | AGGCVARRLRIDLDMRSPRALPAAHFECNDVIIICETVH |
| Ga0318533_108726821 | 3300032059 | Soil | VAGGFVTRRLRIDLDMRPPRALPAAHFERNDVIIICETVH |
| Ga0311301_117708242 | 3300032160 | Peatlands Soil | WAGGRVARRLHIDSDMRPPRALPTAHFERNDVTIICETVH |
| Ga0307471_1005796953 | 3300032180 | Hardwood Forest Soil | GGCVARRLRIDLDMRHPRALSTAHFERNDVIIICETVHWNP |
| Ga0307471_1042685161 | 3300032180 | Hardwood Forest Soil | NWAGGWVARGLRIALDMRPPPALPTAHFERNDVTTICETAHQRNL |
| Ga0310914_100923961 | 3300033289 | Soil | GCVARRLHIDLDMRPPIASPARTALPAAHFERNDVIIICETLH |
| Ga0310914_112177051 | 3300033289 | Soil | IDLDMRPLTASPARTALPAAHFERNDVIIICETVH |
| ⦗Top⦘ |