


| Basic Information | |
|---|---|
| Family ID | F047179 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MRNCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELAD |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.52 % |
| % of genes near scaffold ends (potentially truncated) | 25.33 % |
| % of genes from short scaffolds (< 2000 bps) | 85.33 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.16% β-sheet: 0.00% Coil/Unstructured: 55.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF02525 | Flavodoxin_2 | 51.33 |
| PF01926 | MMR_HSR1 | 15.33 |
| PF04241 | DUF423 | 9.33 |
| PF00440 | TetR_N | 4.67 |
| PF02096 | 60KD_IMP | 1.33 |
| PF00696 | AA_kinase | 1.33 |
| PF03401 | TctC | 0.67 |
| PF13458 | Peripla_BP_6 | 0.67 |
| PF00009 | GTP_EFTU | 0.67 |
| PF13274 | DUF4065 | 0.67 |
| PF01047 | MarR | 0.67 |
| PF13282 | DUF4070 | 0.67 |
| PF13801 | Metal_resist | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 9.33 |
| COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 1.33 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.00 % |
| Unclassified | root | N/A | 24.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_118071946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300001686|C688J18823_10034909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3453 | Open in IMG/M |
| 3300003162|Ga0006778J45830_1026242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 994 | Open in IMG/M |
| 3300003203|JGI25406J46586_10006445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5402 | Open in IMG/M |
| 3300003319|soilL2_10183801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1480 | Open in IMG/M |
| 3300003321|soilH1_10124745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2587 | Open in IMG/M |
| 3300003579|Ga0007429J51699_1041146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 899 | Open in IMG/M |
| 3300004157|Ga0062590_100857636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300004157|Ga0062590_101193054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 741 | Open in IMG/M |
| 3300004157|Ga0062590_101960615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 606 | Open in IMG/M |
| 3300004643|Ga0062591_101299673 | Not Available | 715 | Open in IMG/M |
| 3300005184|Ga0066671_10012932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3437 | Open in IMG/M |
| 3300005328|Ga0070676_10172135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1402 | Open in IMG/M |
| 3300005329|Ga0070683_100098895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2746 | Open in IMG/M |
| 3300005330|Ga0070690_100962608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
| 3300005456|Ga0070678_102183670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300005458|Ga0070681_11349338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 636 | Open in IMG/M |
| 3300005466|Ga0070685_10079136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1966 | Open in IMG/M |
| 3300005466|Ga0070685_11293660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300005529|Ga0070741_10344663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1384 | Open in IMG/M |
| 3300005539|Ga0068853_100109425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2452 | Open in IMG/M |
| 3300005543|Ga0070672_101101007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300005543|Ga0070672_101610465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 583 | Open in IMG/M |
| 3300005548|Ga0070665_101371831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
| 3300005548|Ga0070665_101435912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300005764|Ga0066903_103226222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 882 | Open in IMG/M |
| 3300005841|Ga0068863_102293544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 549 | Open in IMG/M |
| 3300005844|Ga0068862_100262673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1576 | Open in IMG/M |
| 3300005844|Ga0068862_101200547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 757 | Open in IMG/M |
| 3300005985|Ga0081539_10005288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13297 | Open in IMG/M |
| 3300006048|Ga0075363_100007606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4992 | Open in IMG/M |
| 3300006177|Ga0075362_10050420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1861 | Open in IMG/M |
| 3300006237|Ga0097621_101847012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 576 | Open in IMG/M |
| 3300006804|Ga0079221_10608024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 739 | Open in IMG/M |
| 3300006806|Ga0079220_10237150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1081 | Open in IMG/M |
| 3300009087|Ga0105107_10283759 | Not Available | 1155 | Open in IMG/M |
| 3300009093|Ga0105240_12645342 | Not Available | 518 | Open in IMG/M |
| 3300009143|Ga0099792_10342731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 899 | Open in IMG/M |
| 3300009143|Ga0099792_10682282 | Not Available | 663 | Open in IMG/M |
| 3300009148|Ga0105243_11550547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 688 | Open in IMG/M |
| 3300009156|Ga0111538_10325440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1946 | Open in IMG/M |
| 3300009174|Ga0105241_10906564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300009176|Ga0105242_11425465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 721 | Open in IMG/M |
| 3300009551|Ga0105238_10436425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1305 | Open in IMG/M |
| 3300010046|Ga0126384_10981586 | Not Available | 768 | Open in IMG/M |
| 3300010166|Ga0126306_11465361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
| 3300010399|Ga0134127_12190923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. G22 | 632 | Open in IMG/M |
| 3300010400|Ga0134122_11058108 | Not Available | 800 | Open in IMG/M |
| 3300010400|Ga0134122_11850354 | Not Available | 637 | Open in IMG/M |
| 3300010403|Ga0134123_10850432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300010854|Ga0126360_1085822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300010857|Ga0126354_1019736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300010857|Ga0126354_1029666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2931 | Open in IMG/M |
| 3300010857|Ga0126354_1052576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300010857|Ga0126354_1241332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1104 | Open in IMG/M |
| 3300010861|Ga0126349_1015971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 781 | Open in IMG/M |
| 3300010862|Ga0126348_1045990 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010862|Ga0126348_1233545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1388 | Open in IMG/M |
| 3300010862|Ga0126348_1306171 | Not Available | 664 | Open in IMG/M |
| 3300011443|Ga0137457_1339479 | Not Available | 512 | Open in IMG/M |
| 3300012203|Ga0137399_10415346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1123 | Open in IMG/M |
| 3300012212|Ga0150985_105519993 | Not Available | 581 | Open in IMG/M |
| 3300012212|Ga0150985_107784927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1026 | Open in IMG/M |
| 3300012212|Ga0150985_109782203 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012469|Ga0150984_103719959 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012469|Ga0150984_107108193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300012469|Ga0150984_110622152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1462 | Open in IMG/M |
| 3300012469|Ga0150984_114568053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300012469|Ga0150984_123547248 | Not Available | 524 | Open in IMG/M |
| 3300012683|Ga0137398_10173118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1412 | Open in IMG/M |
| 3300012893|Ga0157284_10026677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1171 | Open in IMG/M |
| 3300012898|Ga0157293_10027648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
| 3300012899|Ga0157299_10245957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 564 | Open in IMG/M |
| 3300012911|Ga0157301_10278728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300012924|Ga0137413_11828109 | Not Available | 502 | Open in IMG/M |
| 3300012929|Ga0137404_11925335 | Not Available | 551 | Open in IMG/M |
| 3300012930|Ga0137407_10945241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 816 | Open in IMG/M |
| 3300012986|Ga0164304_11670294 | Not Available | 532 | Open in IMG/M |
| 3300013308|Ga0157375_11938400 | Not Available | 700 | Open in IMG/M |
| 3300014326|Ga0157380_10581109 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1105 | Open in IMG/M |
| 3300015069|Ga0167633_100276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 23241 | Open in IMG/M |
| 3300015242|Ga0137412_10031163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4353 | Open in IMG/M |
| 3300015258|Ga0180093_1167636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300015264|Ga0137403_10741402 | Not Available | 841 | Open in IMG/M |
| 3300015264|Ga0137403_10834390 | Not Available | 775 | Open in IMG/M |
| 3300015264|Ga0137403_11156366 | Not Available | 620 | Open in IMG/M |
| 3300017972|Ga0187781_10083540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2207 | Open in IMG/M |
| 3300017975|Ga0187782_10596235 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 849 | Open in IMG/M |
| 3300018072|Ga0184635_10061256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1461 | Open in IMG/M |
| 3300018429|Ga0190272_12181554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300018429|Ga0190272_12785148 | Not Available | 539 | Open in IMG/M |
| 3300018469|Ga0190270_11356726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300018469|Ga0190270_12123625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300018476|Ga0190274_10999622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 911 | Open in IMG/M |
| 3300018476|Ga0190274_13714833 | Not Available | 516 | Open in IMG/M |
| 3300018476|Ga0190274_13810287 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018481|Ga0190271_10360540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1537 | Open in IMG/M |
| 3300019212|Ga0180106_1132453 | Not Available | 504 | Open in IMG/M |
| 3300019232|Ga0180114_1280618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 736 | Open in IMG/M |
| 3300019254|Ga0184641_1045665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1088 | Open in IMG/M |
| 3300019254|Ga0184641_1459558 | Not Available | 563 | Open in IMG/M |
| 3300019255|Ga0184643_1120191 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300019255|Ga0184643_1210179 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300019255|Ga0184643_1253720 | Not Available | 513 | Open in IMG/M |
| 3300019263|Ga0184647_1332890 | Not Available | 618 | Open in IMG/M |
| 3300019279|Ga0184642_1508762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
| 3300019362|Ga0173479_10140933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300020065|Ga0180113_1024959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
| 3300021362|Ga0213882_10078914 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1322 | Open in IMG/M |
| 3300021951|Ga0222624_1343727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300021951|Ga0222624_1616869 | Not Available | 564 | Open in IMG/M |
| 3300022756|Ga0222622_10764907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| 3300025900|Ga0207710_10037583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2139 | Open in IMG/M |
| 3300025901|Ga0207688_10414013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 837 | Open in IMG/M |
| 3300025913|Ga0207695_10674972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. ORS 3324 | 914 | Open in IMG/M |
| 3300025924|Ga0207694_10654116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 885 | Open in IMG/M |
| 3300025936|Ga0207670_10315731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1228 | Open in IMG/M |
| 3300025941|Ga0207711_11173769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 709 | Open in IMG/M |
| 3300025942|Ga0207689_11150949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300026095|Ga0207676_10056702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3081 | Open in IMG/M |
| 3300026095|Ga0207676_10352952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1360 | Open in IMG/M |
| 3300026312|Ga0209153_1010024 | All Organisms → cellular organisms → Bacteria | 2970 | Open in IMG/M |
| 3300026557|Ga0179587_10485743 | Not Available | 810 | Open in IMG/M |
| 3300027818|Ga0209706_10162942 | Not Available | 1093 | Open in IMG/M |
| 3300027903|Ga0209488_10743714 | Not Available | 699 | Open in IMG/M |
| 3300027979|Ga0209705_10198631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1054 | Open in IMG/M |
| 3300028379|Ga0268266_10801674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 910 | Open in IMG/M |
| 3300028379|Ga0268266_11058769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 785 | Open in IMG/M |
| 3300028577|Ga0265318_10102377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
| 3300028802|Ga0307503_10926007 | Not Available | 506 | Open in IMG/M |
| 3300030975|Ga0099845_1004264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1278 | Open in IMG/M |
| 3300030975|Ga0099845_1023019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1100 | Open in IMG/M |
| 3300030975|Ga0099845_1052399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1147 | Open in IMG/M |
| 3300031152|Ga0307501_10268786 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031250|Ga0265331_10242740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 808 | Open in IMG/M |
| 3300031344|Ga0265316_10134551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1860 | Open in IMG/M |
| 3300031716|Ga0310813_10748668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300031938|Ga0308175_102135487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300032782|Ga0335082_10961967 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300032955|Ga0335076_11124512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300033412|Ga0310810_11011794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300033475|Ga0310811_11261995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300034652|Ga0316598_166571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 8.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.67% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 8.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.33% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.33% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.33% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.33% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.33% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.67% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.67% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_13483680 | 2124908045 | Soil | MRFCHDELTLDEMLNDPLIGAVMRADGVDPEQLGAEL |
| JGI10216J12902_1180719462 | 3300000956 | Soil | MRLCHDEMTLDELLNDPVINAVMRADGVDPERLGEEFARMSQEQDAFAE* |
| C688J18823_100349094 | 3300001686 | Soil | MRFCHDEPTLDDMLNDPLIGAVMRADGVDPDELGAALVRVAEERDYAPAE* |
| Ga0006778J45830_10262422 | 3300003162 | Avena Fatua Rhizosphere | MRFCHDEPTLDDMLNDPLIGAVMRADGVDPDELGAALARVAEERDYAPAE* |
| JGI25406J46586_100064452 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MRICHDELTLDXLLAXPVIGAVMRADGVDPDQLGEELARFSEMEREEAA* |
| soilL2_101838013 | 3300003319 | Sugarcane Root And Bulk Soil | MRYCHDELTLDQLLADPVIAAVMQADGVDPAELQSDLARFAEERELID* |
| soilH1_101247454 | 3300003321 | Sugarcane Root And Bulk Soil | MRFCHDELTLDDMLNDPLIGAVMRADGVDAGELGAELARVAEERDALAED* |
| Ga0007429J51699_10411462 | 3300003579 | Avena Fatua Rhizosphere | MRFCHDEPTLDDMLNDPLIGAVMRADGVDPDELGAALARVAEERDYATAE* |
| Ga0062590_1008576362 | 3300004157 | Soil | MRQCYDELTLDELLADPLIGAVMRADGVDAEQLGSDLARVAEDQREFAE* |
| Ga0062590_1011930541 | 3300004157 | Soil | MRQCYDEPTLDELLADPLIGDVMRADGVDPGQLGADLARFAEDRDNAA* |
| Ga0062590_1019606151 | 3300004157 | Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEEQRELVD* |
| Ga0062591_1012996732 | 3300004643 | Soil | DELLADPLIGAVMRADGVDAEQLGSDLARVAEDQREFAE* |
| Ga0066671_100129322 | 3300005184 | Soil | MRWCHDEPTLDEILADPLIGVLMRADGVDREQLERDFARIFDEREERAAAE* |
| Ga0070676_101721353 | 3300005328 | Miscanthus Rhizosphere | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEERELVD* |
| Ga0070683_1000988952 | 3300005329 | Corn Rhizosphere | MRYCHDELTLDELLADPVIGAVMRADGVDPDALGNELARFAEEREEETV* |
| Ga0070690_1009626082 | 3300005330 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEEQRELVD* |
| Ga0070678_1021836702 | 3300005456 | Miscanthus Rhizosphere | MRQCYDELTLDELLADPLIGAVMRADGVDAEQLGSDLARVAEDQRE |
| Ga0070681_113493381 | 3300005458 | Corn Rhizosphere | MRYCHDELTLDELLADPVIGAVMRADGVDPDALGNELARFAEER |
| Ga0070685_100791362 | 3300005466 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEERELID* |
| Ga0070685_112936602 | 3300005466 | Switchgrass Rhizosphere | MRQCYDEPTLDELLADPLIGDVMRADGVDPERLGADLARMADDRDAAA* |
| Ga0070741_103446632 | 3300005529 | Surface Soil | MRYCHDELTLNELLADPVIGAVMRADGVDPDTLGTELARFAEEREEVEA* |
| Ga0068853_1001094254 | 3300005539 | Corn Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEERELID* |
| Ga0070672_1011010072 | 3300005543 | Miscanthus Rhizosphere | MRSCHDELTLDELLNDPVIHAVMRADGVNPRELGEEFARMAQEQDALVE* |
| Ga0070672_1016104652 | 3300005543 | Miscanthus Rhizosphere | MRRCYDEPTLDELLADPLIGDVMRADGVDPERLGADLARMADDRDAAA* |
| Ga0070665_1013718312 | 3300005548 | Switchgrass Rhizosphere | MRWCHDEPTLDELLADPMIGALMRADGVDPEALGGDLARLADDRRETAD* |
| Ga0070665_1014359122 | 3300005548 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAKEQRELVD* |
| Ga0066903_1032262221 | 3300005764 | Tropical Forest Soil | ELRRRRMRICHDELTLDELLADPVIGAVMRADGVDPDALSFELARFADEAREEEAA* |
| Ga0068863_1022935442 | 3300005841 | Switchgrass Rhizosphere | LDELLADPVIAAVMQADGVDPAELQSDLERFAEEQRELVD* |
| Ga0068862_1002626734 | 3300005844 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEERELVD* |
| Ga0068862_1012005471 | 3300005844 | Switchgrass Rhizosphere | MRQCYDELTLDKLLADPLIGAVMRADGVDADQLGSDLARVAADQREFAE* |
| Ga0081539_100052889 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MRICHDELTLDELLADPVIGAVMRADGVDPDQLGEELARFSEMEREEAA* |
| Ga0075363_1000076064 | 3300006048 | Populus Endosphere | MRTCTDELTLDELLADPVIVAVMRADGVDPAELGSELARFAEEQYELAA* |
| Ga0075362_100504203 | 3300006177 | Populus Endosphere | MRTCYDELTLDELLADPVIGAVMRADGVDPEELGFELARVAEDQRELAD* |
| Ga0097621_1018470122 | 3300006237 | Miscanthus Rhizosphere | MRICHDELTLDELLADPVINAVMQADGVDPFELGSDLARFTEQQEERELTD* |
| Ga0079221_106080242 | 3300006804 | Agricultural Soil | ENATMRYCHDELTLDELLADPVIGAVMRADGVDPDALGSALARFAEEREEVEA* |
| Ga0079220_102371502 | 3300006806 | Agricultural Soil | MRICHDELTLDELLADPVIAAVMRADGVDPDALGSELARFAESQDLEGPEQEEAV* |
| Ga0105107_102837593 | 3300009087 | Freshwater Sediment | KLEENTMRFCHDELTLDEMLNDPLIAAVMRADGVDPEQLGADLARMAEDRAVAAE* |
| Ga0105240_126453422 | 3300009093 | Corn Rhizosphere | LYCHDELTLDELLADPVIGAVMRADGVDPDALGNELARFAEEREEETV* |
| Ga0099792_103427312 | 3300009143 | Vadose Zone Soil | MRNCYDELTPDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELAD* |
| Ga0099792_106822821 | 3300009143 | Vadose Zone Soil | LTLDELLADPVINAVMRADGVDPEQLGSDLVRFAEDQRELAD* |
| Ga0105243_115505471 | 3300009148 | Miscanthus Rhizosphere | DELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEEQRELVD* |
| Ga0111538_103254402 | 3300009156 | Populus Rhizosphere | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLARFAEERELVD* |
| Ga0105241_109065642 | 3300009174 | Corn Rhizosphere | MRYCHDELTLDDLLADPVIAAVMQADGVDPAELQSDLERFAEEQRELVD* |
| Ga0105242_114254652 | 3300009176 | Miscanthus Rhizosphere | MRYCHDELTLDELLADPVITAMMRADGVDPAELQSDLERFAEEQRELVD* |
| Ga0105238_104364251 | 3300009551 | Corn Rhizosphere | RYCHDELTLDELLADPVIGAVMRADGVDPDALGNELARFAEEREEETV* |
| Ga0126384_109815862 | 3300010046 | Tropical Forest Soil | MRICHDELTLDELLADPVIGAVMRADGVDPDALSSELARFADASQEQQEEAA* |
| Ga0126306_114653612 | 3300010166 | Serpentine Soil | DELTLDEMLADPLIEAVMRADGVDRDRLERDFARIFDERETRELTD* |
| Ga0134127_121909232 | 3300010399 | Terrestrial Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERLAEGQRELVD* |
| Ga0134122_110581081 | 3300010400 | Terrestrial Soil | MRYCHDELTLDELLADPLIGEVMRADGVDVEQLGSELSRVAEDQREFAD* |
| Ga0134122_118503541 | 3300010400 | Terrestrial Soil | MRVCHDELSLDDMLNDPLIGAVMRADGVDREELGAELARIADEREDAMAD* |
| Ga0134123_108504322 | 3300010403 | Terrestrial Soil | MRYCHDELTLDELLADPLIGAVMRADGVDPAELQSDLERFAQERELAD* |
| Ga0126360_10858222 | 3300010854 | Boreal Forest Soil | MRHCYDELTLDELLADPVIGAVMRADGVDPDELGNELARFAEERDEVVE* |
| Ga0126354_10197361 | 3300010857 | Boreal Forest Soil | MRWCHEELTLEELLADPLIGAVMRADGVDPGELGIELARFEAE |
| Ga0126354_10296664 | 3300010857 | Boreal Forest Soil | MRWCHDELTLDEMLADPLIGVLMRADGVDRAQLGSDLARVADEREERAAAE* |
| Ga0126354_10525762 | 3300010857 | Boreal Forest Soil | MRNCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAQDQRELAD |
| Ga0126354_12413322 | 3300010857 | Boreal Forest Soil | MRWCHEELTLDELLADPVIGAVMRADGVDPEALGGDLARLAEDRRETTD* |
| Ga0126349_10159712 | 3300010861 | Boreal Forest Soil | MRWCHDEQTLDEMLADPLIGVLMRADGVDRERLERDFARIFDEREEHAAAG* |
| Ga0126348_10459901 | 3300010862 | Boreal Forest Soil | MRFCHDEMTLDDMLNDPLIGAVMRADGVDPEQLGADLARMAQEQVRAAD* |
| Ga0126348_12335452 | 3300010862 | Boreal Forest Soil | MRNCYDELTLDELLADPLIGAVMRADGVDPDELGSELARYAEEKDEIEA* |
| Ga0126348_13061711 | 3300010862 | Boreal Forest Soil | MRWCHDEPTLDEMLSDPLIDVLMRADGVDRERLERDFARIFDEREERAAAE* |
| Ga0105246_101639533 | 3300011119 | Miscanthus Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSD |
| Ga0137457_13394791 | 3300011443 | Soil | MRFCHDELTLDELLNDPVIHAVMRADGVDPQQLGEEFARLAEEQDALSE* |
| Ga0137399_104153462 | 3300012203 | Vadose Zone Soil | MRNCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELAD* |
| Ga0150985_1055199931 | 3300012212 | Avena Fatua Rhizosphere | MRNCYDELTLDELLADPVTGAVMQADGVDPEELGFELARIAEDQRELTD* |
| Ga0150985_1077849272 | 3300012212 | Avena Fatua Rhizosphere | MRHCYDELTLDELLTDPLIEAVMRADGVDPDQLGLELARFNEDQREAAE* |
| Ga0150985_1097822032 | 3300012212 | Avena Fatua Rhizosphere | MRFCHDEPTLDDMLNDPLIGAMMQADGVDPEQLGADLARMADAQEYGPAE* |
| Ga0150984_1037199591 | 3300012469 | Avena Fatua Rhizosphere | LKQKGKEQMRFCHDELTLDDMLNDPLIGAVMRADRVDPEQLGAELARIAEEKEYAP |
| Ga0150984_1071081932 | 3300012469 | Avena Fatua Rhizosphere | MRFCHDELTLDDMLNDPLIGAMMQADGVDPEQLGADLARMADEQDDSAAQ* |
| Ga0150984_1106221522 | 3300012469 | Avena Fatua Rhizosphere | MRFCHDEMTLDELLNDPVINAVMRADGVNPRELGEEFARMAEEQDALVE* |
| Ga0150984_1145680531 | 3300012469 | Avena Fatua Rhizosphere | MRFCHDELTLDEMLNDPLIGAVMRAEGVDPEQLGAELARIAEEQEYAPAE* |
| Ga0150984_1235472482 | 3300012469 | Avena Fatua Rhizosphere | LENEIMRYCHDELTLDELLADPVIGAVMRADGVDPDALGSELARFAQESDEQERAEETV* |
| Ga0137398_101731181 | 3300012683 | Vadose Zone Soil | TRRRAMRNCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELAD* |
| Ga0157284_100266771 | 3300012893 | Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEEREL |
| Ga0157293_100276482 | 3300012898 | Soil | MRYCHDELTLDELLADQVIEAVMRADGVDPAELQSDLERFAEEQRELVD* |
| Ga0157299_102459572 | 3300012899 | Soil | MRQCYDEPTLDELLSDPLIGDVMRADGVDPQRLGAELARFKDRENAA* |
| Ga0157292_100990602 | 3300012900 | Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELTVVG |
| Ga0157301_102787281 | 3300012911 | Soil | GEKQMRVCHDELSLDDMLNDPLIGAVMRADGVDREELGAELARIADEREDAMAD* |
| Ga0137413_118281091 | 3300012924 | Vadose Zone Soil | MRTCYDELTLDELLADPVIGAVMRADGVDLEELGFELARFAEDQRELAD* |
| Ga0137404_119253351 | 3300012929 | Vadose Zone Soil | MRQCYDELTLDELLADPLIGAVMRADGVDPDALGNELARFAEERYDEGAISLAL* |
| Ga0137407_109452412 | 3300012930 | Vadose Zone Soil | MRYCHDELTLDELLADPVINAVMRADGVDPEQLGSDLVRFAEDQRELAD* |
| Ga0164304_116702941 | 3300012986 | Soil | RKTSMRICHDELTLDELLADPVIAAVMRADGVDPEALSSELARFAEESRDEAP* |
| Ga0157375_119384002 | 3300013308 | Miscanthus Rhizosphere | MMRQCYDEPTLDELLADPLIGDVMRADGVDPERLGADLARMADDRDAAA* |
| Ga0157380_105811093 | 3300014326 | Switchgrass Rhizosphere | MRFCHDELTLDELLNDPVINAVMRADGVDPRELGEEFARMTREQDALVE* |
| Ga0167633_1002763 | 3300015069 | Glacier Forefield Soil | MRWCHDEQTLDEMLADPLIGVLMRADGVDRAQLERDFARIFDERASAE* |
| Ga0137412_100311637 | 3300015242 | Vadose Zone Soil | MRTCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELAD* |
| Ga0180093_11676362 | 3300015258 | Soil | MRFCHDELTLDEMLNDPLIGALMRADGVDPEQLGAELARIAVEHASAE* |
| Ga0137403_107414022 | 3300015264 | Vadose Zone Soil | SMRQCYDELTLDELLADPLIGAVMRADGVDPDALGNELARFAEERYDEGAISLAL* |
| Ga0137403_108343901 | 3300015264 | Vadose Zone Soil | MRYCHDELTLDELLADPVINAVMRADGVDPEQLGSDLVRFAEDQRELDD* |
| Ga0137403_111563662 | 3300015264 | Vadose Zone Soil | MRNCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELTD* |
| Ga0187781_100835402 | 3300017972 | Tropical Peatland | MRTCYDELTLDELLADPVIGAVMRADGVDPDELGSELARFAEERDELAE |
| Ga0187782_105962352 | 3300017975 | Tropical Peatland | MRNCYDELTLDELLADPVIGAVMHADGVDPDTLGDELARFAEEREEAVE |
| Ga0184635_100612561 | 3300018072 | Groundwater Sediment | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSVLERFAEEQRELVD |
| Ga0190272_121815542 | 3300018429 | Soil | MRFCHDELTLDEMLNDPLIGAMTRADGVDPEQLGAELARVADEREYAEAE |
| Ga0190272_127851482 | 3300018429 | Soil | MRHCYDEPTLDELLADPLIGDVMRADGVDPEQLGADLARMADDQARDDAA |
| Ga0190270_113567262 | 3300018469 | Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEEQR |
| Ga0190270_121236252 | 3300018469 | Soil | MRFCHDELTLDELLNDPVIHAVMRADGVDPQQLGEEFARLAEEQDALTE |
| Ga0190274_109996221 | 3300018476 | Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEERELVD |
| Ga0190274_137148332 | 3300018476 | Soil | MRYCHDELTLGELLADPVIAAMMQADGVDPAGLQSDLERFAEEQRELAD |
| Ga0190274_138102872 | 3300018476 | Soil | MRFCHDELTLDELLNDPVIHAVMRADGVNPRELGEEFARMAQEQDALVE |
| Ga0190271_103605402 | 3300018481 | Soil | MRFCHDELTLDEMLNDPLIGALMRADGVDPEQLGAELARIAVEHASAE |
| Ga0190271_103611141 | 3300018481 | Soil | MRFCHDELTLDEMLNDPLIGAVMRADGVDPAQLGAE |
| Ga0180106_11324532 | 3300019212 | Groundwater Sediment | MRFCHDELTLDELLNDPVIDAVMRADGVDPRELGEEFARMAKGQDAFIE |
| Ga0180114_12806182 | 3300019232 | Groundwater Sediment | MRFCHDELTLDELLNDPVIHAVMRADGVDPQQLGEEFARLAEEQDALAE |
| Ga0184641_10456652 | 3300019254 | Groundwater Sediment | MRQCHDEPTLDELLADPLIGDVMRADGVDPQRLGADLARFAEDRENAA |
| Ga0184641_11336802 | 3300019254 | Groundwater Sediment | MRQCYDELTLDELLTDPLIGAVMRADGVDPEQLGSE |
| Ga0184641_14595581 | 3300019254 | Groundwater Sediment | MRYCHDELTLDELLADPVINAVMRADGVDPEQLGSDLARFAED |
| Ga0184643_11201912 | 3300019255 | Groundwater Sediment | MRQCYDELTLDELLADPLIGDVMRADGVDVEQLGADLSRMAEDQARDTVA |
| Ga0184643_12101791 | 3300019255 | Groundwater Sediment | MRFCHDEMTLDELLNDPVINAVMRADGVDPERLEEEFARMTREQDALAE |
| Ga0184643_12537202 | 3300019255 | Groundwater Sediment | MRQCYDELTLDELLADPLIGAVMRADGVDAEQLGSDLARVAEDQREFAE |
| Ga0184647_13328902 | 3300019263 | Groundwater Sediment | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEEQRELVD |
| Ga0184642_15087622 | 3300019279 | Groundwater Sediment | MRQCYDEPTLDELLADPLIGDVMRADGVDVEQLGADLSRMAEDQARDAAA |
| Ga0173479_101409332 | 3300019362 | Soil | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAE |
| Ga0180113_10249591 | 3300020065 | Groundwater Sediment | MRFCHDELTLDELLNDPVIHAVMRADGVDPQQLGEEFARLAEEQDALSE |
| Ga0213882_100789142 | 3300021362 | Exposed Rock | MRYCHDELTLDELLADPVIGAVMRADGVDPDDLRELARFAEERDEVEI |
| Ga0222624_13437271 | 3300021951 | Groundwater Sediment | MRQCHDEPTLDELLADPLIGDVMRADGVDPQRLGADLARFAE |
| Ga0222624_16168692 | 3300021951 | Groundwater Sediment | MRNCYDELTLDELLADPVIGAVMEADGVNPEELGFELARFAEDQREL |
| Ga0222622_107649073 | 3300022756 | Groundwater Sediment | TLDELLADPVIAAVMRADGVDPAELQSDLERFAEEQRELVD |
| Ga0207710_100375834 | 3300025900 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEEQRELVD |
| Ga0207688_104140132 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEERELID |
| Ga0207695_106749722 | 3300025913 | Corn Rhizosphere | MLYCHDELTLDELLADPVIGAVMRADGVDPDALGNELARFAEEREEETV |
| Ga0207694_106541162 | 3300025924 | Corn Rhizosphere | MRYCHDELTLDELLADPVIGAVMRADGVDPDALGNELARFAEEREEETV |
| Ga0207670_103157313 | 3300025936 | Switchgrass Rhizosphere | YCHDELTLDELLADPVIAAVMRADGVDPAELQSDLERFAEEQRELVD |
| Ga0207711_111737693 | 3300025941 | Switchgrass Rhizosphere | LDELLADPVIAAVMQADGVDPAELQSDLERFAEEQRELVD |
| Ga0207689_111509492 | 3300025942 | Miscanthus Rhizosphere | MRQCYDEPTLDELLSDPLIGDVMRADGVDPQRLGAELARFKDRENAA |
| Ga0207679_102829333 | 3300025945 | Corn Rhizosphere | MRYCHDELTLDELLADPVIAAVMRADGVDPAELQSDLE |
| Ga0207676_100567024 | 3300026095 | Switchgrass Rhizosphere | YCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEERELID |
| Ga0207676_103529521 | 3300026095 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAEEQ |
| Ga0209153_10100242 | 3300026312 | Soil | MRWCHDEPTLDEILADPLIGVLMRADGVDREQLERDFARIFDEREERAAAE |
| Ga0179587_104857432 | 3300026557 | Vadose Zone Soil | MRQCYDELTLDELLADPLIGAVMRADGVDPDALGNELARFAEERYDEGAISLAL |
| Ga0209706_101629423 | 3300027818 | Freshwater Sediment | ENTMRFCHDELTLDEMLNDPLIAAVMRADGVDPEQLGADLARMAEDRAVAAE |
| Ga0209488_107437142 | 3300027903 | Vadose Zone Soil | MRNCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRELAD |
| Ga0209705_101986312 | 3300027979 | Freshwater Sediment | MRFCHDELTLDEMLNDPLIAAVMRADGVDPEQLGADLARMAEDRAVAAE |
| Ga0268266_108016742 | 3300028379 | Switchgrass Rhizosphere | MRYCHDELTLDELLADPVIAAVMQADGVDPAELQSDLERFAKEQRELVD |
| Ga0268266_110587692 | 3300028379 | Switchgrass Rhizosphere | MRWCHDEPTLDELLADPMIGALMRADGVDPEALGGDLARLADDRRETAD |
| Ga0265318_101023772 | 3300028577 | Rhizosphere | MRWCHDEPTLDTLLDDPLIDVLMRADGVDRERLERDFARIFDERQERAAAE |
| Ga0307503_109260072 | 3300028802 | Soil | MRHCYDEPTLDELLADPLIGDVMRADGVDPERLGADLARMADDRDAAA |
| Ga0099845_10042642 | 3300030975 | Boreal Forest Soil | MRWCHDELTLDEMLADPLIGVLMRADGVDRAQLGSDLARVADEREERAAAE |
| Ga0099845_10230192 | 3300030975 | Boreal Forest Soil | MRWCHDELTLDEMLSDPLIDVLMRADGVDRERLERDFARIFDEREARASAE |
| Ga0099845_10523992 | 3300030975 | Boreal Forest Soil | MRWCHDEPTLDELMADPLIDVLMRADGVDRAQLERDFARIFDEREQRAAAE |
| Ga0307501_102687861 | 3300031152 | Soil | MRTCYDELTLDELLADPVIGAVMRADGVDPEELGFELARFAEDQRE |
| Ga0265331_102427402 | 3300031250 | Rhizosphere | MQWCHDEPTLDTLLDDPLIDVLMRADGVDRERLERDFARIFDERQERAAAE |
| Ga0265316_101345511 | 3300031344 | Rhizosphere | PMRWCHDEPTLDTLLDDPLIDVLMRADGVDRERLERDFARIFDERQERAAAAD |
| Ga0310813_107486681 | 3300031716 | Soil | MRFCHDELTLDDMLNDPLIGAVMRADGVEPQELGAELARLAEERESDR |
| Ga0310813_119325972 | 3300031716 | Soil | MRFCHDELTLDDMLNDPLINAVMRADGVDPEELGAEL |
| Ga0308175_1021354871 | 3300031938 | Soil | MRFCHDELTLDEMLNDPLIGAVMRADGVDPEQLGADLARL |
| Ga0335082_109619672 | 3300032782 | Soil | MRICHDELTLDELLADPVIEAMMRADGVDPDALSSELARIAEETEPEAV |
| Ga0335076_111245122 | 3300032955 | Soil | RRAMRSCHDELTLDELLADPVIGAVMRADGVDPEELGFELARIAEDQRELTD |
| Ga0310810_110117941 | 3300033412 | Soil | MRFCHDELTLDDMLNDPLIGAMMRADGVEPQELGAELARLAE |
| Ga0310811_112619951 | 3300033475 | Soil | RPDKLHQEKEKGMRFCHDELTLDDMLNDPLIGAMMRADGVEPQELGAELARLAEERESDR |
| Ga0316598_166571_486_620 | 3300034652 | Untreated Peat Soil | MRWCHDEPTLDELLADPMIGALMRADGVDPEALGGDLARLADDRR |
| ⦗Top⦘ |