


| Basic Information | |
|---|---|
| Family ID | F047344 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRKVDETKQPDLWTWIVIGVVFSAVTAALYGPFVWEHWVV |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (35.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (76.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13676 | TIR_2 | 4.00 |
| PF02518 | HATPase_c | 3.33 |
| PF04392 | ABC_sub_bind | 2.67 |
| PF01734 | Patatin | 2.67 |
| PF00293 | NUDIX | 2.00 |
| PF12802 | MarR_2 | 2.00 |
| PF12833 | HTH_18 | 1.33 |
| PF14559 | TPR_19 | 1.33 |
| PF00132 | Hexapep | 1.33 |
| PF13185 | GAF_2 | 1.33 |
| PF00106 | adh_short | 0.67 |
| PF01152 | Bac_globin | 0.67 |
| PF13474 | SnoaL_3 | 0.67 |
| PF12680 | SnoaL_2 | 0.67 |
| PF04879 | Molybdop_Fe4S4 | 0.67 |
| PF12796 | Ank_2 | 0.67 |
| PF02371 | Transposase_20 | 0.67 |
| PF00211 | Guanylate_cyc | 0.67 |
| PF00589 | Phage_integrase | 0.67 |
| PF01695 | IstB_IS21 | 0.67 |
| PF00239 | Resolvase | 0.67 |
| PF13546 | DDE_5 | 0.67 |
| PF13683 | rve_3 | 0.67 |
| PF02543 | Carbam_trans_N | 0.67 |
| PF00069 | Pkinase | 0.67 |
| PF04955 | HupE_UreJ | 0.67 |
| PF08241 | Methyltransf_11 | 0.67 |
| PF12395 | DUF3658 | 0.67 |
| PF00376 | MerR | 0.67 |
| PF00083 | Sugar_tr | 0.67 |
| PF00723 | Glyco_hydro_15 | 0.67 |
| PF01797 | Y1_Tnp | 0.67 |
| PF01841 | Transglut_core | 0.67 |
| PF01464 | SLT | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.67 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 2.67 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.67 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 2.67 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 2.67 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.67 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.67 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.67 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.67 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.67 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.67 |
| COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 0.67 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.33 % |
| Unclassified | root | N/A | 42.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12844208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1412 | Open in IMG/M |
| 3300000789|JGI1027J11758_12857684 | Not Available | 934 | Open in IMG/M |
| 3300004633|Ga0066395_10047118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13 | 1890 | Open in IMG/M |
| 3300004633|Ga0066395_10223854 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300004633|Ga0066395_10780576 | Not Available | 572 | Open in IMG/M |
| 3300005332|Ga0066388_100343723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2138 | Open in IMG/M |
| 3300005332|Ga0066388_100416068 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300005332|Ga0066388_100651016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1668 | Open in IMG/M |
| 3300005332|Ga0066388_100771609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
| 3300005332|Ga0066388_101954296 | Not Available | 1049 | Open in IMG/M |
| 3300005332|Ga0066388_106524131 | Not Available | 588 | Open in IMG/M |
| 3300005332|Ga0066388_106855952 | Not Available | 573 | Open in IMG/M |
| 3300005332|Ga0066388_107019412 | Not Available | 567 | Open in IMG/M |
| 3300005434|Ga0070709_11125286 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005439|Ga0070711_100326639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1227 | Open in IMG/M |
| 3300005441|Ga0070700_100019754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3892 | Open in IMG/M |
| 3300005536|Ga0070697_100311183 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300005713|Ga0066905_100047326 | Not Available | 2604 | Open in IMG/M |
| 3300005713|Ga0066905_100055867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium sangaii | 2448 | Open in IMG/M |
| 3300005713|Ga0066905_100169238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1598 | Open in IMG/M |
| 3300005713|Ga0066905_100213455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
| 3300005713|Ga0066905_100241834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
| 3300005713|Ga0066905_100288166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1282 | Open in IMG/M |
| 3300005713|Ga0066905_100425357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
| 3300005713|Ga0066905_100428034 | Not Available | 1082 | Open in IMG/M |
| 3300005713|Ga0066905_100447857 | Not Available | 1061 | Open in IMG/M |
| 3300005713|Ga0066905_100526531 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300005713|Ga0066905_100631988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 910 | Open in IMG/M |
| 3300005713|Ga0066905_101008963 | Not Available | 734 | Open in IMG/M |
| 3300005713|Ga0066905_101086184 | Not Available | 710 | Open in IMG/M |
| 3300005764|Ga0066903_100232063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2816 | Open in IMG/M |
| 3300005764|Ga0066903_100375707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2319 | Open in IMG/M |
| 3300005764|Ga0066903_100503059 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300005764|Ga0066903_100510536 | Not Available | 2041 | Open in IMG/M |
| 3300005764|Ga0066903_100635590 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300005764|Ga0066903_101431027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1300 | Open in IMG/M |
| 3300005764|Ga0066903_103335206 | Not Available | 867 | Open in IMG/M |
| 3300005764|Ga0066903_103431123 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005764|Ga0066903_103852992 | Not Available | 806 | Open in IMG/M |
| 3300005764|Ga0066903_104984720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 704 | Open in IMG/M |
| 3300005764|Ga0066903_105718553 | Not Available | 654 | Open in IMG/M |
| 3300005764|Ga0066903_107439874 | Not Available | 565 | Open in IMG/M |
| 3300005937|Ga0081455_10000053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 122071 | Open in IMG/M |
| 3300005937|Ga0081455_10175440 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300005983|Ga0081540_1001740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18326 | Open in IMG/M |
| 3300005983|Ga0081540_1101738 | Not Available | 1236 | Open in IMG/M |
| 3300006058|Ga0075432_10154866 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300006163|Ga0070715_10063827 | Not Available | 1625 | Open in IMG/M |
| 3300006173|Ga0070716_100441020 | Not Available | 947 | Open in IMG/M |
| 3300006173|Ga0070716_100651522 | Not Available | 799 | Open in IMG/M |
| 3300006755|Ga0079222_10824355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 762 | Open in IMG/M |
| 3300006755|Ga0079222_11886202 | Not Available | 582 | Open in IMG/M |
| 3300006755|Ga0079222_12379322 | Not Available | 530 | Open in IMG/M |
| 3300006854|Ga0075425_100011773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9369 | Open in IMG/M |
| 3300006871|Ga0075434_100030908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5278 | Open in IMG/M |
| 3300010043|Ga0126380_10063224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2063 | Open in IMG/M |
| 3300010043|Ga0126380_10391393 | Not Available | 1029 | Open in IMG/M |
| 3300010043|Ga0126380_10705554 | Not Available | 812 | Open in IMG/M |
| 3300010043|Ga0126380_11011489 | Not Available | 701 | Open in IMG/M |
| 3300010043|Ga0126380_11726466 | Not Available | 563 | Open in IMG/M |
| 3300010046|Ga0126384_10518943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
| 3300010046|Ga0126384_10538165 | Not Available | 1013 | Open in IMG/M |
| 3300010046|Ga0126384_10736031 | Not Available | 877 | Open in IMG/M |
| 3300010047|Ga0126382_10097886 | Not Available | 1886 | Open in IMG/M |
| 3300010047|Ga0126382_10518405 | Not Available | 962 | Open in IMG/M |
| 3300010047|Ga0126382_10746469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300010047|Ga0126382_10981505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
| 3300010047|Ga0126382_10988878 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300010048|Ga0126373_12854619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300010358|Ga0126370_10041146 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
| 3300010358|Ga0126370_10087253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2117 | Open in IMG/M |
| 3300010358|Ga0126370_10502916 | Not Available | 1024 | Open in IMG/M |
| 3300010358|Ga0126370_11104333 | Not Available | 731 | Open in IMG/M |
| 3300010358|Ga0126370_12494594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300010359|Ga0126376_10181073 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300010359|Ga0126376_10602974 | Not Available | 1039 | Open in IMG/M |
| 3300010360|Ga0126372_12156268 | Not Available | 606 | Open in IMG/M |
| 3300010361|Ga0126378_11508608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300010362|Ga0126377_10009901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7380 | Open in IMG/M |
| 3300010362|Ga0126377_10111619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 62 | 2510 | Open in IMG/M |
| 3300010362|Ga0126377_10184036 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300010362|Ga0126377_10434901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1331 | Open in IMG/M |
| 3300010362|Ga0126377_10583542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1160 | Open in IMG/M |
| 3300010362|Ga0126377_12113393 | Not Available | 639 | Open in IMG/M |
| 3300010362|Ga0126377_12929643 | Not Available | 551 | Open in IMG/M |
| 3300010362|Ga0126377_13156128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300010366|Ga0126379_10063916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3102 | Open in IMG/M |
| 3300010366|Ga0126379_10618093 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300010366|Ga0126379_11033154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300010366|Ga0126379_11418038 | Not Available | 800 | Open in IMG/M |
| 3300010366|Ga0126379_12315127 | Not Available | 637 | Open in IMG/M |
| 3300010376|Ga0126381_100368808 | Not Available | 1990 | Open in IMG/M |
| 3300010398|Ga0126383_10102243 | Not Available | 2565 | Open in IMG/M |
| 3300010398|Ga0126383_10179999 | Not Available | 2008 | Open in IMG/M |
| 3300010398|Ga0126383_10606826 | Not Available | 1166 | Open in IMG/M |
| 3300010398|Ga0126383_11440183 | Not Available | 779 | Open in IMG/M |
| 3300010398|Ga0126383_11467101 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010398|Ga0126383_12325108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 622 | Open in IMG/M |
| 3300010400|Ga0134122_10804556 | Not Available | 897 | Open in IMG/M |
| 3300012948|Ga0126375_10093207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1761 | Open in IMG/M |
| 3300012948|Ga0126375_11030193 | Not Available | 672 | Open in IMG/M |
| 3300012948|Ga0126375_11539724 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300012971|Ga0126369_10512776 | Not Available | 1259 | Open in IMG/M |
| 3300012971|Ga0126369_12786403 | Not Available | 572 | Open in IMG/M |
| 3300015371|Ga0132258_10069721 | All Organisms → cellular organisms → Bacteria | 8149 | Open in IMG/M |
| 3300015371|Ga0132258_10078304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7696 | Open in IMG/M |
| 3300015371|Ga0132258_10079075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7663 | Open in IMG/M |
| 3300015371|Ga0132258_10156514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5472 | Open in IMG/M |
| 3300015371|Ga0132258_10311988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3873 | Open in IMG/M |
| 3300015372|Ga0132256_101115672 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300015372|Ga0132256_103548362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 524 | Open in IMG/M |
| 3300015373|Ga0132257_101236493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
| 3300015374|Ga0132255_102313606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300016270|Ga0182036_11073002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 666 | Open in IMG/M |
| 3300016319|Ga0182033_10680654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium → Rhodomicrobium vannielii | 899 | Open in IMG/M |
| 3300016357|Ga0182032_11270026 | Not Available | 635 | Open in IMG/M |
| 3300016445|Ga0182038_10479779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1057 | Open in IMG/M |
| 3300017970|Ga0187783_10866727 | Not Available | 651 | Open in IMG/M |
| 3300020581|Ga0210399_10628318 | Not Available | 887 | Open in IMG/M |
| 3300021178|Ga0210408_10122285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2053 | Open in IMG/M |
| 3300021560|Ga0126371_10200084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2092 | Open in IMG/M |
| 3300021560|Ga0126371_10374803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
| 3300021560|Ga0126371_10871120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300021560|Ga0126371_12104506 | Not Available | 680 | Open in IMG/M |
| 3300021560|Ga0126371_13322077 | Not Available | 544 | Open in IMG/M |
| 3300025972|Ga0207668_10233257 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300027775|Ga0209177_10036270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81 | 1325 | Open in IMG/M |
| 3300027874|Ga0209465_10038137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2280 | Open in IMG/M |
| 3300027874|Ga0209465_10452800 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300027874|Ga0209465_10477287 | Not Available | 623 | Open in IMG/M |
| 3300027907|Ga0207428_10579564 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300031545|Ga0318541_10448758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300031573|Ga0310915_10361377 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031573|Ga0310915_10749060 | Not Available | 688 | Open in IMG/M |
| 3300031719|Ga0306917_11021830 | Not Available | 645 | Open in IMG/M |
| 3300031740|Ga0307468_101573238 | Not Available | 613 | Open in IMG/M |
| 3300031744|Ga0306918_10363739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1124 | Open in IMG/M |
| 3300031782|Ga0318552_10146964 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300031890|Ga0306925_10481215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1324 | Open in IMG/M |
| 3300031890|Ga0306925_11958436 | Not Available | 555 | Open in IMG/M |
| 3300031897|Ga0318520_11013811 | Not Available | 525 | Open in IMG/M |
| 3300031912|Ga0306921_10082148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3713 | Open in IMG/M |
| 3300031912|Ga0306921_11791980 | Not Available | 660 | Open in IMG/M |
| 3300031941|Ga0310912_11156632 | Not Available | 590 | Open in IMG/M |
| 3300031947|Ga0310909_10238316 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300032001|Ga0306922_10709520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300032180|Ga0307471_101553283 | Not Available | 819 | Open in IMG/M |
| 3300032261|Ga0306920_100360809 | Not Available | 2161 | Open in IMG/M |
| 3300034817|Ga0373948_0056001 | Not Available | 857 | Open in IMG/M |
| 3300034819|Ga0373958_0050785 | Not Available | 875 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 35.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 26.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.33% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_128442082 | 3300000789 | Soil | MHKVDESKHADLWTWIVIGLVFSAMTVALYGPFVWEHWVV* |
| JGI1027J11758_128576842 | 3300000789 | Soil | MPKDETKQTDLWTWIVIGLVFSAVTVALYGPFVWEHWAT* |
| Ga0066395_100471182 | 3300004633 | Tropical Forest Soil | MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0066395_102238542 | 3300004633 | Tropical Forest Soil | MRKVDESKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV* |
| Ga0066395_107805762 | 3300004633 | Tropical Forest Soil | MKVGRQMHKVNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA* |
| Ga0066388_1003437234 | 3300005332 | Tropical Forest Soil | MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0066388_1004160682 | 3300005332 | Tropical Forest Soil | MRKVDETKQPDLWTWIVIGIVFSAVTAALYGPFVWEYWVV* |
| Ga0066388_1006510164 | 3300005332 | Tropical Forest Soil | MRKVDESKQPDLWTWVVLGLVFSAVTAALYGPFVWEHWVI* |
| Ga0066388_1007716093 | 3300005332 | Tropical Forest Soil | MRKVDETKQWDLWTWIVIGVVFGAVTAALYGPFVWEHWVV* |
| Ga0066388_1019542962 | 3300005332 | Tropical Forest Soil | MRKVDQSKQPDLLTWIVIGIAFSVVTAALYGPFVWEHWVV* |
| Ga0066388_1065241312 | 3300005332 | Tropical Forest Soil | MRKVDDSKQPDLWTWVVLGLVFSAVTAALYGPFVWEHWAI* |
| Ga0066388_1068559522 | 3300005332 | Tropical Forest Soil | MRMMDEPKQADLWTWIVIGIVFSAVTAALYGPFVWEHWVL* |
| Ga0066388_1070194121 | 3300005332 | Tropical Forest Soil | MRKVDEVKQPDLWTWIVIGIVFGAVTAALYVPFVWEHWAV* |
| Ga0070709_111252861 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMHKVDESKRVDLWTWIVIGLVFSAVTVALYGPFVWEHWVV* |
| Ga0070711_1003266392 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTEIETKQPEADVWTWIVIDLVFSAVTAALYGPFVWEHLVT* |
| Ga0070700_1000197544 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGSTMHTVNDTKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA* |
| Ga0070697_1003111833 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTVNDTKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA* |
| Ga0066905_1000473267 | 3300005713 | Tropical Forest Soil | MHRLDEPKQADLWTWIVLGLVFGAVTAALYGPFVWEHWVV* |
| Ga0066905_1000558676 | 3300005713 | Tropical Forest Soil | MRKVDETKQPDLWTWIVIGIVFSAVAAALYGPFVWEHWVV* |
| Ga0066905_1001692383 | 3300005713 | Tropical Forest Soil | MRKVDEAKQPDLWTWVVIGLVFSAVTAALYGPFVWEHWAI* |
| Ga0066905_1002134552 | 3300005713 | Tropical Forest Soil | MRTVDETKQPEADLWTWIVIGLVFSAVTAALYGPFVWERWVA* |
| Ga0066905_1002418342 | 3300005713 | Tropical Forest Soil | MDKVDEPKQPDLWTWVVIGIVISAVMAALYGPFVWERWVI* |
| Ga0066905_1002881664 | 3300005713 | Tropical Forest Soil | MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0066905_1004253572 | 3300005713 | Tropical Forest Soil | MHTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA* |
| Ga0066905_1004280343 | 3300005713 | Tropical Forest Soil | MRKVDEPKQPDLWTWVVIGIAFGAVMAALYGPFVWEHWVV* |
| Ga0066905_1004478572 | 3300005713 | Tropical Forest Soil | MAGSTMRTVNETKQSEVDLWTWIVIGLVFSAVTAALYGPFVWERWAA* |
| Ga0066905_1005265312 | 3300005713 | Tropical Forest Soil | MRKMDEPKQADLWTWTVIGVVFSAVMAALYGPLVWEHWVL* |
| Ga0066905_1006319882 | 3300005713 | Tropical Forest Soil | MRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWERWVA* |
| Ga0066905_1010089631 | 3300005713 | Tropical Forest Soil | MRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPF |
| Ga0066905_1010861841 | 3300005713 | Tropical Forest Soil | MRKVDEPEQPDLWTWVVIGIAFSAVMAALYGPFVWEHWVV* |
| Ga0066903_1002320631 | 3300005764 | Tropical Forest Soil | MHKADKSKHADLWTWIVIGLVFGAVTVALYGPFVWEHWVA* |
| Ga0066903_1003757074 | 3300005764 | Tropical Forest Soil | KMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0066903_1005030593 | 3300005764 | Tropical Forest Soil | MHKVNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA* |
| Ga0066903_1005105363 | 3300005764 | Tropical Forest Soil | MKVDRQMHNVNETKQPEADVWTWVVIGLVFGAVTVALYGPFVWEHLA* |
| Ga0066903_1006355905 | 3300005764 | Tropical Forest Soil | MRTVNETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0066903_1014310273 | 3300005764 | Tropical Forest Soil | MRKVDESKQPDLWTWVVIGLVFGAVTAALYGPFVWEHWAI* |
| Ga0066903_1033352062 | 3300005764 | Tropical Forest Soil | MRKVDEAKQWDLWTWIVIGVVFGAVTAALYGPFVWEHW |
| Ga0066903_1034311232 | 3300005764 | Tropical Forest Soil | MRKVDEIKQPDLWTWIVIGIVFSAVMTALYGPFIWEHWAV* |
| Ga0066903_1038529922 | 3300005764 | Tropical Forest Soil | MRKVDESKQPDLWTWVVIGLVFSAVTAALYGPFLWEHWVI* |
| Ga0066903_1049847201 | 3300005764 | Tropical Forest Soil | MRKVEESKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV* |
| Ga0066903_1057185532 | 3300005764 | Tropical Forest Soil | MHKVDEEKQADLLTWILIGVVFSFVTAALYGPFVWEHWVA* |
| Ga0066903_1074398742 | 3300005764 | Tropical Forest Soil | MRKVDETKQPDLWTWIVIGVVFSAVTAALYGPFVWEHWVV* |
| Ga0081455_1000005326 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRKLDETKQPDLWTWIVIGIVFSAVAAALYGPFVWEHWVV* |
| Ga0081455_101754403 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWAV* |
| Ga0081540_10017409 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MHKVEETKQADLWTWIVIGIVFSAVTAALYGPFVWEHWLV* |
| Ga0081540_11017382 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MRKVDEPKQLDLWTWVVIGIVFSAVMVALYGPFVWEHWVV* |
| Ga0075432_101548662 | 3300006058 | Populus Rhizosphere | MRNADEIKQPDLWTWIVIGIVFGAVTAALYGPFIWEHWVV* |
| Ga0070715_100638273 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKVDESKHADLWTWIVIGLVFSAVTVALYGPFVWEHWVV* |
| Ga0070716_1004410202 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMHKVDESKHADLWTWIVIGLVFSAVTVALYGPFVWEHWVV* |
| Ga0070716_1006515222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHKVDESKRVDLWTWIVIGLVFSAVTVALYGPFVWEHWVV* |
| Ga0079222_108243552 | 3300006755 | Agricultural Soil | MHKVDESKHADLWTWIVIGLVFGAVTVALYGPFVWEHWVV* |
| Ga0079222_118862022 | 3300006755 | Agricultural Soil | LTMRKVDENKPPDLLTWIVIGIVFSAVVTVLYAPFIWEHWAV* |
| Ga0079222_123793221 | 3300006755 | Agricultural Soil | MGPVNEMEQPEPDLWTWIVIGFVFSAVSAALYGPFVWEHWAP* |
| Ga0075425_10001177310 | 3300006854 | Populus Rhizosphere | MPKDETKQTDLWTWIVIGVVFSLVTAALYGPFVWEHWVT* |
| Ga0075434_1000309086 | 3300006871 | Populus Rhizosphere | MRTEIETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHFVT* |
| Ga0126380_100632242 | 3300010043 | Tropical Forest Soil | MAGSTMRTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWERWVA* |
| Ga0126380_103913931 | 3300010043 | Tropical Forest Soil | MRKVDETRQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV* |
| Ga0126380_107055542 | 3300010043 | Tropical Forest Soil | MRKMDESKQPDLWTWIVIGLVFSAVTIALYGPFVWERSVI* |
| Ga0126380_110114891 | 3300010043 | Tropical Forest Soil | TKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0126380_117264661 | 3300010043 | Tropical Forest Soil | MKVGRQMHKVNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEH |
| Ga0126384_105189431 | 3300010046 | Tropical Forest Soil | MRKVDETKQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV* |
| Ga0126384_105381652 | 3300010046 | Tropical Forest Soil | MRKMDEPKQADLWTWTAIGVVFSAVMAALYGPFVWEHWVL* |
| Ga0126384_107360311 | 3300010046 | Tropical Forest Soil | MRKVDESKQPDLWTWVVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0126382_100978861 | 3300010047 | Tropical Forest Soil | MRKVDEIKHPDLWTWIAIGIAFSAVMAVLYGPFIWEHWAV* |
| Ga0126382_105184052 | 3300010047 | Tropical Forest Soil | MRKVDEVKQPDLWTWVVIGIVFSAVMVALYGPFVWEHWVV* |
| Ga0126382_107464691 | 3300010047 | Tropical Forest Soil | MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0126382_109815051 | 3300010047 | Tropical Forest Soil | PKQPDLWPWVVIGIVVRAVMAALYGPFVWERWVV* |
| Ga0126382_109888781 | 3300010047 | Tropical Forest Soil | MAGSTMRTVKETKQPEADLWTWIVIGLVFSAVTAALYAPFIWEHWVA* |
| Ga0126373_128546191 | 3300010048 | Tropical Forest Soil | MRKVDESEQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV* |
| Ga0126370_100411462 | 3300010358 | Tropical Forest Soil | MPKDKTPQTDLWTWIVIGLVFSAVTVALYGPFVWEHWVT* |
| Ga0126370_100872534 | 3300010358 | Tropical Forest Soil | MRKVDQSKQPDLWTWIVIGIAFGVVTAALYGPFVWEHWVV* |
| Ga0126370_105029162 | 3300010358 | Tropical Forest Soil | MHKLDEPKQADLWTWIVLGLVFGAVTAALYGPFVWEHWVM* |
| Ga0126370_111043331 | 3300010358 | Tropical Forest Soil | MEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0126370_124945942 | 3300010358 | Tropical Forest Soil | DQSKQPDLWTWIVIGIAFSVVTAALYGPFVWEHWVV* |
| Ga0126376_101810733 | 3300010359 | Tropical Forest Soil | MRKVTESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0126376_106029741 | 3300010359 | Tropical Forest Soil | MRKVDETKQPDLWTWIVIGIVFSAVTAALYGPLVWEHWVV* |
| Ga0126372_121562682 | 3300010360 | Tropical Forest Soil | MAGSTMRSLNETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0126378_115086083 | 3300010361 | Tropical Forest Soil | MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWE |
| Ga0126377_100099018 | 3300010362 | Tropical Forest Soil | MAGSTMRTVNETKQPEADLWTWIVIGLVFSAVTAALYAPFVWEHWA* |
| Ga0126377_101116193 | 3300010362 | Tropical Forest Soil | MDETNQPDLWTWIVIGIVFGAVAAALYGPFVWEYWVV* |
| Ga0126377_101840363 | 3300010362 | Tropical Forest Soil | MAGSTMRTANEKKQPEADLWTWIVIGLVFGVVTAALYAPFVWEHWVA* |
| Ga0126377_104349011 | 3300010362 | Tropical Forest Soil | MRTVDEPKQPDLWTWVVIGIVFSAVMAALYGPFVWEHWVVV* |
| Ga0126377_105835422 | 3300010362 | Tropical Forest Soil | MRTVKETKQPEADLWTWIVIGLVFSAVTAALYAPFIWEHWVA* |
| Ga0126377_121133931 | 3300010362 | Tropical Forest Soil | PKQSDLWTWIVIGIVLSAVMAALYGPFVWEHWVVV* |
| Ga0126377_129296432 | 3300010362 | Tropical Forest Soil | VDESKQPDLWTWIVIGIVFSAVMAALYGPFVWEHWVV* |
| Ga0126377_131561281 | 3300010362 | Tropical Forest Soil | LTMRKMDETNQPDLWTWIVIGVVFSTVTAALYGPFVWEHWVV* |
| Ga0126379_100639162 | 3300010366 | Tropical Forest Soil | MDKMEETKQADPWTWIVIGLVFSAVTAALYCPFVWEHWVI* |
| Ga0126379_106180934 | 3300010366 | Tropical Forest Soil | DKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0126379_110331541 | 3300010366 | Tropical Forest Soil | MRKVDESKQRDLWTWIVIGIVFSAVTAALYGPFVWEHWVV* |
| Ga0126379_114180381 | 3300010366 | Tropical Forest Soil | VNETKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA* |
| Ga0126379_123151271 | 3300010366 | Tropical Forest Soil | MRMMDEPKQADLWTWIVIGIVFSAVTAALYGPFVW |
| Ga0126381_1003688081 | 3300010376 | Tropical Forest Soil | MPKDKTKQTDLWTWIVIGLVFSAVTVALYGPFVWEHWVT* |
| Ga0126383_101022431 | 3300010398 | Tropical Forest Soil | MKVGRQMHKVNVTKQPEADVWTWIVIGLVFGAVTVALYGPFVWEHLA* |
| Ga0126383_101799991 | 3300010398 | Tropical Forest Soil | KGRQTMDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0126383_106068261 | 3300010398 | Tropical Forest Soil | ETKQPDLWTWIVIGIVFSAVTAALYGPLVWEHWVV* |
| Ga0126383_114401832 | 3300010398 | Tropical Forest Soil | EFTMHKVDEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVA* |
| Ga0126383_114671011 | 3300010398 | Tropical Forest Soil | GRQTMDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVV* |
| Ga0126383_123251082 | 3300010398 | Tropical Forest Soil | TESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0134122_108045561 | 3300010400 | Terrestrial Soil | MRKMDEPKQADLWTWTVIGVVFSAVLAALYGPFVWEHWVL* |
| Ga0126375_100932071 | 3300012948 | Tropical Forest Soil | MRKVDEIKHPDLWTWIAIGIVFSAVMAVLYGPFIWEHWAV* |
| Ga0126375_110301932 | 3300012948 | Tropical Forest Soil | MRKMDESKQPDLWTWIVIGLVFSAVTIALYGPFVWERWVI* |
| Ga0126375_115397241 | 3300012948 | Tropical Forest Soil | MHTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEH |
| Ga0126369_105127761 | 3300012971 | Tropical Forest Soil | MAGSTMRSVNETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHWVT* |
| Ga0126369_127864031 | 3300012971 | Tropical Forest Soil | MRKVTESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVV* |
| Ga0132258_100697211 | 3300015371 | Arabidopsis Rhizosphere | MQKVDESKRADLWTWIVIGLVFSAVTVALYGPFVWEHWVV* |
| Ga0132258_100783049 | 3300015371 | Arabidopsis Rhizosphere | MRTVNQPKQSEQADLWTWFVIGLVFSAVTVALYGTFIWEHWVT* |
| Ga0132258_100790753 | 3300015371 | Arabidopsis Rhizosphere | MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHYVI* |
| Ga0132258_101565142 | 3300015371 | Arabidopsis Rhizosphere | MRKMDETKPANLWTWIVIGIVFSAVTVALYGPFVWEHWVA* |
| Ga0132258_103119883 | 3300015371 | Arabidopsis Rhizosphere | MMDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI* |
| Ga0132256_1011156722 | 3300015372 | Arabidopsis Rhizosphere | MQKADESKRADLWTWIVIGLVFSAVTVALYGPFVWEHWVV* |
| Ga0132256_1035483622 | 3300015372 | Arabidopsis Rhizosphere | MMHKVDESKRVDLWTWIVIGLVFSTVTVALYGPFVWEHWVV* |
| Ga0132257_1012364931 | 3300015373 | Arabidopsis Rhizosphere | MRKMDETKPANLWTWIVIGIVFSAVTVALYGPFVWEDWVA |
| Ga0132255_1023136061 | 3300015374 | Arabidopsis Rhizosphere | QTMRKMDETKPANLWTWIVIGIVFSAVTVALYGPFVWEHWVA* |
| Ga0182036_110730021 | 3300016270 | Soil | TPAAKKNELTMRKVAESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI |
| Ga0182033_106806543 | 3300016319 | Soil | ERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT |
| Ga0182032_112700262 | 3300016357 | Soil | MPKDKTKQTDLWTWIVIGLVFSAVTVALYGPFVWEHWGDL |
| Ga0182038_104797792 | 3300016445 | Soil | MHKLEETQQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI |
| Ga0187783_108667271 | 3300017970 | Tropical Peatland | MDKMEETKQADPWTWIVIGLVFSAVTAALYGSFVWEHWVV |
| Ga0210399_106283181 | 3300020581 | Soil | MRTEIETKQPEADVWTWIVIGLVFSAVTAALYGPFVWEHLVT |
| Ga0210408_101222852 | 3300021178 | Soil | MHKVDESKHADLWTWIVIGLVFGAVTVALYGPFVWEHWVV |
| Ga0126371_102000841 | 3300021560 | Tropical Forest Soil | MRKVDETKQWDLWTWIVIGVVFGAVTAALYGPFVWEHWVV |
| Ga0126371_103748033 | 3300021560 | Tropical Forest Soil | MRKVDESKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV |
| Ga0126371_108711202 | 3300021560 | Tropical Forest Soil | MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT |
| Ga0126371_121045062 | 3300021560 | Tropical Forest Soil | MRKVDQSKQPDLLTWIVIGIAFSVVTAALYGPFVWEHWVV |
| Ga0126371_133220772 | 3300021560 | Tropical Forest Soil | MRKVDESKQPDLWTWVVLGLVFSAVTAALYGPFVWEHWVI |
| Ga0207668_102332573 | 3300025972 | Switchgrass Rhizosphere | MHTVNDTKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA |
| Ga0209177_100362702 | 3300027775 | Agricultural Soil | MGPVNEMEQPEPDLWTWIVIGFVFSAVSAALYGPFVWEHWAP |
| Ga0209465_100381374 | 3300027874 | Tropical Forest Soil | MRKVDETRQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV |
| Ga0209465_104528001 | 3300027874 | Tropical Forest Soil | MHKVDEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVA |
| Ga0209465_104772871 | 3300027874 | Tropical Forest Soil | PKKNELTMRKVDETKQWDLWTWIVIGVVFSTVTAALYGPFVWEHWVV |
| Ga0207428_105795642 | 3300027907 | Populus Rhizosphere | MRNADEIKQPDLWTWIVIGIVFGAVTAALYGPFIWEHWVV |
| Ga0318541_104487582 | 3300031545 | Soil | MDKMEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI |
| Ga0310915_103613772 | 3300031573 | Soil | KVNEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVV |
| Ga0310915_107490601 | 3300031573 | Soil | MEETKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI |
| Ga0306917_110218302 | 3300031719 | Soil | TMRKVDEFKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV |
| Ga0307468_1015732381 | 3300031740 | Hardwood Forest Soil | MRKMDEPKQADLWTWTVIGVVFSAVMAALYGPFVWAHWVL |
| Ga0306918_103637391 | 3300031744 | Soil | MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVI |
| Ga0318552_101469642 | 3300031782 | Soil | MDKVNEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVV |
| Ga0306925_104812153 | 3300031890 | Soil | MDKMEERKQADPWTWIVIGLVFSAVTAALYGPFVWEHWVT |
| Ga0306925_119584361 | 3300031890 | Soil | AAKKNELTMRKVDESKQPDLWTWIVIGIVFSAVTPALYGPFVWEHWVV |
| Ga0318520_110138111 | 3300031897 | Soil | MRKVDESKQPDLWTWIVIGIVFSSVMAALYGPFVWEHWVV |
| Ga0306921_100821481 | 3300031912 | Soil | MPKDKTKQTDLWTWIVIGLVFSAVTVALYGPFVWE |
| Ga0306921_117919802 | 3300031912 | Soil | MRKVAESKQPDLWTWIVIGLVFSAVTAALYGPFVWEHWVI |
| Ga0310912_111566321 | 3300031941 | Soil | MRKVDETKQWDLWTWIVIGVVFSAVTAALYGPFVWEHWVV |
| Ga0310909_102383161 | 3300031947 | Soil | TMDKVNEEKQADLLTWIVIGVVFSFVTAALYGPFVWEHWVV |
| Ga0306922_107095202 | 3300032001 | Soil | MRKVDESKQPDLWTWIVIGIVFSAVTPALYGPFVWEHWVV |
| Ga0307471_1015532831 | 3300032180 | Hardwood Forest Soil | MHTVNETKQPEADLWTWIVIGLVFSAVTAALYGPFVWEHWVA |
| Ga0306920_1003608093 | 3300032261 | Soil | MRKVDEFKQPDLWTWIVIGIVFSAVTAALYGPFVWEHWVV |
| Ga0373948_0056001_667_789 | 3300034817 | Rhizosphere Soil | MRKMDEPKQADLWTWTVIGVVFSAVMAALYGPFVWEHWVL |
| Ga0373958_0050785_39_161 | 3300034819 | Rhizosphere Soil | MRNADDIKQPDLWTWIVIGIVFGAVTAALYGPFIWEHWVV |
| ⦗Top⦘ |