


| Basic Information | |
|---|---|
| Family ID | F047236 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPVEGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARES |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.33 % |
| % of genes near scaffold ends (potentially truncated) | 94.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 6.67 |
| PF10908 | DUF2778 | 2.00 |
| PF04392 | ABC_sub_bind | 1.33 |
| PF02371 | Transposase_20 | 1.33 |
| PF01548 | DEDD_Tnp_IS110 | 1.33 |
| PF01614 | IclR | 0.67 |
| PF00078 | RVT_1 | 0.67 |
| PF13801 | Metal_resist | 0.67 |
| PF05598 | DUF772 | 0.67 |
| PF05443 | ROS_MUCR | 0.67 |
| PF13602 | ADH_zinc_N_2 | 0.67 |
| PF07045 | DUF1330 | 0.67 |
| PF01609 | DDE_Tnp_1 | 0.67 |
| PF13385 | Laminin_G_3 | 0.67 |
| PF12746 | GNAT_acetyltran | 0.67 |
| PF00589 | Phage_integrase | 0.67 |
| PF00296 | Bac_luciferase | 0.67 |
| PF13649 | Methyltransf_25 | 0.67 |
| PF02518 | HATPase_c | 0.67 |
| PF05711 | TylF | 0.67 |
| PF16197 | KAsynt_C_assoc | 0.67 |
| PF13185 | GAF_2 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.67 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.33 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.67 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.67 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.00 % |
| Unclassified | root | N/A | 8.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002IOMBE | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300000890|JGI11643J12802_11249686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300001593|JGI12635J15846_10428657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300001870|JGI24129J20441_1019087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 1928 | Open in IMG/M |
| 3300002568|C688J35102_118290249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300002568|C688J35102_118319026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300003219|JGI26341J46601_10158464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 629 | Open in IMG/M |
| 3300003220|JGI26342J46808_1021856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. 9U | 621 | Open in IMG/M |
| 3300003669|LSCM4E_1081892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 518 | Open in IMG/M |
| 3300004016|Ga0058689_10166067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300004602|Ga0068960_1270905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 515 | Open in IMG/M |
| 3300004605|Ga0068952_1320275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1026 | Open in IMG/M |
| 3300004633|Ga0066395_10556625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 667 | Open in IMG/M |
| 3300005163|Ga0066823_10070174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OR444 | 670 | Open in IMG/M |
| 3300005168|Ga0066809_10167451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 578 | Open in IMG/M |
| 3300005332|Ga0066388_104403313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 717 | Open in IMG/M |
| 3300005332|Ga0066388_108519692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 510 | Open in IMG/M |
| 3300005440|Ga0070705_101254861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300005441|Ga0070700_101562786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300005445|Ga0070708_102054497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 529 | Open in IMG/M |
| 3300005829|Ga0074479_10513718 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 540 | Open in IMG/M |
| 3300005938|Ga0066795_10213153 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005947|Ga0066794_10241935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 541 | Open in IMG/M |
| 3300006050|Ga0075028_100212583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300006050|Ga0075028_100815533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 569 | Open in IMG/M |
| 3300006052|Ga0075029_100492011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 808 | Open in IMG/M |
| 3300006057|Ga0075026_100426261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300006086|Ga0075019_11105385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 514 | Open in IMG/M |
| 3300006102|Ga0075015_100570360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300006175|Ga0070712_100103512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2111 | Open in IMG/M |
| 3300006572|Ga0074051_10011467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 714 | Open in IMG/M |
| 3300006638|Ga0075522_10554327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300006806|Ga0079220_12008809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 516 | Open in IMG/M |
| 3300006893|Ga0073928_10560188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OR444 | 812 | Open in IMG/M |
| 3300006893|Ga0073928_11100303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 538 | Open in IMG/M |
| 3300007982|Ga0102924_1232627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300009030|Ga0114950_10732174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 782 | Open in IMG/M |
| 3300009038|Ga0099829_10477676 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300009088|Ga0099830_10518868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
| 3300009521|Ga0116222_1446242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300009553|Ga0105249_11752774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300009610|Ga0105340_1504788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 541 | Open in IMG/M |
| 3300009672|Ga0116215_1472519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300010043|Ga0126380_10862498 | Not Available | 748 | Open in IMG/M |
| 3300010366|Ga0126379_10176607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2025 | Open in IMG/M |
| 3300010379|Ga0136449_100111313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 5556 | Open in IMG/M |
| 3300010379|Ga0136449_103218698 | Not Available | 630 | Open in IMG/M |
| 3300010379|Ga0136449_103418870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 607 | Open in IMG/M |
| 3300010379|Ga0136449_104424201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 518 | Open in IMG/M |
| 3300010430|Ga0118733_108734625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 523 | Open in IMG/M |
| 3300011057|Ga0138544_1011330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300011075|Ga0138555_1035217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 550 | Open in IMG/M |
| 3300011082|Ga0138526_1122194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300012206|Ga0137380_11674107 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012207|Ga0137381_10229728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1610 | Open in IMG/M |
| 3300012675|Ga0137337_1008256 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300012683|Ga0137398_10566081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 784 | Open in IMG/M |
| 3300012943|Ga0164241_10923278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300013102|Ga0157371_11248866 | Not Available | 574 | Open in IMG/M |
| 3300014320|Ga0075342_1136218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300014502|Ga0182021_12351449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 641 | Open in IMG/M |
| 3300014838|Ga0182030_11164307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 662 | Open in IMG/M |
| 3300015265|Ga0182005_1152878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300016270|Ga0182036_10195198 | Not Available | 1480 | Open in IMG/M |
| 3300016371|Ga0182034_10211741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 1506 | Open in IMG/M |
| 3300016387|Ga0182040_10064425 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300016404|Ga0182037_11830461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300017924|Ga0187820_1298948 | Not Available | 529 | Open in IMG/M |
| 3300018067|Ga0184611_1020380 | Not Available | 2036 | Open in IMG/M |
| 3300019879|Ga0193723_1189463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 521 | Open in IMG/M |
| 3300020581|Ga0210399_10775052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300021402|Ga0210385_10756586 | Not Available | 744 | Open in IMG/M |
| 3300021405|Ga0210387_11815029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 513 | Open in IMG/M |
| 3300021474|Ga0210390_11274188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 590 | Open in IMG/M |
| 3300021479|Ga0210410_10247552 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300022213|Ga0224500_10065343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
| 3300022506|Ga0242648_1060617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 595 | Open in IMG/M |
| 3300022528|Ga0242669_1002162 | Not Available | 1945 | Open in IMG/M |
| 3300023274|Ga0247763_1178044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10146297 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300025473|Ga0208190_1073037 | Not Available | 692 | Open in IMG/M |
| 3300025479|Ga0208588_1036148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1020 | Open in IMG/M |
| 3300025500|Ga0208686_1105346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300025854|Ga0209176_10145944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300025919|Ga0207657_10963360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300025923|Ga0207681_11553843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300025929|Ga0207664_11669999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300025932|Ga0207690_10926512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300025935|Ga0207709_10051979 | Not Available | 2514 | Open in IMG/M |
| 3300026475|Ga0257147_1053560 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027108|Ga0207946_108042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300027680|Ga0207826_1145486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300027846|Ga0209180_10767677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 519 | Open in IMG/M |
| 3300027862|Ga0209701_10565830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 608 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10096097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1446 | Open in IMG/M |
| 3300027935|Ga0209870_107050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 574 | Open in IMG/M |
| 3300028020|Ga0265351_1005066 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300028600|Ga0265303_10994020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300028809|Ga0247824_10577404 | Not Available | 673 | Open in IMG/M |
| 3300030494|Ga0310037_10113840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
| 3300030494|Ga0310037_10437569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 537 | Open in IMG/M |
| 3300030622|Ga0265391_10136889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica → Dechloromonas aromatica RCB | 675 | Open in IMG/M |
| 3300030659|Ga0316363_10067904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1645 | Open in IMG/M |
| 3300030969|Ga0075394_10120482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 527 | Open in IMG/M |
| 3300031114|Ga0308187_10412443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 536 | Open in IMG/M |
| 3300031122|Ga0170822_16933899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 503 | Open in IMG/M |
| 3300031446|Ga0170820_14312390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
| 3300031543|Ga0318516_10061721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2063 | Open in IMG/M |
| 3300031544|Ga0318534_10620429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 614 | Open in IMG/M |
| 3300031545|Ga0318541_10423466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300031680|Ga0318574_10687064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300031708|Ga0310686_109053303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300031715|Ga0307476_11288542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 533 | Open in IMG/M |
| 3300031719|Ga0306917_10464975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
| 3300031724|Ga0318500_10013109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2974 | Open in IMG/M |
| 3300031726|Ga0302321_102118987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300031726|Ga0302321_102876773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300031744|Ga0306918_10923096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 679 | Open in IMG/M |
| 3300031747|Ga0318502_10810822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300031770|Ga0318521_10707896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 611 | Open in IMG/M |
| 3300031781|Ga0318547_11080149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 502 | Open in IMG/M |
| 3300031794|Ga0318503_10183641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300031805|Ga0318497_10408449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 760 | Open in IMG/M |
| 3300031831|Ga0318564_10104469 | Not Available | 1259 | Open in IMG/M |
| 3300031846|Ga0318512_10579599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 571 | Open in IMG/M |
| 3300031890|Ga0306925_10776074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
| 3300031890|Ga0306925_12128516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 524 | Open in IMG/M |
| 3300031893|Ga0318536_10506758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 606 | Open in IMG/M |
| 3300031893|Ga0318536_10601113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 550 | Open in IMG/M |
| 3300031910|Ga0306923_10329333 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
| 3300031942|Ga0310916_10808878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 789 | Open in IMG/M |
| 3300031945|Ga0310913_10545325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 823 | Open in IMG/M |
| 3300031947|Ga0310909_10277841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1401 | Open in IMG/M |
| 3300031947|Ga0310909_11254946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 597 | Open in IMG/M |
| 3300031947|Ga0310909_11580067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 520 | Open in IMG/M |
| 3300031981|Ga0318531_10500136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 550 | Open in IMG/M |
| 3300032035|Ga0310911_10711229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 582 | Open in IMG/M |
| 3300032174|Ga0307470_10854086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300032180|Ga0307471_103142240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
| 3300032205|Ga0307472_102032988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300032261|Ga0306920_100192702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3042 | Open in IMG/M |
| 3300032261|Ga0306920_101928887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 829 | Open in IMG/M |
| 3300032897|Ga0335071_11519979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
| 3300032954|Ga0335083_11059083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300033289|Ga0310914_11848084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300033417|Ga0214471_11395622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 527 | Open in IMG/M |
| 3300033550|Ga0247829_11465198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 564 | Open in IMG/M |
| 3300033755|Ga0371489_0025085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4640 | Open in IMG/M |
| 3300034236|Ga0334938_070475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300034818|Ga0373950_0154190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Acidithiobacillaceae → Acidithiobacillus → unclassified Acidithiobacillus → Acidithiobacillus sp. MC6.1 | 527 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.33% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.33% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.33% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.33% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.67% |
| Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 0.67% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.67% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.67% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.67% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.67% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.67% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.67% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.67% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.67% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.67% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.67% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.67% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300003669 | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3) | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004602 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023274 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025479 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300027108 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027935 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030622 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300034236 | Biocrust microbial communities from Mojave Desert, California, United States - 34SMC | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_04068410 | 2170459003 | Grass Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDGVARG |
| JGI11643J12802_112496861 | 3300000890 | Soil | MPVEERGLSSRLTQDVVRDLEIGQPSNSEECSETADGVARESEGR |
| JGI12635J15846_104286572 | 3300001593 | Forest Soil | MPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGVARESEGVKSCPR |
| JGI24129J20441_10190871 | 3300001870 | Arctic Peat Soil | VEGRDLSSRQTQYVVKDLEIGQPINSDECSETAEGV* |
| C688J35102_1182902491 | 3300002568 | Soil | RVMPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGVARES* |
| C688J35102_1183190262 | 3300002568 | Soil | RGSRVTPVEGRDLSSRQTQDVARDQEIGSPINSEERPEAADGVARES* |
| JGI26341J46601_101584641 | 3300003219 | Bog Forest Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETADGVARES |
| JGI26342J46808_10218561 | 3300003220 | Bog Forest Soil | MPGEGRDLSSRQTQDVARDLEIGQPINSEQRSETADGVARESEGRTRL |
| LSCM4E_10818922 | 3300003669 | Coalbed Water | MPVEGRGLSSRPTQHASKDLEIGQPINSDKSSETTDGVTRKSEG |
| Ga0058689_101660671 | 3300004016 | Agave | MPVEGRDLSSRRTQYVVRDLEIGQPINSEECSETADGVARESEGRSRLSVL |
| Ga0068960_12709051 | 3300004602 | Peatlands Soil | VEGRGLSSRQTQDVVRDLEIGQPINSDECSETADGVARESEGRS |
| Ga0068952_13202752 | 3300004605 | Peatlands Soil | MPVEGRDLSSRQTQYVVKDLEIGQPINSKECSETADGVACESKA* |
| Ga0066395_105566251 | 3300004633 | Tropical Forest Soil | MPVEGRGLSSRPTQDVVRDLEIGQPSNSEKRSETADGVTRES |
| Ga0066823_100701742 | 3300005163 | Soil | VEGRDLSSRQTQYVVKDMEIGQPINSKECSETTDGVARESKA* |
| Ga0066809_101674511 | 3300005168 | Soil | MPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETAEGVARESEGRSR |
| Ga0066388_1044033131 | 3300005332 | Tropical Forest Soil | MPVEGRGLGSRRTQHAVKDLEIGQPSNSEQCSETADGVTRESEGRTG |
| Ga0066388_1085196922 | 3300005332 | Tropical Forest Soil | MPVEGRGLSSRRTQDVVRDLGIGQPINSEECSETADGVARESEG |
| Ga0070705_1012548611 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVEGRDLSSRRTQYVVRDLEIGQPINSEECSETADGVARESEGRSR |
| Ga0070700_1015627862 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAEGRGLSSRQTQDVVRDLGIGQPSNPEKCSETADGVTRES |
| Ga0070708_1020544971 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVEGRDLSSRPTQYVVRDLEIGQPINSDQCSETADGVARESEGRSRL |
| Ga0074479_105137182 | 3300005829 | Sediment (Intertidal) | MEGRNLSSRQTQDVVRDLEIGQPINSEKCSEAAEGVTRESEG |
| Ga0066795_102131532 | 3300005938 | Soil | EGRDLSSRQTQYVVKDLEIGQPINSDECSETAEGV* |
| Ga0066794_102419351 | 3300005947 | Soil | VEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGVARE |
| Ga0075028_1002125832 | 3300006050 | Watersheds | MPGEGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARE |
| Ga0075028_1008155331 | 3300006050 | Watersheds | MPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETADGVTRESEG |
| Ga0075029_1004920111 | 3300006052 | Watersheds | MPVEGRDLSSRQTHYVVKDMEIGQPINSEKCSETADGVARKKTNA* |
| Ga0075026_1004262611 | 3300006057 | Watersheds | VMPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDRVARESKA* |
| Ga0075019_111053851 | 3300006086 | Watersheds | GRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARES* |
| Ga0075015_1005703602 | 3300006102 | Watersheds | MPVEGRDLSSRQTQYVVKDMEIGQPINSKKCSETADGVARE |
| Ga0070712_1001035122 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETTDGVARESEA* |
| Ga0074051_100114672 | 3300006572 | Soil | MPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETAEGVARESE |
| Ga0075522_105543272 | 3300006638 | Arctic Peat Soil | MPAEGRDLSSRRTQYVVRDLEIGQPINSEECSETADGVARES |
| Ga0079220_120088091 | 3300006806 | Agricultural Soil | MPVEGRGLSSRQTQDAVRDLEIGQPSNSEKCSETADGVTRESEGGGRL |
| Ga0073928_105601881 | 3300006893 | Iron-Sulfur Acid Spring | RQTQYVVKDMEIGQPINSEECSETTDGVARESKA* |
| Ga0073928_111003032 | 3300006893 | Iron-Sulfur Acid Spring | MPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETAD |
| Ga0102924_12326271 | 3300007982 | Iron-Sulfur Acid Spring | MPAEGRDLSSRQTKYVVKDLEIGQPINSAECSETADGVARASKGVK |
| Ga0114950_107321742 | 3300009030 | Deep Subsurface | MPVEGRGLGSRQMDNVVRDVEIGQPINSEECSETT |
| Ga0099829_104776764 | 3300009038 | Vadose Zone Soil | DLSSRQTQYVVKDLEIGQPINSEECSEAADGVARAGGFPFEA* |
| Ga0099830_105188682 | 3300009088 | Vadose Zone Soil | MPVEARDLSSRQTQYVVKDLEIGQPINSEECSEAADGVARAGGFPFEA* |
| Ga0116222_14462421 | 3300009521 | Peatlands Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDGVARES |
| Ga0105249_117527742 | 3300009553 | Switchgrass Rhizosphere | MPVEERDLSSRQTQDVVRDLEIGQPINSEECSETADG |
| Ga0105340_15047881 | 3300009610 | Soil | VEGRDLSSRRTQHVVKDLEIGQPINSDECSETADGVARES |
| Ga0116215_14725191 | 3300009672 | Peatlands Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETAD |
| Ga0126380_108624982 | 3300010043 | Tropical Forest Soil | VEGRDLSSRRTQDVVRDLEIGQPINSEECSETADGVARESEGRSR |
| Ga0126379_101766072 | 3300010366 | Tropical Forest Soil | MPVEGRDLSSRLTQDGVRDLEIGRPSNSEKCSETADGVTRESEGRSRLSLLR |
| Ga0136449_1001113137 | 3300010379 | Peatlands Soil | MPVEGRDLSSRQTHYAAKNLEIGQPINSDWCSAAADGVARDS* |
| Ga0136449_1032186981 | 3300010379 | Peatlands Soil | MLGVAAAARGLSSGQTQDVVKDLEIGQPINSGQRSETADGVARESE |
| Ga0136449_1034188702 | 3300010379 | Peatlands Soil | SRQTQYVVKDMEIGQPINSEECSETTDGVARESKA* |
| Ga0136449_1044242011 | 3300010379 | Peatlands Soil | MPVEGRDLSSRQTQDAVRDLEIGQPINSEQCSETADGVARESEGRSR |
| Ga0118733_1087346252 | 3300010430 | Marine Sediment | MPVEGRNLSSRQTHDVVRDREIGQPINSKICSEAAEGVARESEG |
| Ga0138544_10113301 | 3300011057 | Peatlands Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETTDG |
| Ga0138555_10352171 | 3300011075 | Peatlands Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSEECSETADGVARESKG |
| Ga0138526_11221942 | 3300011082 | Peatlands Soil | MPVEGRDLSSRQTRQAVRDLEIGQPINSEQCSEIAEGVARKSE |
| Ga0137380_116741071 | 3300012206 | Vadose Zone Soil | MPVEGRDLSSRQTKYVVKDLEIGQPINSAECSEAADGVTRES |
| Ga0137381_102297281 | 3300012207 | Vadose Zone Soil | VEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGVARESVK |
| Ga0137337_10082561 | 3300012675 | Soil | MEGRGLSSRQTHDVVRDLEIGQPINSDECSETDGVARESTRKRKGVK |
| Ga0137398_105660811 | 3300012683 | Vadose Zone Soil | MPGEGRGLSSRQTQQAVKDQEIGQPNNSKKCSEAADGVT |
| Ga0164241_109232781 | 3300012943 | Soil | MPVEERDLSSRQTQDVVRDLEIGQPINSEECSETADGVARES |
| Ga0157371_112488662 | 3300013102 | Corn Rhizosphere | MPVEGRSLSSRQTQEVARDPEIGQPINSRQSPEAAEGVARESEG |
| Ga0075342_11362181 | 3300014320 | Natural And Restored Wetlands | MLVEGRGLGSRQTQHVVRDVEIGQPINSDQCSETADGVTRESE |
| Ga0182021_123514492 | 3300014502 | Fen | MPVEGRDLSSGQTQYVAKDLEIGQPINSDECSETAEGVARE |
| Ga0182030_111643072 | 3300014838 | Bog | MPVEGRDLSSKKTQQVVRDLEIGQPINSENCSETAEG |
| Ga0182005_11528781 | 3300015265 | Rhizosphere | MPVEGRDLSSRQTQDVARDQEIGPPINSEQCPEAADGVARES |
| Ga0182036_101951982 | 3300016270 | Soil | MPGEGKGLSSRPTQDVVRDLEIGQPSNSEKCSETADGVTRESEG |
| Ga0182034_102117414 | 3300016371 | Soil | MPVEGRGLSSRPTQDAVRDLEIGRPSNSEKCSETADG |
| Ga0182040_100644251 | 3300016387 | Soil | VEGRDLSSRRTQDVVRDLEIGQPINSEERSEAADGVARESEGRS |
| Ga0182037_118304612 | 3300016404 | Soil | MPAEGRGLSSRLTQDVVRDLEIGQPSNSEKRSEAADG |
| Ga0187820_12989482 | 3300017924 | Freshwater Sediment | MPVEGRDLSSRQTQYVVRDLEIGQPINSEECSETADGVARES |
| Ga0184611_10203802 | 3300018067 | Groundwater Sediment | MPVEERGLSSRRTQQVAKDLEIGQPNNSEKCSEAADGVARESEGIA |
| Ga0193723_11894631 | 3300019879 | Soil | VEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGVARAICLS |
| Ga0210399_107750521 | 3300020581 | Soil | MPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETADG |
| Ga0210385_107565862 | 3300021402 | Soil | MPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETAD |
| Ga0210387_118150291 | 3300021405 | Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETADGV |
| Ga0210390_112741881 | 3300021474 | Soil | MPAEGRGLSSGQTQRRSEGQEIGQPSNSEKRSADGGIPQ |
| Ga0210410_102475522 | 3300021479 | Soil | MLVEGRDLSSRQTQYVVKDMEIGQPINSKKCSETADGVARESK |
| Ga0224500_100653431 | 3300022213 | Sediment | MPAEERGLSSRQTQEVERDEEIGQPSNSDECSESAE |
| Ga0242648_10606171 | 3300022506 | Soil | MPVEGRDLSSRQTHDAVRDLEIGQPINSEEGSETADGVTRESK |
| Ga0242669_10021621 | 3300022528 | Soil | MPVEGRGLSSRQTQDVVRDLEIGQPSNSETCSETADGVTRES |
| Ga0247763_11780441 | 3300023274 | Plant Litter | MPVEGRDLSSRQTQDVVRDLEIGQPINSDECSETAD |
| (restricted) Ga0255056_101462972 | 3300024521 | Seawater | PMHEVEKDQEIGQPINSEKAFETTGSETAKGIARKSEG |
| Ga0208190_10730372 | 3300025473 | Peatland | MLVEGRDLSSRQTQYVVKDLEIGQPINSKECSETADGV |
| Ga0208588_10361481 | 3300025479 | Arctic Peat Soil | MPVEGRGLSSRQTQQAMRDLEIGKPINSEKCSEIADGVARESE |
| Ga0208686_11053461 | 3300025500 | Peatland | MPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGIARESK |
| Ga0209176_101459441 | 3300025854 | Arctic Peat Soil | EGRDLSSRQTQYVVKDLEIGQPINSDECSETAEGV |
| Ga0207657_109633602 | 3300025919 | Corn Rhizosphere | MPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGVARES |
| Ga0207681_115538431 | 3300025923 | Switchgrass Rhizosphere | MPVEGRDLSSRRTQYVVRDLEIGQPINSEECSETAD |
| Ga0207664_116699991 | 3300025929 | Agricultural Soil | MPGEGRGLGSRQTQDVVRDLEIGQPSNSEKCSETAD |
| Ga0207690_109265122 | 3300025932 | Corn Rhizosphere | AEGRGLSSRQTQDVVRDLGIGQPSNPEKCSETADGVTRES |
| Ga0207709_100519794 | 3300025935 | Miscanthus Rhizosphere | MPVEERSLSSRRTQQVARDLEIGQPNNSEKCSEAAD |
| Ga0257147_10535601 | 3300026475 | Soil | NLSSRQTQYVVKDMEIGKPINSDKCSEAADGVARESVPTSLLNRCI |
| Ga0207946_1080421 | 3300027108 | Forest Soil | MPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETA |
| Ga0207826_11454861 | 3300027680 | Tropical Forest Soil | MPVEGRDLSSRQTQQVMRDLEIGQPINSEQGSEIADGVTRKSEG |
| Ga0209180_107676771 | 3300027846 | Vadose Zone Soil | MEGRGLSSRQTHDVVRDLEIGQPINSEECSETTEGVTRESEG |
| Ga0209701_105658301 | 3300027862 | Vadose Zone Soil | EGRDLSSRQTQYVVKDLEIGQPINSEECSEAADGVARAGGFPFEA |
| (restricted) Ga0255052_100960972 | 3300027865 | Seawater | MPVEGRGLGSRRTQEVEQDQEIGQPINSDKGSETTKS |
| Ga0209870_1070502 | 3300027935 | Groundwater Sand | MLVEGRGLGSRQTQHVVRDVEIGQPINSDQCSETADGV |
| Ga0265351_10050662 | 3300028020 | Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSKECSETTDGVAR |
| Ga0265303_109940202 | 3300028600 | Sediment | MPVEERDLSSRQMHEVEKDQEIGQPINSEKCSETAKGIARKSEG |
| Ga0247824_105774041 | 3300028809 | Soil | RNLSSRQTQYVVKDLEIGQPINSEECSETADGVARES |
| Ga0310037_101138401 | 3300030494 | Peatlands Soil | MPVEGRDLSSRRTHYVVRDLEIGQPINSEECSETTNGATLVSTLVTE |
| Ga0310037_104375691 | 3300030494 | Peatlands Soil | MPVEGRDLSSRQTQYVVKDMEIGQPINSKKCSETADGVARESKGVK |
| Ga0265391_101368891 | 3300030622 | Soil | MPVEGRDLSSRQTQYVVKDLEIGQPINSDECAETADGVARKSKGV |
| Ga0316363_100679041 | 3300030659 | Peatlands Soil | MPVEGRDLSSRQTHYVAKNLEIGQPINSAECSETADGVARKSKG |
| Ga0075394_101204821 | 3300030969 | Soil | MPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETADGVTRESEGGGRLSLLR |
| Ga0308187_104124431 | 3300031114 | Soil | MPVEGRDLSSRQTQYVVKDLEIGKPINSDKCSEAA |
| Ga0170822_169338991 | 3300031122 | Forest Soil | MPVEGRGLSSRQTQQPVRDREIGQPNNSETCSETADGV |
| Ga0170820_143123901 | 3300031446 | Forest Soil | MPVEGRSLSSGPTQHVVRDRRLGNLSNSDKRSETADGVPRAGVT |
| Ga0318516_100617212 | 3300031543 | Soil | MPGEGRDLSSRRTQDVVKDLEIGQPINSEKCSETAEGVARES |
| Ga0318534_106204291 | 3300031544 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETAGGV |
| Ga0318541_104234661 | 3300031545 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVAGESEGRSRV |
| Ga0318574_106870641 | 3300031680 | Soil | PGEGRGLSSRPTQDVVRDLEIGQPSNSEKRSDTAGGVTREKA |
| Ga0310686_1090533031 | 3300031708 | Soil | MKPVMPVEGRSLSSRLTQDVVRDLEIGQPSNSEECSKT |
| Ga0307476_112885421 | 3300031715 | Hardwood Forest Soil | VEGRDLSSRQTQYVVKDLEIGKPINSNKCPEAADG |
| Ga0306917_104649752 | 3300031719 | Soil | MPVEGRGLSSRPTQDAVRDLEIGQPSNSEKCSETADGVTRESEGG |
| Ga0318500_100131094 | 3300031724 | Soil | MPVEGRGLGSRQTQEVVRDLEIGQPINSEECSETADGV |
| Ga0302321_1021189871 | 3300031726 | Fen | MEGRDLSSRQTHDVVRDLEIGQPINSEKCSEAAEGVTRESEGRSRLSLLR |
| Ga0302321_1028767731 | 3300031726 | Fen | MPVEGRGLSSRQTQQAMRDLEIGQPINSEKCSEIADGVARESEGRSRLSILR |
| Ga0306918_109230961 | 3300031744 | Soil | MPGEGRGLSSRQTQEVVRDLEIGRPSNSEKCSETADGVTRESEGGSRL |
| Ga0318502_108108221 | 3300031747 | Soil | MPGEGRGLSSRPTQDAVRDLEIGRPSNSEKCSETA |
| Ga0318521_107078961 | 3300031770 | Soil | MPGEGRGLSSRQTQDVVRDLEIGQPSNSEKCSETADGV |
| Ga0318547_110801491 | 3300031781 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVAGESEGR |
| Ga0318503_101836412 | 3300031794 | Soil | MPVEGRDLSSRQTQDVAKDLEIGQPINSDECSETAEGVARKS |
| Ga0318497_104084492 | 3300031805 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVAG |
| Ga0318564_101044691 | 3300031831 | Soil | MKPGNAGEGRDLSSRQTQDVVKDLGIGQPINSGQCSE |
| Ga0318512_105795991 | 3300031846 | Soil | MPVEGRGLSSRPTQDVVRDLEIGQPSNSEKRSATAEGVTRERA |
| Ga0306925_107760742 | 3300031890 | Soil | MPGEGRGLSSRPTQDAVRDLEIGQPSNSEKCSATADGVTRD |
| Ga0306925_121285161 | 3300031890 | Soil | MPVEGRDLSSRQTQYVVTDPEIGQPINSNKCSETADGVARESKGVKSCP |
| Ga0318536_105067581 | 3300031893 | Soil | MPVEGRDLSSRQTHYVVTDPEIGQPINSNKCSEAADGVARE |
| Ga0318536_106011131 | 3300031893 | Soil | MLGEGRGLSSRPTQDVVRDLEIGQPSNSEKRSEAADGVTRESEGG |
| Ga0306923_103293331 | 3300031910 | Soil | MPVEGRGLSSRPTQDVVRDLEIGQPSNSEKCSDTADGERSVE |
| Ga0310916_108088783 | 3300031942 | Soil | MLVEGRGLSSRQTQQAVRDLEIGQPNNSKKCSEAADGVARE |
| Ga0310913_105453251 | 3300031945 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVARESEGRSRVSLLRP |
| Ga0310909_102778412 | 3300031947 | Soil | MPGEGRDLSSRRTQDVVRDLEIGQPNNSEKCSETAE |
| Ga0310909_112549461 | 3300031947 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVARES |
| Ga0310909_115800671 | 3300031947 | Soil | MPVEGRDLSSRQTQYVVTDPEIGQPINSNKCSETADGVARESKGVKSC |
| Ga0318531_105001361 | 3300031981 | Soil | MPVEGRGLSSRPTQDAVRDLEIGQPSNSEKCSEAADGVTRESEGGSRLS |
| Ga0310911_107112291 | 3300032035 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETAGGVARE |
| Ga0307470_108540861 | 3300032174 | Hardwood Forest Soil | MPVEGRDLSSRQTQYVVKDLEIGQPINSEECSETADGV |
| Ga0307471_1031422401 | 3300032180 | Hardwood Forest Soil | VEGRDLSSRQTQYVVKDLEIGKPINSNKCSEAADGAARESVT |
| Ga0307472_1020329881 | 3300032205 | Hardwood Forest Soil | MPVEGRGLSSRQTQDVVRDLEIGQPNNSEKCSETADG |
| Ga0306920_1001927023 | 3300032261 | Soil | MPVEGRDLSSRQTQDVAKDLEIGQPINSDECSETAEGVARKSKA |
| Ga0306920_1019288872 | 3300032261 | Soil | MPAEGRDLSSRQTQDVVRDLEIGQPINSEECSETTGGVA |
| Ga0335071_115199791 | 3300032897 | Soil | MPVEERDLSSRRTQDVVRDLEIGQPINSEECSETADG |
| Ga0335083_110590831 | 3300032954 | Soil | MPVEGRDLSSRRTQYVARDQEIGQPINSDQCSEAADGVARE |
| Ga0310914_118480841 | 3300033289 | Soil | MPGEGRGLSSRPTQDAVRDLEIGQPSNSEKCSETADGVTRESEGG |
| Ga0214471_113956221 | 3300033417 | Soil | MEGRGLSSRQTHDVVRDLEIGQPINSEECSETTEGGYT |
| Ga0247829_114651981 | 3300033550 | Soil | MPAEGRGLSSRQTQDVVRDLGIGQPSNPEKCSETADGV |
| Ga0371489_0025085_4340_4477 | 3300033755 | Peat Soil | MPAEGRDLSSRLTQDVAKDMEIGKPINSGKRSEAAEGVARERRMA |
| Ga0334938_070475_3_128 | 3300034236 | Biocrust | MPVEGRSLSSRQTQDAVRDLEIGQPINSEECSETAKGVARES |
| Ga0373950_0154190_2_127 | 3300034818 | Rhizosphere Soil | MEGRGLSSGQTQDVVRDREIGQPNNSETCSEAADGVARESEG |
| ⦗Top⦘ |