


| Basic Information | |
|---|---|
| Family ID | F047167 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MARGRKTSLTIRLTPAERQTLLAWQRATTISAGRARR |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.28 % |
| % of genes near scaffold ends (potentially truncated) | 96.67 % |
| % of genes from short scaffolds (< 2000 bps) | 94.67 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF00076 | RRM_1 | 4.67 |
| PF01209 | Ubie_methyltran | 4.00 |
| PF00072 | Response_reg | 2.00 |
| PF01609 | DDE_Tnp_1 | 2.00 |
| PF04972 | BON | 2.00 |
| PF10771 | DUF2582 | 2.00 |
| PF01548 | DEDD_Tnp_IS110 | 1.33 |
| PF03400 | DDE_Tnp_IS1 | 1.33 |
| PF00216 | Bac_DNA_binding | 1.33 |
| PF13613 | HTH_Tnp_4 | 0.67 |
| PF13546 | DDE_5 | 0.67 |
| PF13650 | Asp_protease_2 | 0.67 |
| PF13560 | HTH_31 | 0.67 |
| PF02452 | PemK_toxin | 0.67 |
| PF13358 | DDE_3 | 0.67 |
| PF01610 | DDE_Tnp_ISL3 | 0.67 |
| PF00753 | Lactamase_B | 0.67 |
| PF02518 | HATPase_c | 0.67 |
| PF13676 | TIR_2 | 0.67 |
| PF00196 | GerE | 0.67 |
| PF04392 | ABC_sub_bind | 0.67 |
| PF05443 | ROS_MUCR | 0.67 |
| PF13580 | SIS_2 | 0.67 |
| PF06794 | UPF0270 | 0.67 |
| PF13518 | HTH_28 | 0.67 |
| PF01471 | PG_binding_1 | 0.67 |
| PF00589 | Phage_integrase | 0.67 |
| PF11075 | DUF2780 | 0.67 |
| PF13551 | HTH_29 | 0.67 |
| PF01807 | zf-CHC2 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 4.00 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 4.00 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.00 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.00 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.00 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.33 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.33 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.33 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.67 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.67 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.67 |
| COG3089 | Uncharacterized conserved protein YheU, UPF0270 family | Function unknown [S] | 0.67 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.67 % |
| All Organisms | root | All Organisms | 49.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_102015894 | Not Available | 996 | Open in IMG/M |
| 3300000858|JGI10213J12805_10477013 | Not Available | 626 | Open in IMG/M |
| 3300000858|JGI10213J12805_10947363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300000955|JGI1027J12803_102714466 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005332|Ga0066388_102261059 | Not Available | 983 | Open in IMG/M |
| 3300005332|Ga0066388_102978302 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005332|Ga0066388_104624418 | Not Available | 700 | Open in IMG/M |
| 3300005467|Ga0070706_101929262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
| 3300005558|Ga0066698_10706975 | Not Available | 664 | Open in IMG/M |
| 3300005559|Ga0066700_10985817 | Not Available | 555 | Open in IMG/M |
| 3300005576|Ga0066708_10681797 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005586|Ga0066691_10341743 | Not Available | 886 | Open in IMG/M |
| 3300005617|Ga0068859_102114939 | Not Available | 621 | Open in IMG/M |
| 3300005719|Ga0068861_100516372 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005764|Ga0066903_104223716 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 768 | Open in IMG/M |
| 3300005764|Ga0066903_108829054 | Not Available | 512 | Open in IMG/M |
| 3300006194|Ga0075427_10025907 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300006196|Ga0075422_10165455 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300006794|Ga0066658_10780451 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006796|Ga0066665_11505561 | Not Available | 525 | Open in IMG/M |
| 3300006797|Ga0066659_10397482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1083 | Open in IMG/M |
| 3300006844|Ga0075428_100109046 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300006844|Ga0075428_101193008 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300006844|Ga0075428_101316013 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006845|Ga0075421_102086649 | Not Available | 601 | Open in IMG/M |
| 3300006846|Ga0075430_100584095 | Not Available | 922 | Open in IMG/M |
| 3300006847|Ga0075431_100160330 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300006847|Ga0075431_100399598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1375 | Open in IMG/M |
| 3300006847|Ga0075431_100777708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia amicalis | 931 | Open in IMG/M |
| 3300006847|Ga0075431_101508880 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 631 | Open in IMG/M |
| 3300006852|Ga0075433_10845191 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006853|Ga0075420_100247981 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300006854|Ga0075425_102133670 | Not Available | 625 | Open in IMG/M |
| 3300006871|Ga0075434_101866837 | Not Available | 607 | Open in IMG/M |
| 3300006880|Ga0075429_100610795 | Not Available | 955 | Open in IMG/M |
| 3300006880|Ga0075429_101137601 | Not Available | 682 | Open in IMG/M |
| 3300006903|Ga0075426_10647252 | Not Available | 791 | Open in IMG/M |
| 3300006969|Ga0075419_10488466 | Not Available | 854 | Open in IMG/M |
| 3300006969|Ga0075419_11197267 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
| 3300006969|Ga0075419_11526780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300007255|Ga0099791_10238975 | Not Available | 860 | Open in IMG/M |
| 3300007265|Ga0099794_10065853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1767 | Open in IMG/M |
| 3300009012|Ga0066710_102816226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 687 | Open in IMG/M |
| 3300009012|Ga0066710_104276949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
| 3300009089|Ga0099828_10232916 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300009090|Ga0099827_11107051 | Not Available | 688 | Open in IMG/M |
| 3300009090|Ga0099827_11138233 | Not Available | 678 | Open in IMG/M |
| 3300009094|Ga0111539_12825229 | Not Available | 562 | Open in IMG/M |
| 3300009098|Ga0105245_10760287 | Not Available | 1005 | Open in IMG/M |
| 3300009100|Ga0075418_10303071 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300009100|Ga0075418_10511535 | Not Available | 1289 | Open in IMG/M |
| 3300009100|Ga0075418_10630542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1154 | Open in IMG/M |
| 3300009100|Ga0075418_12488452 | Not Available | 565 | Open in IMG/M |
| 3300009100|Ga0075418_12762599 | Not Available | 536 | Open in IMG/M |
| 3300009137|Ga0066709_100947666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1257 | Open in IMG/M |
| 3300009137|Ga0066709_101009399 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1219 | Open in IMG/M |
| 3300009143|Ga0099792_10508528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 755 | Open in IMG/M |
| 3300009156|Ga0111538_10490523 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300009156|Ga0111538_13250059 | Not Available | 566 | Open in IMG/M |
| 3300009162|Ga0075423_12164143 | Not Available | 604 | Open in IMG/M |
| 3300009162|Ga0075423_13011362 | Not Available | 516 | Open in IMG/M |
| 3300010043|Ga0126380_11103973 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12 | 676 | Open in IMG/M |
| 3300010046|Ga0126384_11165044 | Not Available | 709 | Open in IMG/M |
| 3300010046|Ga0126384_12089361 | Not Available | 543 | Open in IMG/M |
| 3300010048|Ga0126373_10186997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1997 | Open in IMG/M |
| 3300010358|Ga0126370_11181458 | Not Available | 710 | Open in IMG/M |
| 3300010359|Ga0126376_10359734 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1294 | Open in IMG/M |
| 3300010359|Ga0126376_11270766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 755 | Open in IMG/M |
| 3300010360|Ga0126372_10571045 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1079 | Open in IMG/M |
| 3300010360|Ga0126372_13103759 | Not Available | 516 | Open in IMG/M |
| 3300010362|Ga0126377_11767382 | Not Available | 694 | Open in IMG/M |
| 3300010366|Ga0126379_10101397 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 2562 | Open in IMG/M |
| 3300010366|Ga0126379_13292339 | Not Available | 541 | Open in IMG/M |
| 3300012198|Ga0137364_11446950 | Not Available | 507 | Open in IMG/M |
| 3300012199|Ga0137383_10917542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
| 3300012199|Ga0137383_10944747 | Not Available | 629 | Open in IMG/M |
| 3300012203|Ga0137399_10078476 | Not Available | 2499 | Open in IMG/M |
| 3300012203|Ga0137399_10646685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
| 3300012203|Ga0137399_11181469 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012206|Ga0137380_11746618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300012209|Ga0137379_10163113 | Not Available | 2140 | Open in IMG/M |
| 3300012209|Ga0137379_11291494 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 635 | Open in IMG/M |
| 3300012210|Ga0137378_11272228 | Not Available | 652 | Open in IMG/M |
| 3300012211|Ga0137377_10295468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1554 | Open in IMG/M |
| 3300012349|Ga0137387_10848549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 661 | Open in IMG/M |
| 3300012353|Ga0137367_10492606 | Not Available | 864 | Open in IMG/M |
| 3300012357|Ga0137384_10939578 | Not Available | 696 | Open in IMG/M |
| 3300012359|Ga0137385_10456345 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1085 | Open in IMG/M |
| 3300012361|Ga0137360_10514619 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1019 | Open in IMG/M |
| 3300012361|Ga0137360_11109194 | Not Available | 683 | Open in IMG/M |
| 3300012363|Ga0137390_11466220 | Not Available | 624 | Open in IMG/M |
| 3300012391|Ga0134035_1120985 | Not Available | 1092 | Open in IMG/M |
| 3300012908|Ga0157286_10444203 | Not Available | 514 | Open in IMG/M |
| 3300012948|Ga0126375_10071580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece → unclassified Cyanothece → Cyanothece sp. SIO1E1 | 1947 | Open in IMG/M |
| 3300012971|Ga0126369_11380133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 795 | Open in IMG/M |
| 3300012971|Ga0126369_12174941 | Not Available | 642 | Open in IMG/M |
| 3300013297|Ga0157378_10992366 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300013306|Ga0163162_10354149 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1600 | Open in IMG/M |
| 3300014154|Ga0134075_10446970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
| 3300014326|Ga0157380_11976879 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300014326|Ga0157380_13543485 | Not Available | 500 | Open in IMG/M |
| 3300015264|Ga0137403_10272249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300015371|Ga0132258_13033788 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300015371|Ga0132258_13348235 | Not Available | 1102 | Open in IMG/M |
| 3300015372|Ga0132256_100349803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → unclassified Fischerella → Fischerella sp. PCC 9605 | 1572 | Open in IMG/M |
| 3300015373|Ga0132257_100883466 | Not Available | 1119 | Open in IMG/M |
| 3300015373|Ga0132257_101092763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1006 | Open in IMG/M |
| 3300015374|Ga0132255_101319802 | Not Available | 1089 | Open in IMG/M |
| 3300018082|Ga0184639_10212246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1026 | Open in IMG/M |
| 3300025910|Ga0207684_11048764 | Not Available | 680 | Open in IMG/M |
| 3300025936|Ga0207670_10343509 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300025961|Ga0207712_10896910 | Not Available | 783 | Open in IMG/M |
| 3300025961|Ga0207712_11350040 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 637 | Open in IMG/M |
| 3300025961|Ga0207712_12139431 | Not Available | 500 | Open in IMG/M |
| 3300026313|Ga0209761_1192562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 908 | Open in IMG/M |
| 3300026318|Ga0209471_1103688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13 | 1227 | Open in IMG/M |
| 3300026318|Ga0209471_1302018 | Not Available | 530 | Open in IMG/M |
| 3300026552|Ga0209577_10710502 | Not Available | 568 | Open in IMG/M |
| 3300027577|Ga0209874_1058186 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300027655|Ga0209388_1169542 | Not Available | 613 | Open in IMG/M |
| 3300027873|Ga0209814_10529766 | Not Available | 523 | Open in IMG/M |
| 3300027880|Ga0209481_10461337 | Not Available | 654 | Open in IMG/M |
| 3300027882|Ga0209590_10809547 | Not Available | 595 | Open in IMG/M |
| 3300027909|Ga0209382_10423512 | Not Available | 1479 | Open in IMG/M |
| 3300027909|Ga0209382_11495505 | Not Available | 673 | Open in IMG/M |
| 3300027909|Ga0209382_11522367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 665 | Open in IMG/M |
| 3300028587|Ga0247828_10251768 | Not Available | 950 | Open in IMG/M |
| 3300028587|Ga0247828_10443021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 758 | Open in IMG/M |
| 3300028587|Ga0247828_10988944 | Not Available | 549 | Open in IMG/M |
| 3300028819|Ga0307296_10549262 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300030563|Ga0247653_1041352 | Not Available | 620 | Open in IMG/M |
| 3300031081|Ga0308185_1033543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 627 | Open in IMG/M |
| 3300031092|Ga0308204_10159751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300031099|Ga0308181_1160566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 533 | Open in IMG/M |
| 3300031561|Ga0318528_10469532 | Not Available | 676 | Open in IMG/M |
| 3300031572|Ga0318515_10498355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 650 | Open in IMG/M |
| 3300031640|Ga0318555_10608645 | Not Available | 592 | Open in IMG/M |
| 3300031770|Ga0318521_10489488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas juntendi | 738 | Open in IMG/M |
| 3300031858|Ga0310892_11343713 | Not Available | 512 | Open in IMG/M |
| 3300031873|Ga0315297_10579986 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031890|Ga0306925_12049937 | Not Available | 538 | Open in IMG/M |
| 3300031908|Ga0310900_11046820 | Not Available | 673 | Open in IMG/M |
| 3300031947|Ga0310909_10483321 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300032001|Ga0306922_11132039 | Not Available | 800 | Open in IMG/M |
| 3300032068|Ga0318553_10572664 | Not Available | 591 | Open in IMG/M |
| 3300032159|Ga0268251_10325331 | Not Available | 645 | Open in IMG/M |
| 3300032180|Ga0307471_102620260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 24.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.33% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.67% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030563 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031081 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1020158942 | 3300000559 | Soil | MARGRITSLTISLTPTERQTLLAWQRATTIAAGRARRG |
| JGI10213J12805_104770132 | 3300000858 | Soil | MARGRKTSLTISLTPEERQTLRAWQRATIVPSGVS |
| JGI10213J12805_109473631 | 3300000858 | Soil | MPRGRPTALTIRLTPAERQTLLAWQRATTIPAGRARRGRMIL |
| JGI1027J12803_1027144661 | 3300000955 | Soil | MPRGRRTSLTIRLTPAERLTLLAWQRATSIPAGLARRARIILLL |
| Ga0066388_1022610591 | 3300005332 | Tropical Forest Soil | MARGRTTALTLTLTPAERRTLLAWQRATTIAAGRARRGRMILLIA |
| Ga0066388_1029783021 | 3300005332 | Tropical Forest Soil | MARGRKTALTIRLASDERHTLMAWQRSTTIPAGRARRGRI |
| Ga0066388_1046244182 | 3300005332 | Tropical Forest Soil | MVLFPKGVCMPRGRKTSLTIRLTPTQRQALRAWQRALTIPAGMA |
| Ga0070706_1019292621 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MARGRHTALTMQLTADERQTLLAWQRSTTIPAGSVRRGQIM |
| Ga0066698_107069752 | 3300005558 | Soil | MGQGRTTSLTLRLTPAERRTLLAWQRATTTISAGRARR |
| Ga0066700_109858172 | 3300005559 | Soil | MARGRKTSLTIRLTPAERLTLLTWQRATTIPAGLARRARLLVL |
| Ga0066708_106817972 | 3300005576 | Soil | MPRGRTTALTIRLTPAQRQTLLAWESSTTIPAGLARR |
| Ga0066691_103417433 | 3300005586 | Soil | MARGRTTSLTIRLTPTERQTLLTWQRATTIAAGRARRG |
| Ga0068859_1021149391 | 3300005617 | Switchgrass Rhizosphere | MARGRKTSLMIRLTPAERQTLLTWQRATTISAGRAR |
| Ga0068861_1005163723 | 3300005719 | Switchgrass Rhizosphere | MARGRKTALTIRLAADERHTLMAWQRSTTIPAGRARRGR |
| Ga0066903_1042237162 | 3300005764 | Tropical Forest Soil | MARGRKTALTIRLAADERHTLMAWQRSTTIPAGRAR |
| Ga0066903_1088290541 | 3300005764 | Tropical Forest Soil | MPRGRKTALRISLTADEYQTLRAWQRSTTMPAGQARRGRI |
| Ga0075427_100259071 | 3300006194 | Populus Rhizosphere | MARGRKSSFTIRLTPAERLTLLTWQRATTISAGVARRARLLLL |
| Ga0075422_101654552 | 3300006196 | Populus Rhizosphere | MARGRKTSLSIRLTPAVRQTLLAWQRAPTIPAGRV |
| Ga0066658_107804511 | 3300006794 | Soil | MARGRKTSFTIRLTPAERQTLLAWQRATTIPAGIARRGR |
| Ga0066665_115055611 | 3300006796 | Soil | MARGRKTALTIRLTADQRRTLLALQRSTTIRAGRARRGR |
| Ga0066659_103974823 | 3300006797 | Soil | MALGRRTSFTITLTDEERQTLLAWQPSTSIPAGIARRGRIIL |
| Ga0075428_1001090464 | 3300006844 | Populus Rhizosphere | MARKTSLTIHLTPADRQTLRAWQWSTTLRPGLGRRARMILLRA |
| Ga0075428_1011930083 | 3300006844 | Populus Rhizosphere | MAQRRKTSLIIRLTPEERQTLLAWQRAPTIRAGLVRRARMILLLAD |
| Ga0075428_1013160133 | 3300006844 | Populus Rhizosphere | MARGRKTALTIRLTPAERLTLLTWQRATTISAGVARRARLLLL |
| Ga0075421_1020866492 | 3300006845 | Populus Rhizosphere | MARGRKTSLTIRLTPAERQTLLAWQRATAIPAGLAR |
| Ga0075430_1005840953 | 3300006846 | Populus Rhizosphere | MARGRTTTLTISLTPAQQQTLLGWQHARTVTARHARRAGSSS |
| Ga0075431_1001603305 | 3300006847 | Populus Rhizosphere | MARGRKTALHIHLTPADRQTLLAWQRSTTMPAGRARR |
| Ga0075431_1003995981 | 3300006847 | Populus Rhizosphere | MAHGRKTSLTIELTLEERQTLLAWQRSTTMPAGRA |
| Ga0075431_1007777081 | 3300006847 | Populus Rhizosphere | MARKTSLTIHLTPADRQTLRAWQWSTTLRPGLGRRARMILLRAD |
| Ga0075431_1015088802 | 3300006847 | Populus Rhizosphere | CMARGRTTSLTIRLTPTERQTLLAWQRATTISAGPDYFWL* |
| Ga0075433_108451912 | 3300006852 | Populus Rhizosphere | MARGRKTSFTIRLTPAQRQTLLMWQRATSVPAGLARRARMIL |
| Ga0075420_1002479811 | 3300006853 | Populus Rhizosphere | MARGRTTSLTISLTPTERQTLLAWQRATTIAAGRARRG |
| Ga0075425_1021336701 | 3300006854 | Populus Rhizosphere | MARGRRTSLTICLMPAERQTLLAWQGATTIAAGRTRRGRII |
| Ga0075434_1018668372 | 3300006871 | Populus Rhizosphere | MPCGRKTSLIIRLTPAQRLTLLTWQRSTSIPAGLARRA |
| Ga0075429_1006107951 | 3300006880 | Populus Rhizosphere | MARGRRTSFTISLTPAQRQTLLAWQRAPTTPAGLARRAR |
| Ga0075429_1011376012 | 3300006880 | Populus Rhizosphere | MASGRKTALTIRLTPAQRQLLLVRQRATGIPAGDARR |
| Ga0075426_106472521 | 3300006903 | Populus Rhizosphere | MPRGRKTALSVLSVQLTPAQRQTLLAWQRSTAIPAGLAR |
| Ga0075419_104884661 | 3300006969 | Populus Rhizosphere | MARGRKTSLSIRLTPAVHQTLLAWQRATTIPAGRVRRGR |
| Ga0075419_111972671 | 3300006969 | Populus Rhizosphere | MARGRTTSLTVRLTPMERQTLLAWQRATTIGAGRARRGRI |
| Ga0075419_115267802 | 3300006969 | Populus Rhizosphere | MARGRKTALTIRLAADERHTLMAWQRSTTIPAGRARR |
| Ga0099791_102389752 | 3300007255 | Vadose Zone Soil | MILFLKKSHMPRGRKTSLTIRLTPAQRQTLLAWQRATTIPAGQAR |
| Ga0099794_100658531 | 3300007265 | Vadose Zone Soil | MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRGRI |
| Ga0066710_1028162261 | 3300009012 | Grasslands Soil | MRRGRRTSLTIRLTDDARQPLLAWQRSTTIPAGIARRGGALVLMA |
| Ga0066710_1042769491 | 3300009012 | Grasslands Soil | MAGGRKTALTICFTQEEQQSLRSWQRSTTIPAGRAQRGRIILL |
| Ga0099828_102329161 | 3300009089 | Vadose Zone Soil | MARGRKTSLTIRLTPAERQTLLAWQRATTISAGRARR |
| Ga0099827_111070511 | 3300009090 | Vadose Zone Soil | MARGRKTSLSVPLTPAERRTLLAWQRATTISAGRAR |
| Ga0099827_111382332 | 3300009090 | Vadose Zone Soil | MARGRTTSLTIRLTLAQRQTLLAWQRSATTISAGRARRGRI |
| Ga0111539_128252291 | 3300009094 | Populus Rhizosphere | MTRGRKTSLTITLTPAERQTLLAWQRATTIAAGRA |
| Ga0105245_107602871 | 3300009098 | Miscanthus Rhizosphere | MARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLARRARLLLLLAD |
| Ga0075418_103030715 | 3300009100 | Populus Rhizosphere | MAQRRKTSLIIRLTPEERQTLLAWQRAPTIRAGLVRRARMILLLADGV |
| Ga0075418_105115351 | 3300009100 | Populus Rhizosphere | MEEYSMAQGRKTSLTIRLTPAERQTLLAWQRATTIRAGL |
| Ga0075418_106305421 | 3300009100 | Populus Rhizosphere | MTRGRKTSLTLTLTPEERQTLLAWQRSTTMPAGRARRGRI |
| Ga0075418_124884522 | 3300009100 | Populus Rhizosphere | MARGRKTALTIRLTPEERRTLLGWQRATTISAGRAR |
| Ga0075418_127625991 | 3300009100 | Populus Rhizosphere | MARGRKTSLTIRLTPAERQTLLAWQRATAIPAGLARR |
| Ga0066709_1009476661 | 3300009137 | Grasslands Soil | MARGRTTSLTIRLTEAERRTLQAWQRATTISAGRARRG |
| Ga0066709_1010093991 | 3300009137 | Grasslands Soil | MTRGRRTSLTIRLTPAERRTLLTWQRATTVPAGLARRARLL |
| Ga0099792_105085282 | 3300009143 | Vadose Zone Soil | MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRG |
| Ga0111538_104905231 | 3300009156 | Populus Rhizosphere | MARGRKTLLTIRLTPAERLTLLTWQRVTTISVGVARRARLLLL |
| Ga0111538_132500591 | 3300009156 | Populus Rhizosphere | MARGRRTSFTIRLTPAERRTLLTWQRATTIPAGLARRA |
| Ga0075423_121641431 | 3300009162 | Populus Rhizosphere | MARGRKTSLTIRLTPPECQTLLMWQRLTTIPAGQARRARLL |
| Ga0075423_130113621 | 3300009162 | Populus Rhizosphere | MARGRRTSFTIRLTPAERRTLLTWQRATTVPAGLARRA |
| Ga0126380_111039731 | 3300010043 | Tropical Forest Soil | MAQGCKTSVTIRLTPAQRQTLMAWQRATTISAGLARRGRMI |
| Ga0126384_111650441 | 3300010046 | Tropical Forest Soil | MARGRTTALTLRLTPTQRRTLLTWQRATTIHAGLARRGR |
| Ga0126384_120893611 | 3300010046 | Tropical Forest Soil | MARGRTTSFTIRLTPAQRQTLLAWQRATSVSAGLARRARLIL |
| Ga0126373_101869973 | 3300010048 | Tropical Forest Soil | MVQGRKTALTIRLTPAERLTLLAWQRATAIPAGQARQ |
| Ga0126370_111814582 | 3300010358 | Tropical Forest Soil | MVSGRKTSFSIRLTPVERQTLLAWQCATTLSAGLARRA |
| Ga0126376_103597343 | 3300010359 | Tropical Forest Soil | MPRGRTTSFTIRLTPAQRQTLRTWQQATTLPAGLARRA |
| Ga0126376_112707661 | 3300010359 | Tropical Forest Soil | MARGRTTSLTIRLTPAERRTLLAWQRATTIAAGRAR |
| Ga0126372_105710452 | 3300010360 | Tropical Forest Soil | MARGRRTALTIRLAADERHTLMAWQRSTTIPAGRARR |
| Ga0126372_131037591 | 3300010360 | Tropical Forest Soil | MARGRKTSLMIRLTPAERHTLLAWQRATTISAGRAR |
| Ga0126377_117673821 | 3300010362 | Tropical Forest Soil | MAQGRTTSLTIRLTPAQRRTLLAWQRATTISAGRARRGRL |
| Ga0126379_101013971 | 3300010366 | Tropical Forest Soil | MREGEIGMPRGRTTSLTITLTDAERQTLMAWQRSTTIRAG* |
| Ga0126379_132923391 | 3300010366 | Tropical Forest Soil | MARGRKTSLRIRLTPAQRQTLLAWQRATTIPAGQARR |
| Ga0137364_114469502 | 3300012198 | Vadose Zone Soil | MARGRHPSFRIRLTPDDRQTLRSWQRSTTIPAGRARRGRSIVQLADG |
| Ga0137383_109175421 | 3300012199 | Vadose Zone Soil | MVLFLKGLTMARGRKTSFTIRLTPGQRQTLLAWQRATTIPAGQARRGRMV |
| Ga0137383_109447472 | 3300012199 | Vadose Zone Soil | MARGRRTSLTIRLTPAQRQTLLAWQRATTIHAGQARRGRILLLLADGV |
| Ga0137399_100784761 | 3300012203 | Vadose Zone Soil | MARGRKTALTIRLTPAERRTLLAWQRATTLSAGRARRGRI |
| Ga0137399_106466851 | 3300012203 | Vadose Zone Soil | MARGRKTSLTIRLTPAQRQTLLAWQRATTISAGRAR |
| Ga0137399_111814691 | 3300012203 | Vadose Zone Soil | MAQGRPTALVIRLTPAERLTLLTWQRGTTLSAGLARRARLILLRAE |
| Ga0137362_111423372 | 3300012205 | Vadose Zone Soil | MARGRKTSLTICLTLSQRQTLLAWQRATTVPAGLARRARMISLLADGV |
| Ga0137380_103819282 | 3300012206 | Vadose Zone Soil | MARGRKTSFIIRLTLAQRQTLLVWQRATNISAGLARRARIILLLADGM |
| Ga0137380_117466182 | 3300012206 | Vadose Zone Soil | MPRGRETALTIRLTVEERQTLMAWQRSTTIPAGRA |
| Ga0137379_101631131 | 3300012209 | Vadose Zone Soil | MARGRRTSLTICLTPAQRQTLLAWQRATTITAGLAR |
| Ga0137379_110869061 | 3300012209 | Vadose Zone Soil | MARGRKTALTIHLTPGERWTLLVWQRATTIAAGRARRGRILLLVAEGMP |
| Ga0137379_112914941 | 3300012209 | Vadose Zone Soil | MARGRKTALTIRLTAEERHTLLAWQRSTTIPAGRARR |
| Ga0137378_112722281 | 3300012210 | Vadose Zone Soil | MARGRTTALTIRLTPAERRTLVAWQRATTFSAGRARRG |
| Ga0137377_102954681 | 3300012211 | Vadose Zone Soil | MARGRITALTIRLTPAERRTLLAWQRATTISAGRARR |
| Ga0137387_108485491 | 3300012349 | Vadose Zone Soil | MARGRSTSLTIRLTPAERLTLLAWQRATTISAGRARRGRI |
| Ga0137367_104926061 | 3300012353 | Vadose Zone Soil | MARGRRTSLTIRLTPEERQTLLAWHRSMTIPASIARRGQVI |
| Ga0137384_109395781 | 3300012357 | Vadose Zone Soil | MARGRKTSLTIRLTPAERRTLQAWQRATTISAGRAR |
| Ga0137385_104563452 | 3300012359 | Vadose Zone Soil | MARGRKTALTIRLASDERHTLMAWQRSTTIPAGRARRG |
| Ga0137360_105146191 | 3300012361 | Vadose Zone Soil | MARGRTTSLTIRLTAEERQTLLAWQRATTISAGRARRGRMILLIADRV |
| Ga0137360_111091942 | 3300012361 | Vadose Zone Soil | MARGRTTSLTIRLTPAERQTLLAWQRAKTITAGRA |
| Ga0137390_114662201 | 3300012363 | Vadose Zone Soil | MARGRKTSLSIRLTPAERLTLLAWQRATTIPAGLARRAR |
| Ga0134035_11209852 | 3300012391 | Grasslands Soil | MARGRTTSLTIRLTPTERQTLLTWQRATTIAAGRAR |
| Ga0157286_104442031 | 3300012908 | Soil | MILFLKKSRMPRGRTTSLTIRLTPAQRQTLLAWQRATTIPAGQ |
| Ga0126375_100715804 | 3300012948 | Tropical Forest Soil | MARGRKTTLTIYLTPAQRQMLLAWQRATTISAGRA |
| Ga0126369_113801331 | 3300012971 | Tropical Forest Soil | MARGRKTALTIRLTPAQRHTLLAWQRSTTIAAGRVR |
| Ga0126369_121749411 | 3300012971 | Tropical Forest Soil | MLEGEIGMPRGRTTSLTITLTDAERQTLMAWQRSTTIRAG* |
| Ga0157378_109923662 | 3300013297 | Miscanthus Rhizosphere | MARGRTTSLTVCLTPAQRQFLLARQRAITTPAGLARRARIIILMA |
| Ga0163162_103541491 | 3300013306 | Switchgrass Rhizosphere | MILFLKKSRMPSGRKTSLTIRLTPAQRQTLLAWQHATTIPAGQARR |
| Ga0134075_104469701 | 3300014154 | Grasslands Soil | MPRGRTTALTIRLTPAQRQTLLAWERSTTIPAGLARRARMVLL |
| Ga0157380_119768791 | 3300014326 | Switchgrass Rhizosphere | MILFLKKSRMPRGRTTSLTIRLTPAQRQTLLAWQLATTIPAGQA |
| Ga0157380_135434851 | 3300014326 | Switchgrass Rhizosphere | MARGRKTALILHLTPAQRQTLLAWQRATTISAGRARR |
| Ga0137403_102722495 | 3300015264 | Vadose Zone Soil | MARGRVTSLTIRLTSAERQTLLAWQRATTISAGRARRGRMILL |
| Ga0132258_130337882 | 3300015371 | Arabidopsis Rhizosphere | MARGRKTSLSIRLTPAVRQTLLAWQRAPTIPAGRVRRGRMILL |
| Ga0132258_133482351 | 3300015371 | Arabidopsis Rhizosphere | MARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLARRARL |
| Ga0132256_1003498031 | 3300015372 | Arabidopsis Rhizosphere | MARGRTTSFTLRLTPTQRRTLLAWQRATRIPAGLARRGRIILL |
| Ga0132257_1008834662 | 3300015373 | Arabidopsis Rhizosphere | MARGRRTSFTIRLTPAERLTLLTWQRATTVPAGLA |
| Ga0132257_1010927632 | 3300015373 | Arabidopsis Rhizosphere | MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARR |
| Ga0132255_1013198021 | 3300015374 | Arabidopsis Rhizosphere | MARGRTTSLTIHLTPAERQTLVAWQRATTIPAGLARRSRIILLAAD |
| Ga0184639_102122462 | 3300018082 | Groundwater Sediment | MARGWKTLLTIDLTAEQRETLTAWQRSTTIPAGHAKRGRIILLI |
| Ga0207684_110487641 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MARGRKTSLTISLTVEEPQTLMAWQRSTTIRAGRA |
| Ga0207670_103435093 | 3300025936 | Switchgrass Rhizosphere | MARGRTTSLTVCLTPAERQLLVARQRATNIPAGLA |
| Ga0207712_108969102 | 3300025961 | Switchgrass Rhizosphere | MARGRKTSFTIRLTPAERRTLLTWQRATTVPAGLAR |
| Ga0207712_113500402 | 3300025961 | Switchgrass Rhizosphere | MARGRKTALTIRLANDERHTLMAWQRSTTIPAGRA |
| Ga0207712_121394311 | 3300025961 | Switchgrass Rhizosphere | MARGRTTSLTVCLTPAERQLLVARQRAITTPAGLAR |
| Ga0209761_11925621 | 3300026313 | Grasslands Soil | MARGRKTSLSIQLTPAQRQMLLVWQRSTTTISAGHARRGRM |
| Ga0209471_11036881 | 3300026318 | Soil | MGQGRTTSLTIRLTPAERRTLLAWQRSTTTISAGRARRGRIIVLV |
| Ga0209471_13020181 | 3300026318 | Soil | MARGRTTSLTIYLTPAERRTLLAWQRSTTTISAGR |
| Ga0209577_107105022 | 3300026552 | Soil | MGQGRTTSLTLRLTPAERRTLLAWQRATTTISAGRARRGRILLLVA |
| Ga0209874_10581862 | 3300027577 | Groundwater Sand | MARGRRTSLTIRLTPAERETLLAWQRATTISAGRARR |
| Ga0209388_11695421 | 3300027655 | Vadose Zone Soil | MILFLKKSRMPRGRKTSLTIRLTPAQRQTLLAWQRATTIPAGQARR |
| Ga0209814_105297661 | 3300027873 | Populus Rhizosphere | MARGRTTAFIIRLTPAERLTLLTWQRATTISAGVARRARLLLL |
| Ga0209481_104613371 | 3300027880 | Populus Rhizosphere | MARGRTTSLTIRLTPTERQTLLAWQRATTIAAGRARRG |
| Ga0209590_108095471 | 3300027882 | Vadose Zone Soil | MARGRRTSLTIRLTPAERRTLQAWQRTTTLSAGLA |
| Ga0209382_104235122 | 3300027909 | Populus Rhizosphere | MPRGRKTSLLIRLTPAERLTLLTWQRSTTIPAGLA |
| Ga0209382_114955052 | 3300027909 | Populus Rhizosphere | MASGRKTALTIRLTPAQRQLLLVRQRATGIPAGDARRARIILLLAD |
| Ga0209382_115223672 | 3300027909 | Populus Rhizosphere | MARGRKTSLTIHLTPAQRQTLLAWQRATNIPAGLARRARIV |
| Ga0247828_102517681 | 3300028587 | Soil | MAHGRKSALTMHVTPAQRHTLLAWQRATTVSAGLARRGRLIFLVAD |
| Ga0247828_104430212 | 3300028587 | Soil | MARGRKTSLSIRLTPAVRQTLLAWQRATTIPAGRVRRGRMILL |
| Ga0247828_109889441 | 3300028587 | Soil | MARGRKTSLTIRLTPAERQTLRAWQRATTIAAGRARR |
| Ga0307296_105492621 | 3300028819 | Soil | MARGRHTASHICLTPEDRHTPLAWQRSTTIRAAPDRF |
| Ga0247653_10413521 | 3300030563 | Soil | MAHGRQTALTLTLNLTPEERQTLQAWQRSPTMPAGPARRGRMIVRVA |
| Ga0308185_10335431 | 3300031081 | Soil | MARGRKTSLTIRLTPAERRTLLAWQRATTISAGRARRGRILLLM |
| Ga0308204_101597513 | 3300031092 | Soil | MARGRTTSLTIRLTLSERRTLLAWQRATTIPAGQARRGRIMLLRAD |
| Ga0308181_11605661 | 3300031099 | Soil | MARGRKTSLMIRLTPAERRTLLAWQRATIISAGRARRGRIL |
| Ga0318528_104695321 | 3300031561 | Soil | MARGRKTSLAIRLTPAVRQTLLAWQRATTMPAGRARRGRI |
| Ga0318515_104983551 | 3300031572 | Soil | MARGRKTSLVIRLTPAVRQTLLAWQRATTIPAGRAR |
| Ga0318555_106086452 | 3300031640 | Soil | MARGRKTSFTIRLTPAERLTLLTWQRATTLSAGVARRARLLLLL |
| Ga0318521_104894882 | 3300031770 | Soil | MARGRKTSLAIRLTPAVRQTLLAWQRATTIPAGRARRGRLILLV |
| Ga0310892_113437131 | 3300031858 | Soil | MPRERTTSLTIRLMPAERLTLMTWQRSVTLSAGLARRARIRLLRAD |
| Ga0315297_105799863 | 3300031873 | Sediment | MARGRKTSLTVTLTAEERDELEFWQRCTTLPVGLV |
| Ga0306925_120499371 | 3300031890 | Soil | MASGRKTSFSIRLTPAERQTLLAWQRTTTISAGLFRISRII |
| Ga0310900_110468201 | 3300031908 | Soil | MARGRKTSLTIRLTSAERQTLRAWQRATTIAAGRARRGRI |
| Ga0310909_104833212 | 3300031947 | Soil | MARGRKTALKIPLTPAERRTLLAWQRATTISAGRA |
| Ga0306922_111320392 | 3300032001 | Soil | MARGRKTSRTLRLTPAERQTLLAWQRASLIPAGLARRGRIV |
| Ga0318553_105726641 | 3300032068 | Soil | MARGRKTSLVVRLTPAERQTLLAWQRATTIAAGRARRGRLIVLVA |
| Ga0268251_103253312 | 3300032159 | Agave | MARGRKTSLTITLTPEERRTLLAWQRSTTIHAGML |
| Ga0307471_1026202602 | 3300032180 | Hardwood Forest Soil | MPRGRKTSLMIRLTADDRQTLTRWQRSTTIRAGDA |
| ⦗Top⦘ |