


| Basic Information | |
|---|---|
| Family ID | F047261 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VLPVYRYEGLEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 20.00 % |
| % of genes near scaffold ends (potentially truncated) | 72.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.67 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.33% β-sheet: 0.00% Coil/Unstructured: 54.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00805 | Pentapeptide | 8.00 |
| PF04392 | ABC_sub_bind | 2.00 |
| PF09948 | DUF2182 | 2.00 |
| PF03401 | TctC | 1.33 |
| PF00589 | Phage_integrase | 1.33 |
| PF13676 | TIR_2 | 1.33 |
| PF05154 | TM2 | 1.33 |
| PF01925 | TauE | 0.67 |
| PF00072 | Response_reg | 0.67 |
| PF13561 | adh_short_C2 | 0.67 |
| PF00581 | Rhodanese | 0.67 |
| PF07859 | Abhydrolase_3 | 0.67 |
| PF00578 | AhpC-TSA | 0.67 |
| PF08327 | AHSA1 | 0.67 |
| PF00211 | Guanylate_cyc | 0.67 |
| PF00872 | Transposase_mut | 0.67 |
| PF00436 | SSB | 0.67 |
| PF13414 | TPR_11 | 0.67 |
| PF13181 | TPR_8 | 0.67 |
| PF04551 | GcpE | 0.67 |
| PF13751 | DDE_Tnp_1_6 | 0.67 |
| PF10088 | DUF2326 | 0.67 |
| PF13683 | rve_3 | 0.67 |
| PF12760 | Zn_Tnp_IS1595 | 0.67 |
| PF02518 | HATPase_c | 0.67 |
| PF03602 | Cons_hypoth95 | 0.67 |
| PF13281 | MAP3K_TRAF_bd | 0.67 |
| PF01068 | DNA_ligase_A_M | 0.67 |
| PF01370 | Epimerase | 0.67 |
| PF05065 | Phage_capsid | 0.67 |
| PF17200 | sCache_2 | 0.67 |
| PF00561 | Abhydrolase_1 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 8.00 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.00 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 1.33 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.33 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.67 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.67 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.67 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.67 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.67 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.67 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.67 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.67 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.67 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.67 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.67 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.67 % |
| All Organisms | root | All Organisms | 47.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02IJ74R | Not Available | 509 | Open in IMG/M |
| 2170459016|G1P06HT02IBVAS | Not Available | 539 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10072997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 867 | Open in IMG/M |
| 3300005174|Ga0066680_10051036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2429 | Open in IMG/M |
| 3300005332|Ga0066388_106113526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 37f | 608 | Open in IMG/M |
| 3300005332|Ga0066388_108165926 | Not Available | 523 | Open in IMG/M |
| 3300005363|Ga0008090_10108374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300005436|Ga0070713_101236799 | Not Available | 723 | Open in IMG/M |
| 3300005511|Ga0077121_10797075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 581 | Open in IMG/M |
| 3300005557|Ga0066704_10070369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2251 | Open in IMG/M |
| 3300005559|Ga0066700_10184123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1435 | Open in IMG/M |
| 3300005713|Ga0066905_100269084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1320 | Open in IMG/M |
| 3300005764|Ga0066903_100047882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5159 | Open in IMG/M |
| 3300005764|Ga0066903_101436652 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300005764|Ga0066903_102348052 | Not Available | 1031 | Open in IMG/M |
| 3300005764|Ga0066903_102544078 | Not Available | 992 | Open in IMG/M |
| 3300005764|Ga0066903_103800878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
| 3300005764|Ga0066903_104317765 | Not Available | 760 | Open in IMG/M |
| 3300005764|Ga0066903_108025909 | Not Available | 541 | Open in IMG/M |
| 3300005844|Ga0068862_101734085 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006049|Ga0075417_10517256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300006173|Ga0070716_101124102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → Fischerella muscicola | 628 | Open in IMG/M |
| 3300006174|Ga0075014_101020977 | Not Available | 502 | Open in IMG/M |
| 3300006175|Ga0070712_100536405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 985 | Open in IMG/M |
| 3300006176|Ga0070765_101266621 | Not Available | 696 | Open in IMG/M |
| 3300006176|Ga0070765_102221836 | Not Available | 512 | Open in IMG/M |
| 3300006755|Ga0079222_11787572 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006791|Ga0066653_10613445 | Not Available | 554 | Open in IMG/M |
| 3300009100|Ga0075418_11745970 | Not Available | 677 | Open in IMG/M |
| 3300009143|Ga0099792_10207359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300009146|Ga0105091_10603183 | Not Available | 567 | Open in IMG/M |
| 3300009148|Ga0105243_11323284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300009522|Ga0116218_1173757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300009826|Ga0123355_10653479 | Not Available | 1226 | Open in IMG/M |
| 3300009826|Ga0123355_11058678 | Not Available | 851 | Open in IMG/M |
| 3300010041|Ga0126312_11139309 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010043|Ga0126380_11486240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 599 | Open in IMG/M |
| 3300010046|Ga0126384_11405662 | Not Available | 651 | Open in IMG/M |
| 3300010046|Ga0126384_11650801 | Not Available | 605 | Open in IMG/M |
| 3300010047|Ga0126382_10889330 | Not Available | 769 | Open in IMG/M |
| 3300010049|Ga0123356_10264816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1805 | Open in IMG/M |
| 3300010358|Ga0126370_10944230 | Not Available | 782 | Open in IMG/M |
| 3300010359|Ga0126376_12509820 | Not Available | 563 | Open in IMG/M |
| 3300010359|Ga0126376_12750616 | Not Available | 541 | Open in IMG/M |
| 3300010362|Ga0126377_10442739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1320 | Open in IMG/M |
| 3300010366|Ga0126379_13655391 | Not Available | 515 | Open in IMG/M |
| 3300010375|Ga0105239_11239013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 186 | 860 | Open in IMG/M |
| 3300010376|Ga0126381_103261431 | Not Available | 641 | Open in IMG/M |
| 3300010376|Ga0126381_103560625 | Not Available | 611 | Open in IMG/M |
| 3300010376|Ga0126381_104756742 | Not Available | 522 | Open in IMG/M |
| 3300010376|Ga0126381_104906833 | Not Available | 514 | Open in IMG/M |
| 3300010398|Ga0126383_10220850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1836 | Open in IMG/M |
| 3300010398|Ga0126383_12645215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300010868|Ga0124844_1028645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1746 | Open in IMG/M |
| 3300010868|Ga0124844_1202268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300010937|Ga0137776_1410858 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
| 3300012209|Ga0137379_10184507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1999 | Open in IMG/M |
| 3300012209|Ga0137379_10370590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1341 | Open in IMG/M |
| 3300012209|Ga0137379_11319175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
| 3300012212|Ga0150985_122894476 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012362|Ga0137361_10384828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1288 | Open in IMG/M |
| 3300012469|Ga0150984_108563907 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012683|Ga0137398_10096448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1852 | Open in IMG/M |
| 3300012685|Ga0137397_10028986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3931 | Open in IMG/M |
| 3300012961|Ga0164302_10190605 | Not Available | 1251 | Open in IMG/M |
| 3300012971|Ga0126369_12245052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 37f | 633 | Open in IMG/M |
| 3300012987|Ga0164307_11818432 | Not Available | 516 | Open in IMG/M |
| 3300014326|Ga0157380_11811660 | Not Available | 670 | Open in IMG/M |
| 3300014969|Ga0157376_11256797 | Not Available | 770 | Open in IMG/M |
| 3300015372|Ga0132256_100116266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2631 | Open in IMG/M |
| 3300015373|Ga0132257_100017688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7425 | Open in IMG/M |
| 3300016270|Ga0182036_11525520 | Not Available | 561 | Open in IMG/M |
| 3300016294|Ga0182041_10050127 | Not Available | 2819 | Open in IMG/M |
| 3300016294|Ga0182041_11306663 | Not Available | 664 | Open in IMG/M |
| 3300016319|Ga0182033_10110179 | Not Available | 2046 | Open in IMG/M |
| 3300016319|Ga0182033_11379230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 634 | Open in IMG/M |
| 3300016319|Ga0182033_11878101 | Not Available | 544 | Open in IMG/M |
| 3300016357|Ga0182032_11203762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300016357|Ga0182032_11357666 | Not Available | 615 | Open in IMG/M |
| 3300016371|Ga0182034_11612175 | Not Available | 570 | Open in IMG/M |
| 3300016371|Ga0182034_11738150 | Not Available | 549 | Open in IMG/M |
| 3300016387|Ga0182040_11592920 | Not Available | 556 | Open in IMG/M |
| 3300016404|Ga0182037_10610358 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300016404|Ga0182037_10745085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 841 | Open in IMG/M |
| 3300016404|Ga0182037_11319572 | Not Available | 636 | Open in IMG/M |
| 3300016422|Ga0182039_10192751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1619 | Open in IMG/M |
| 3300016422|Ga0182039_10215987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1540 | Open in IMG/M |
| 3300016422|Ga0182039_11909543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300016445|Ga0182038_11593160 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300017792|Ga0163161_11751507 | Not Available | 551 | Open in IMG/M |
| 3300017792|Ga0163161_12073004 | Not Available | 506 | Open in IMG/M |
| 3300017822|Ga0187802_10095920 | Not Available | 1114 | Open in IMG/M |
| 3300017970|Ga0187783_10741344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300017970|Ga0187783_10909520 | Not Available | 634 | Open in IMG/M |
| 3300018053|Ga0184626_10150248 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300018433|Ga0066667_12125132 | Not Available | 520 | Open in IMG/M |
| 3300018481|Ga0190271_13137725 | Not Available | 554 | Open in IMG/M |
| 3300019886|Ga0193727_1124664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → unclassified Tardiphaga → Tardiphaga sp. OK246 | 732 | Open in IMG/M |
| 3300019887|Ga0193729_1243388 | Not Available | 576 | Open in IMG/M |
| 3300020140|Ga0179590_1106453 | Not Available | 757 | Open in IMG/M |
| 3300020581|Ga0210399_11610294 | Not Available | 500 | Open in IMG/M |
| 3300020583|Ga0210401_11547227 | Not Available | 520 | Open in IMG/M |
| 3300021168|Ga0210406_11236932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300021401|Ga0210393_11524586 | Not Available | 531 | Open in IMG/M |
| 3300021478|Ga0210402_10769840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300021479|Ga0210410_10093669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2648 | Open in IMG/M |
| 3300021479|Ga0210410_11033197 | Not Available | 711 | Open in IMG/M |
| 3300021559|Ga0210409_10443838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. URHE0060 | 1158 | Open in IMG/M |
| 3300021560|Ga0126371_10823664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1074 | Open in IMG/M |
| 3300024288|Ga0179589_10334268 | Not Available | 686 | Open in IMG/M |
| 3300026089|Ga0207648_12189086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 514 | Open in IMG/M |
| 3300031421|Ga0308194_10224949 | Not Available | 618 | Open in IMG/M |
| 3300031545|Ga0318541_10177361 | Not Available | 1176 | Open in IMG/M |
| 3300031545|Ga0318541_10638883 | Not Available | 595 | Open in IMG/M |
| 3300031572|Ga0318515_10385793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 750 | Open in IMG/M |
| 3300031573|Ga0310915_10036454 | Not Available | 3107 | Open in IMG/M |
| 3300031708|Ga0310686_101097600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1191 | Open in IMG/M |
| 3300031708|Ga0310686_104289406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4338 | Open in IMG/M |
| 3300031736|Ga0318501_10430407 | Not Available | 715 | Open in IMG/M |
| 3300031753|Ga0307477_11159404 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 503 | Open in IMG/M |
| 3300031781|Ga0318547_11037676 | Not Available | 513 | Open in IMG/M |
| 3300031796|Ga0318576_10043943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1912 | Open in IMG/M |
| 3300031819|Ga0318568_10247002 | Not Available | 1105 | Open in IMG/M |
| 3300031833|Ga0310917_10079625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 2073 | Open in IMG/M |
| 3300031846|Ga0318512_10104189 | Not Available | 1336 | Open in IMG/M |
| 3300031879|Ga0306919_11213924 | Not Available | 573 | Open in IMG/M |
| 3300031880|Ga0318544_10227423 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031890|Ga0306925_11557363 | Not Available | 645 | Open in IMG/M |
| 3300031912|Ga0306921_10009944 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae | 10102 | Open in IMG/M |
| 3300031912|Ga0306921_10944409 | Not Available | 976 | Open in IMG/M |
| 3300031942|Ga0310916_11137017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300031945|Ga0310913_10327757 | Not Available | 1082 | Open in IMG/M |
| 3300031945|Ga0310913_10455622 | Not Available | 908 | Open in IMG/M |
| 3300031947|Ga0310909_10451302 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300031947|Ga0310909_11425343 | Not Available | 554 | Open in IMG/M |
| 3300031954|Ga0306926_10527219 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300032001|Ga0306922_11692480 | Not Available | 626 | Open in IMG/M |
| 3300032013|Ga0310906_10435224 | Not Available | 874 | Open in IMG/M |
| 3300032025|Ga0318507_10453477 | Not Available | 558 | Open in IMG/M |
| 3300032035|Ga0310911_10857911 | Not Available | 524 | Open in IMG/M |
| 3300032052|Ga0318506_10400223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 141 | 609 | Open in IMG/M |
| 3300032055|Ga0318575_10565663 | Not Available | 577 | Open in IMG/M |
| 3300032059|Ga0318533_10642497 | Not Available | 779 | Open in IMG/M |
| 3300032060|Ga0318505_10420811 | Not Available | 632 | Open in IMG/M |
| 3300032076|Ga0306924_11628746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 679 | Open in IMG/M |
| 3300032076|Ga0306924_12592938 | Not Available | 506 | Open in IMG/M |
| 3300032076|Ga0306924_12643291 | Not Available | 500 | Open in IMG/M |
| 3300032261|Ga0306920_100838186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum | 1348 | Open in IMG/M |
| 3300032261|Ga0306920_102129360 | Not Available | 782 | Open in IMG/M |
| 3300033289|Ga0310914_10155255 | Not Available | 2021 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.67% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.67% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_07362170 | 2170459005 | Grass Soil | SLYSMFEDFDPQDFHWVLPVYKYKEPKQLLATLAENVIAPAEGKVKALEERRRMIGTQLRTQ |
| 2ZMR_02953630 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | VYRYKEHKQLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| AF_2010_repII_A1DRAFT_100729971 | 3300000597 | Forest Soil | EWVLPVYRYEGLEPLLATLAEKVIAPAEGKVKALEERRRIIEAELTKPQ* |
| Ga0066680_100510364 | 3300005174 | Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ* |
| Ga0066388_1061135261 | 3300005332 | Tropical Forest Soil | YRYEGLKQLLEVLPEKVIAPAEGKVKALRKRRRLIEAELTKPQ* |
| Ga0066388_1081659261 | 3300005332 | Tropical Forest Soil | YRYEGLEPLLATLMEKVIAPAEGKLRALQEKRRMIEAELTEPR* |
| Ga0008090_101083743 | 3300005363 | Tropical Rainforest Soil | WKYDWVLPVYRYEGLEPLLATLAEKVIAPAEGKVKALEERRHMIEAELTRPQ* |
| Ga0070713_1012367993 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DYWKYDWVLPPHRYEGLAPLLATLAESVIAPAEAKVKALEERRHAIEAELTAPRALT* |
| Ga0077121_107970751 | 3300005511 | Arabidopsis Rhizosphere | LPVYRYDGLEPLLAALAEKVIAPAERKVKALEERRRMIEAELIKSQ* |
| Ga0066704_100703692 | 3300005557 | Soil | LLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ* |
| Ga0066700_101841235 | 3300005559 | Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALEERRRMIEA |
| Ga0066905_1002690843 | 3300005713 | Tropical Forest Soil | MFKDFDPQDFHWVLPVYRYKEPEQLLATLAEKVITPAEGKVKALEQRRRMIEAELTKPQ* |
| Ga0066903_1000478824 | 3300005764 | Tropical Forest Soil | VLPVYRYEGLELLLATLAEKVIAPAEAKVKALEDRRRIIEAELTKPR* |
| Ga0066903_1014366522 | 3300005764 | Tropical Forest Soil | MFKDYWKYNWVLPVYRYKEPAPLADKVIAPAEGKVRALQERRRMIDAELTKPQ* |
| Ga0066903_1023480521 | 3300005764 | Tropical Forest Soil | WVLTTHRYDSQMQLIADLGEKVIAPAEAKVKALEERRRMIEAELTKPQ* |
| Ga0066903_1025440781 | 3300005764 | Tropical Forest Soil | MFKDYWKYDRVLPVYRYDGLEPLLATLAEGVIAPAEGKVKALEERRRLFEAQLGTQSASQ |
| Ga0066903_1038008781 | 3300005764 | Tropical Forest Soil | QDFHWVLPVYRYKEPEQLLATLAEKVIAPAEGKAKALEERRRNFEAELTKPQ* |
| Ga0066903_1043177652 | 3300005764 | Tropical Forest Soil | PLLATLAEKVIAPAEGKVKALEQRRRMIEAELTKPQ* |
| Ga0066903_1080259091 | 3300005764 | Tropical Forest Soil | MFKDYWKYDWVLPIYRYEGTNPLLATLAEEVIVPAEEKAKALEERRRSFEAELTQASDKD |
| Ga0068862_1017340852 | 3300005844 | Switchgrass Rhizosphere | DLFKYDWMLPPYRYESLDGLLATLAEKVIAPAEAKVKALEEKRRLIEAELTKSQ* |
| Ga0075417_105172561 | 3300006049 | Populus Rhizosphere | MFKDYWKYDWVLKVYRYRGLKPLLAALPKHVINDSEKKVKALQKRRRRIEAELTKPQ* |
| Ga0070716_1011241021 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DYWKYDWVLPVYRYEGIEPLLATLAKNIIAPAEGKVKALEERRRRIETELTKPQEAS* |
| Ga0075014_1010209771 | 3300006174 | Watersheds | VLPVYRYEGLEPLLATLVDKVITPAEGKVKALQERRRMIEAELTKSSKPK* |
| Ga0070712_1005364051 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PVYRYEGIEPLLATLAEKVIAPAEGKVRTLEERRRMIEAELTKPQ* |
| Ga0070765_1012666212 | 3300006176 | Soil | LLATLAENVIAPAEAKVKALEERRRMIEAELTKP* |
| Ga0070765_1022218362 | 3300006176 | Soil | DYWKYDWVLPAYRYENINSLLVTLPEKVVVPAEEKVKALAERRRMIEAELNRP* |
| Ga0079222_117875721 | 3300006755 | Agricultural Soil | LLKYDWVLPPHRYEELEPLLATLAKNVIAPAEAKVKALEERRQAIEAALTAQPSPG* |
| Ga0066653_106134452 | 3300006791 | Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALEERRRIEAELTKPQ* |
| Ga0075418_117459702 | 3300009100 | Populus Rhizosphere | DYWKYDWVLPEYRYEGLSPLLVALREKVIAPAEAKVNELEDRRRRGRERKP* |
| Ga0099792_102073591 | 3300009143 | Vadose Zone Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALQERRRMIEAELTKPQ* |
| Ga0105091_106031831 | 3300009146 | Freshwater Sediment | LEPLLVSLAEKVIAPAEEKVKSLEDRRRMIEAELTKPQ* |
| Ga0105243_113232842 | 3300009148 | Miscanthus Rhizosphere | EGADRPYAMFRDYWKYDWVLPVYRYEGLQQLLATLADGVITPSEIKLAALDDRRRRLEAELLSSN* |
| Ga0116218_11737573 | 3300009522 | Peatlands Soil | LPIYRYEGIEPLLATLADKVIAPAEGKVKALQERRRMVEAELTKPK* |
| Ga0123355_106534792 | 3300009826 | Termite Gut | MVYRYEGLEPLLATLTENVIATAEGKVKALAARRRMIEAELTKPQ* |
| Ga0123355_110586781 | 3300009826 | Termite Gut | TRNTEQKVISPAEEKVKALEKRRRKIEAELNKPQ* |
| Ga0126312_111393093 | 3300010041 | Serpentine Soil | LLASLADKVIAPAEAKVKALEEKRRTIEMELTKAQ* |
| Ga0126380_114862401 | 3300010043 | Tropical Forest Soil | YQYEGLEPLLATLAEKVIAPAEGKVKLLEERRRFIEAELIKSS* |
| Ga0126384_114056621 | 3300010046 | Tropical Forest Soil | GLGPLLATLAEKVIAPAEGKAKALQERRREFEAELTKAQ* |
| Ga0126384_116508012 | 3300010046 | Tropical Forest Soil | MFKDFDPQDFHWVLPVYRYKEPEHLLATLAKNVIAPAEGKVRALEERRCLIEAQLTKPQ* |
| Ga0126382_108893302 | 3300010047 | Tropical Forest Soil | LATLAEKVMAPAEEKGKAMEERRRMIEAALTKPQ* |
| Ga0123356_102648163 | 3300010049 | Termite Gut | MVYRYEGLEPLLATLTENVIATAEGKVKALAARRRMIEAELTKP* |
| Ga0126370_109442301 | 3300010358 | Tropical Forest Soil | LLATLAEKVIAPAEGKVTALQDRRRMIEAELTKPQ* |
| Ga0126376_125098201 | 3300010359 | Tropical Forest Soil | KDLGKYEWMLPVYRYEGLEPLLATLAEKVVAAAELKVKALAERRRMIEAELTKPQ* |
| Ga0126376_127506161 | 3300010359 | Tropical Forest Soil | THCYDSQMQLIADLGEKVIRPAELKVLDLQGSTSARRTIEAEPIKPQ* |
| Ga0126377_104427395 | 3300010362 | Tropical Forest Soil | RYEGLDPLLIMLSEKVIAPAEAKVKALEERRRVIEAELTRPQ* |
| Ga0126379_136553912 | 3300010366 | Tropical Forest Soil | DSLLTTIAENVIAPAEAKVNALQERRRMIEAELTKPR* |
| Ga0105239_112390132 | 3300010375 | Corn Rhizosphere | YDWVLPVYQYEGLQPLLATLAEKVIAPAEGKVKALQERRRMIEAELIKPK* |
| Ga0126381_1032614312 | 3300010376 | Tropical Forest Soil | LPVYRYDGLEPLLATLAEKVIAPAEAKVKDLAERRRMIEAELVKPR* |
| Ga0126381_1035606251 | 3300010376 | Tropical Forest Soil | LATLAEKVIAPAEGKVKALQERRRMIEAELTKPQ* |
| Ga0126381_1047567422 | 3300010376 | Tropical Forest Soil | DYWKYEWVLPVWRYEGLEPLLATLAEGVIAPAEAKVKELVERRRTIEAELTRPQ* |
| Ga0126381_1049068332 | 3300010376 | Tropical Forest Soil | MFKDFDPHDFHWVLPVYRYKEPEQLLRTLGEPVIAPAEEKAKALEKRRRMFEAELAKPP* |
| Ga0126383_102208502 | 3300010398 | Tropical Forest Soil | LFSQWYFFEAVVNSMVRDFDPQDYHWVLPVYQYKEPEQLLAALSEKVIDPAEGKAKALQKRRRMFEAELTKPH* |
| Ga0126383_126452151 | 3300010398 | Tropical Forest Soil | YEGLEPLLATLAEKVIAPAEGKVKLLEERRRFIEAELIKSS* |
| Ga0124844_10286451 | 3300010868 | Tropical Forest Soil | GLEPLLAALAERVVAPAEAKVNALLQERRRAFEEELTKP* |
| Ga0124844_12022682 | 3300010868 | Tropical Forest Soil | RKLCPLYRYKGLEPLLAALAERVVAPAEAKVNALQERRRAFEEELTKP* |
| Ga0137776_14108582 | 3300010937 | Sediment | VLPVLRYEGVEPLLATLTERVIAPAEAKVKALEERRSMIEAELIKASN* |
| Ga0137379_101845072 | 3300012209 | Vadose Zone Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALEERRHMIEAELTEPQ* |
| Ga0137379_103705902 | 3300012209 | Vadose Zone Soil | EGLEPLLATLAEKVIAPAEGKVKALAERRRIIEAELTKPQ* |
| Ga0137379_113191752 | 3300012209 | Vadose Zone Soil | LATLAEKVIAPAEVKVKDLEERRRIVEAELTKPQ* |
| Ga0150985_1228944762 | 3300012212 | Avena Fatua Rhizosphere | LPVYRYEGLETLLAALTDKVVSPAEGKVKALEEKRRAIEAEL |
| Ga0137361_103848281 | 3300012362 | Vadose Zone Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALEERRHMIEAELTKPQ* |
| Ga0150984_1085639071 | 3300012469 | Avena Fatua Rhizosphere | VLPPHRYEGLAPLLATLAESVIAPAEAKVKALEERRRAIETELTAPRTST* |
| Ga0137398_100964481 | 3300012683 | Vadose Zone Soil | VLPVSRYEGLELLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ* |
| Ga0137397_100289861 | 3300012685 | Vadose Zone Soil | LGIFIQLLLATLAEKVIAPAEAKVKALEGRRRAIEVELGSQ* |
| Ga0164302_101906051 | 3300012961 | Soil | GLEPLLAMLAEKVIAPAEGKVNALQERRRVIEAELTKPR* |
| Ga0126369_122450522 | 3300012971 | Tropical Forest Soil | WVLPVYRYEGLKQLLEVLPEKVIAPAEGKVKALRKRRRLIEAELTKPQ* |
| Ga0164307_118184321 | 3300012987 | Soil | EQLLATLAENVIAPAEGKAKALEERRRKFEAELTKPQ* |
| Ga0157380_118116601 | 3300014326 | Switchgrass Rhizosphere | QDFYWVLPVYQYKEAEQLLATLVEKVNDPAEAKVKALEERRRAIEVELSKPQ* |
| Ga0157376_112567971 | 3300014969 | Miscanthus Rhizosphere | VLPVYRYEGLEPLRATLAEKVIAPAEGKVNALQERRRVIVAELTKPR* |
| Ga0132256_1001162661 | 3300015372 | Arabidopsis Rhizosphere | DFHWVLPVYKYKEPKQLLATLAENVIAPAEGKVKDLEERRRVVERELNKPQ* |
| Ga0132257_10001768814 | 3300015373 | Arabidopsis Rhizosphere | VYKYKEPKQLLATLAENVIAPAEGKVKDLEERRRVVERELNKPQ* |
| Ga0182036_115255202 | 3300016270 | Soil | MFKDYWKYEWVLPVYRYEGLEPLLATLAENVIAPAEGKVKALAERRRMI |
| Ga0182041_100501271 | 3300016294 | Soil | YEGLEPLLATLAEKVIVPAEGKVRALEERRRTIEAELTKPQ |
| Ga0182041_113066631 | 3300016294 | Soil | KYEWVLPVYRYDGLEPLLATLADRVIAPAEGKVKALQERRRMIEAELTKTSP |
| Ga0182033_101101791 | 3300016319 | Soil | HWYEGLDSLLTTIAENVIAPAEAKVNALQGRRMIEAELTKPR |
| Ga0182033_113792303 | 3300016319 | Soil | FKDFDPQDFHWVLPVYRYKEPEQLLATLAENVIAPAEGKVKALEERRRMIEAELTKPQ |
| Ga0182033_118781012 | 3300016319 | Soil | YEGLEPLLATLAEKVIAPAEGKVKALAERRLMIEAELTKPQ |
| Ga0182032_112037622 | 3300016357 | Soil | GLEPLLATLAEKVIAPAEGKVKALAERRRMIEVELTKPQ |
| Ga0182032_113576661 | 3300016357 | Soil | GLQLLLATLVEKVIGPAEAKVKALEERRRAIEAKLTALRA |
| Ga0182034_116121751 | 3300016371 | Soil | MWTFVFFSAGFPQDFHWVLPVYRYKEPEQLRAALAENVIAPAEGKAKAFEERRRKSEAELTKPQ |
| Ga0182034_117381502 | 3300016371 | Soil | DWVLPPYRYEGLQLLLATLAEKVIAPAEAKVKALEESRRAIEAELTAPRA |
| Ga0182040_115929201 | 3300016387 | Soil | YDWVLPPYCYEELQLLLATLVEKVIAPAEAKVKALEESRRAIEAELTAPRA |
| Ga0182037_106103582 | 3300016404 | Soil | LATLGEKVIGPAEAKVKALEERRRAIEAQLTAPRA |
| Ga0182037_107450853 | 3300016404 | Soil | SPPFSMFKDLGKYEWMIPIYQYEGLEPPFATLAEKVVAPAELKVKALAERRCMIEAELIKPQ |
| Ga0182037_113195722 | 3300016404 | Soil | FKDFDPQDFHWVLPVYQYKEPQQLLSTLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| Ga0182039_101927513 | 3300016422 | Soil | LEPLLAKLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| Ga0182039_102159873 | 3300016422 | Soil | PLLATLAEKVIAPAEGKVKALAERRRMIEVELTKPQ |
| Ga0182039_119095431 | 3300016422 | Soil | LLATLAEKVIAPAEGKAKALQERRRVFEAELTKAQ |
| Ga0182038_115931601 | 3300016445 | Soil | YQYKEPQQLLSTLAEKVIAPAEGKVQALAERRSMIEAELTKPQ |
| Ga0163161_117515071 | 3300017792 | Switchgrass Rhizosphere | DGLEPLVATMAAKVIAPAEAKVKALEERRRAIEAELTKPTG |
| Ga0163161_120730042 | 3300017792 | Switchgrass Rhizosphere | VLPVYRYEGLGPLLTSLADKVIAPAEVMIKALEEKRRRIEAELTKPQ |
| Ga0187802_100959201 | 3300017822 | Freshwater Sediment | QDFHWVLPVYRYKEPEQLLAKLAANVIAPAEGKVNALAERRRMIEAELTKPQ |
| Ga0187783_107413443 | 3300017970 | Tropical Peatland | PLLAALAERVIAPAEAKVKALEERRRMIEAELTKAST |
| Ga0187783_109095201 | 3300017970 | Tropical Peatland | EPLLATLAERVIAPAEAKVKALEERRRMIEAELTKTSP |
| Ga0184626_101502482 | 3300018053 | Groundwater Sediment | VLPVYRYDGLERLVATLAEKVIDPAEGKVKALEERRRMIEAELIKPQ |
| Ga0066667_121251321 | 3300018433 | Grasslands Soil | LLATLAEKVIAPAEGKVKALEERRHMIEAELTEPQ |
| Ga0190271_131377251 | 3300018481 | Soil | LPVYRYEGLEPLLAALAEKIIAPAEGKVNALQERRRVIEAELTKPR |
| Ga0193727_11246642 | 3300019886 | Soil | YEGLEPLLATLAEKVIAPAEGKVKALQERRRVIEAELTKPQ |
| Ga0193729_12433882 | 3300019887 | Soil | VLPVYRYEGLEPLLATLAEKVIAPAEGKVKALHERRRMIEAELTKPR |
| Ga0179590_11064531 | 3300020140 | Vadose Zone Soil | LLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| Ga0210399_116102943 | 3300020581 | Soil | NSLLVTLPEKVVAPAEAKVKALVERRRMIEAELNRP |
| Ga0210401_115472271 | 3300020583 | Soil | GLELLLEMLAEKVIAPAEEKVQALAERRRTIEAELTKPR |
| Ga0210406_112369321 | 3300021168 | Soil | YEGIEPLLATLAEKVIAPAEGKVNALAERRRMIEAELIKPQ |
| Ga0210393_115245861 | 3300021401 | Soil | DWLLPAYRYENINSLLVTLPEKVVVPAEEKVKALAERRRMIEAELNQQ |
| Ga0210402_107698401 | 3300021478 | Soil | LLLEMLAEKVIAPAEEKVQALAERRRTIEAELTKPR |
| Ga0210410_100936694 | 3300021479 | Soil | LLASLAERVIAPAEAKVKGLAERRRVIEAELVKPQ |
| Ga0210410_110331972 | 3300021479 | Soil | VLPVYRYDGLEPLRATLVDKVITPAEGKVKALQERRRMIEAEPTKLQ |
| Ga0210409_104438381 | 3300021559 | Soil | AYRYENINSLLVTLPEKVVVPAEEKVKALAERRRMIEAELNQQ |
| Ga0126371_108236642 | 3300021560 | Tropical Forest Soil | LLATLAEKVIAPAEVKVKALQERRREFEAELTKAQ |
| Ga0179589_103342681 | 3300024288 | Vadose Zone Soil | VLPVSRYEGLEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| Ga0207648_121890861 | 3300026089 | Miscanthus Rhizosphere | MFRDGGNPTQSLAMLAEKVIAPAEVKVKAPQERRRVIEAELAKPR |
| Ga0308194_102249492 | 3300031421 | Soil | VLPVYRYEGLEPLLATLAEKVIAPAEGKVKALHERRRMIEAE |
| Ga0318541_101773612 | 3300031545 | Soil | WVLPVYQYEGLEPLLATLAEKVIVPAEGKVRALEERRRTIEAELTKPQ |
| Ga0318541_106388831 | 3300031545 | Soil | VYRYEGIEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKAE |
| Ga0318515_103857932 | 3300031572 | Soil | VYRYEGLEPLLAALAEKVIAPAEGKVKALQERRRMIEAELIKPQ |
| Ga0310915_100364543 | 3300031573 | Soil | MFKDYWKYDWVLPVYQYEGLEPLLATLAEKVIVPAEGKVRALEERRRTIEAELTKPQ |
| Ga0310686_1010976004 | 3300031708 | Soil | EPLLATLAEKVIAPAEGKVQALAERRLMIEAELTKPQ |
| Ga0310686_1042894061 | 3300031708 | Soil | MFKDYWKYDWVLPVHRYEGLELLLTTLGESVIDPAEAKVNALAERRRLIEAVLIKPQ |
| Ga0318501_104304071 | 3300031736 | Soil | MFKDYWKYDWVLPVYQYEGLEPLLATLAEKVIVPAEGKVRALEERRRTIEAELTKPQKGI |
| Ga0307477_111594042 | 3300031753 | Hardwood Forest Soil | PLLAALAEKVIAPAEAKMKVLAEKRREFEAELIKAR |
| Ga0318547_110376761 | 3300031781 | Soil | IMIPIHFYEGLEPLLATLAEKVIAPAEGKVKALAERRLMIEAELTKPQ |
| Ga0318576_100439432 | 3300031796 | Soil | VLPVYRYEGLKALLATLAEKVIAPAEGKVRALEQRRRMIEAELTKPQ |
| Ga0318568_102470022 | 3300031819 | Soil | RYEGLEPLLATLAEKVIAPAEGKVKVLQERRRMIEAELTKPQ |
| Ga0310917_100796254 | 3300031833 | Soil | LLATLEENVIAPAEGKAKALEERRRMFEAELTKPQ |
| Ga0318512_101041894 | 3300031846 | Soil | GIEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPR |
| Ga0306919_112139241 | 3300031879 | Soil | VLPVYRYEGLEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKPQ |
| Ga0318544_102274232 | 3300031880 | Soil | MFKDFDPQDFHWVLPVYRYKEPEQLLATLAENVISPAEGKAKALEERRRRFETELTKPQ |
| Ga0306925_115573631 | 3300031890 | Soil | DWVLPVYRYEGIEPLLATLAEKVIAPAEGKVKALEERRRMIEAELTKAE |
| Ga0306921_1000994415 | 3300031912 | Soil | WVLPPYRYEGLQLLLGTLVEKVIAPAEAKVKALEERRRAIEAKLTALRA |
| Ga0306921_109444092 | 3300031912 | Soil | MVSAFAGVYRYEGLEPLLATLAEKVIAPAEGKVKALAERRRMIEAELTKPQ |
| Ga0310916_111370172 | 3300031942 | Soil | WVLPVYRYEGLEPLLAALSKKVIAPAERKVKALEKRRRIIEAKLTKPQ |
| Ga0310913_103277572 | 3300031945 | Soil | MFKDYWKYDWVLPVYQYEGLEPLLATLAEKVIVPAEGKVRALEERRRTI |
| Ga0310913_104556221 | 3300031945 | Soil | MWTFVFFSAGFPQDFHWVLPVYRYKEPEQLLATLTEDVIASAEGKAKALEERRRIFEAELTKPQ |
| Ga0310909_104513021 | 3300031947 | Soil | GLKPLLLTLAEKVIAPAEAKVTALEERRRAIEAELTTPRISP |
| Ga0310909_114253431 | 3300031947 | Soil | PHRYEGLETLLTSIAENVIAPAEAKVNALQERRRLIEAELVKPR |
| Ga0306926_105272193 | 3300031954 | Soil | KDYWKYDWVLPPYRYEGLQLLLATLVEKVIAPAEAKVKALEESRRAIEAELTAPRA |
| Ga0306922_116924802 | 3300032001 | Soil | LLAAVAEKVIAPAERKVNALQERRRMIEAELTKPQ |
| Ga0310906_104352242 | 3300032013 | Soil | VYRYEGLEPLLATFAEKVIAPAEGKVRALEERRRAHDLC |
| Ga0318507_104534771 | 3300032025 | Soil | YEALEPLLATLAERVIAPAEAKVKALEERRRMIEAELTKTSP |
| Ga0310911_108579111 | 3300032035 | Soil | LLATLAEKVIAPAEGKVRALEQRRRMIEAELTKPQ |
| Ga0318506_104002232 | 3300032052 | Soil | MFKDYWKYDWVLPVYRYEGLEPLLATLAENVIAPAEGKVKALEERRCVIEAELTKPQ |
| Ga0318575_105656631 | 3300032055 | Soil | SLLTTLAENVIAPAEAKVRALQERQRMIEAQLTKPQ |
| Ga0318533_106424973 | 3300032059 | Soil | FKDFDPQDFHWVLPVYKYKKPKQLLATLAEYVIAPAERKVKALEERRCMIEAQLRTQ |
| Ga0318505_104208111 | 3300032060 | Soil | RFEGLEPLLATLAEKVIAPAEGKVKALAERRCMIEAELTKPQ |
| Ga0306924_116287461 | 3300032076 | Soil | GLEPLLAALAEKVIAPAEGKVKALEQRRRMIEAELIKPQ |
| Ga0306924_125929381 | 3300032076 | Soil | HLLATLAEKVIAPAEAKVKALEESRRAIEAELTAPRS |
| Ga0306924_126432912 | 3300032076 | Soil | LPPHWYEGLDSLLTTIAENVIAPAEAKVNALQGRRMIEAELTKPR |
| Ga0306920_1008381862 | 3300032261 | Soil | LLATLAEKVIAPAEGKVKALEKRRRMIEAELTKPQ |
| Ga0306920_1021293602 | 3300032261 | Soil | RYEGLQLLLATLAEKVIAPAEAKVKTLEESRRAFEAELTAPRS |
| Ga0310914_101552554 | 3300033289 | Soil | ALLAAVAEKVIAPAERKVNALQERRRMIEAELTKPQ |
| ⦗Top⦘ |