


| Basic Information | |
|---|---|
| Family ID | F047031 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.36 % |
| % of genes near scaffold ends (potentially truncated) | 93.33 % |
| % of genes from short scaffolds (< 2000 bps) | 94.00 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF02771 | Acyl-CoA_dh_N | 18.67 |
| PF01075 | Glyco_transf_9 | 8.67 |
| PF07485 | DUF1529 | 6.00 |
| PF00664 | ABC_membrane | 2.00 |
| PF13505 | OMP_b-brl | 2.00 |
| PF12697 | Abhydrolase_6 | 2.00 |
| PF01226 | Form_Nir_trans | 1.33 |
| PF02530 | Porin_2 | 1.33 |
| PF09588 | YqaJ | 1.33 |
| PF03401 | TctC | 0.67 |
| PF04392 | ABC_sub_bind | 0.67 |
| PF12071 | DUF3551 | 0.67 |
| PF00293 | NUDIX | 0.67 |
| PF00078 | RVT_1 | 0.67 |
| PF13565 | HTH_32 | 0.67 |
| PF01339 | CheB_methylest | 0.67 |
| PF08388 | GIIM | 0.67 |
| PF03404 | Mo-co_dimer | 0.67 |
| PF13005 | zf-IS66 | 0.67 |
| PF13467 | RHH_4 | 0.67 |
| PF05726 | Pirin_C | 0.67 |
| PF13683 | rve_3 | 0.67 |
| PF02518 | HATPase_c | 0.67 |
| PF13844 | Glyco_transf_41 | 0.67 |
| PF00476 | DNA_pol_A | 0.67 |
| PF12806 | Acyl-CoA_dh_C | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 18.67 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 8.67 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 1.33 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.33 |
| COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 1.33 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.67 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.67 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.67 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.67 % |
| Unclassified | root | N/A | 35.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401DHFKN | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 2170459021|G14TP7Y02FS8AQ | Not Available | 590 | Open in IMG/M |
| 3300001164|JGI11823J13286_1000805 | Not Available | 1941 | Open in IMG/M |
| 3300001305|C688J14111_10212442 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300001661|JGI12053J15887_10545890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 552 | Open in IMG/M |
| 3300001977|JGI24746J21847_1008833 | Not Available | 1515 | Open in IMG/M |
| 3300002075|JGI24738J21930_10016928 | Not Available | 1535 | Open in IMG/M |
| 3300002076|JGI24749J21850_1029184 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300002155|JGI24033J26618_1018800 | Not Available | 872 | Open in IMG/M |
| 3300002239|JGI24034J26672_10109205 | Not Available | 527 | Open in IMG/M |
| 3300004114|Ga0062593_101892060 | Not Available | 659 | Open in IMG/M |
| 3300004157|Ga0062590_102892054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 514 | Open in IMG/M |
| 3300004480|Ga0062592_100244208 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 1310 | Open in IMG/M |
| 3300004643|Ga0062591_102327849 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005332|Ga0066388_106875922 | Not Available | 573 | Open in IMG/M |
| 3300005355|Ga0070671_102112509 | Not Available | 502 | Open in IMG/M |
| 3300005440|Ga0070705_100993821 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 681 | Open in IMG/M |
| 3300005518|Ga0070699_101744225 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005535|Ga0070684_100755555 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 908 | Open in IMG/M |
| 3300005544|Ga0070686_101149895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300005548|Ga0070665_100548870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 1168 | Open in IMG/M |
| 3300005562|Ga0058697_10583348 | Not Available | 582 | Open in IMG/M |
| 3300005564|Ga0070664_101611925 | Not Available | 615 | Open in IMG/M |
| 3300005764|Ga0066903_100690255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella → Duganella phyllosphaerae | 1796 | Open in IMG/M |
| 3300005764|Ga0066903_102868808 | Not Available | 935 | Open in IMG/M |
| 3300005764|Ga0066903_102979569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300005842|Ga0068858_100628140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300005937|Ga0081455_10143841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1848 | Open in IMG/M |
| 3300006042|Ga0075368_10454250 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006606|Ga0074062_10047339 | Not Available | 901 | Open in IMG/M |
| 3300006844|Ga0075428_100949573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 911 | Open in IMG/M |
| 3300006847|Ga0075431_100905399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300006847|Ga0075431_101330107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300006852|Ga0075433_11914849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300006871|Ga0075434_102156535 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006871|Ga0075434_102440536 | Not Available | 525 | Open in IMG/M |
| 3300006904|Ga0075424_102440997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300006953|Ga0074063_10134038 | Not Available | 618 | Open in IMG/M |
| 3300009038|Ga0099829_11426654 | Not Available | 572 | Open in IMG/M |
| 3300009094|Ga0111539_12315930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300009100|Ga0075418_10075727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3581 | Open in IMG/M |
| 3300009100|Ga0075418_11241059 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300009147|Ga0114129_13346639 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009156|Ga0111538_10160008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2860 | Open in IMG/M |
| 3300009162|Ga0075423_12794291 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300009162|Ga0075423_13161769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300009174|Ga0105241_10838125 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300009176|Ga0105242_10234969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1645 | Open in IMG/M |
| 3300009176|Ga0105242_12268260 | Not Available | 589 | Open in IMG/M |
| 3300009177|Ga0105248_12518373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300009792|Ga0126374_11136402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 622 | Open in IMG/M |
| 3300010333|Ga0134080_10645396 | Not Available | 520 | Open in IMG/M |
| 3300010358|Ga0126370_12295086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300010360|Ga0126372_11155231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300010366|Ga0126379_10948840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium | 964 | Open in IMG/M |
| 3300010366|Ga0126379_11533736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300010373|Ga0134128_12190331 | Not Available | 609 | Open in IMG/M |
| 3300010396|Ga0134126_10592711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1269 | Open in IMG/M |
| 3300010401|Ga0134121_10416420 | Not Available | 1218 | Open in IMG/M |
| 3300010403|Ga0134123_12224435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300011106|Ga0151489_1642992 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012198|Ga0137364_10425460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300012206|Ga0137380_10251701 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300012212|Ga0150985_121556208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium | 512 | Open in IMG/M |
| 3300012212|Ga0150985_122360833 | Not Available | 510 | Open in IMG/M |
| 3300012356|Ga0137371_10098688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2274 | Open in IMG/M |
| 3300012356|Ga0137371_10838364 | Not Available | 700 | Open in IMG/M |
| 3300012683|Ga0137398_10320930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300012685|Ga0137397_11048013 | Not Available | 597 | Open in IMG/M |
| 3300012885|Ga0157287_1120423 | Not Available | 509 | Open in IMG/M |
| 3300012906|Ga0157295_10020404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1317 | Open in IMG/M |
| 3300012915|Ga0157302_10553286 | Not Available | 507 | Open in IMG/M |
| 3300012924|Ga0137413_10897354 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012941|Ga0162652_100008984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1199 | Open in IMG/M |
| 3300012944|Ga0137410_11771369 | Not Available | 545 | Open in IMG/M |
| 3300012971|Ga0126369_13240840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300013308|Ga0157375_11268022 | Not Available | 866 | Open in IMG/M |
| 3300013308|Ga0157375_11520792 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300013308|Ga0157375_12277416 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300013308|Ga0157375_12966717 | Not Available | 567 | Open in IMG/M |
| 3300014157|Ga0134078_10057999 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1358 | Open in IMG/M |
| 3300014325|Ga0163163_10300015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1659 | Open in IMG/M |
| 3300014326|Ga0157380_12011050 | Not Available | 640 | Open in IMG/M |
| 3300014968|Ga0157379_10244834 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1627 | Open in IMG/M |
| 3300014969|Ga0157376_11228287 | Not Available | 778 | Open in IMG/M |
| 3300015052|Ga0137411_1382640 | Not Available | 4787 | Open in IMG/M |
| 3300015077|Ga0173483_10299010 | Not Available | 787 | Open in IMG/M |
| 3300015245|Ga0137409_10851836 | Not Available | 747 | Open in IMG/M |
| 3300015245|Ga0137409_10863104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300015371|Ga0132258_14004545 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 1000 | Open in IMG/M |
| 3300015374|Ga0132255_102002815 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 881 | Open in IMG/M |
| 3300015374|Ga0132255_104195206 | Not Available | 611 | Open in IMG/M |
| 3300018027|Ga0184605_10084154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1390 | Open in IMG/M |
| 3300018028|Ga0184608_10334006 | Not Available | 666 | Open in IMG/M |
| 3300018052|Ga0184638_1220094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 663 | Open in IMG/M |
| 3300018054|Ga0184621_10001820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5369 | Open in IMG/M |
| 3300018073|Ga0184624_10396014 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018077|Ga0184633_10201036 | Not Available | 1029 | Open in IMG/M |
| 3300018465|Ga0190269_12010961 | Not Available | 503 | Open in IMG/M |
| 3300018469|Ga0190270_10481235 | Not Available | 1177 | Open in IMG/M |
| 3300019356|Ga0173481_10248592 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300019875|Ga0193701_1107458 | Not Available | 513 | Open in IMG/M |
| 3300019887|Ga0193729_1092889 | Not Available | 1160 | Open in IMG/M |
| 3300020001|Ga0193731_1004047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3749 | Open in IMG/M |
| 3300020016|Ga0193696_1061848 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300021510|Ga0222621_1030224 | Not Available | 1113 | Open in IMG/M |
| 3300022694|Ga0222623_10346454 | Not Available | 568 | Open in IMG/M |
| 3300025321|Ga0207656_10273573 | Not Available | 831 | Open in IMG/M |
| 3300025914|Ga0207671_10294233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
| 3300025915|Ga0207693_10015043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6211 | Open in IMG/M |
| 3300025922|Ga0207646_11947136 | Not Available | 500 | Open in IMG/M |
| 3300025926|Ga0207659_11591250 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 558 | Open in IMG/M |
| 3300025932|Ga0207690_10897645 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300025949|Ga0207667_10533407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
| 3300025972|Ga0207668_10514704 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300026023|Ga0207677_11665983 | Not Available | 591 | Open in IMG/M |
| 3300027875|Ga0209283_10243481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1193 | Open in IMG/M |
| 3300028380|Ga0268265_10023662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4333 | Open in IMG/M |
| 3300028536|Ga0137415_10298310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1416 | Open in IMG/M |
| 3300028587|Ga0247828_10575367 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 683 | Open in IMG/M |
| 3300028708|Ga0307295_10151336 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300028710|Ga0307322_10114975 | Not Available | 699 | Open in IMG/M |
| 3300028718|Ga0307307_10308272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300028720|Ga0307317_10079203 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300028754|Ga0307297_10289841 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300028784|Ga0307282_10618480 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300028787|Ga0307323_10354885 | Not Available | 525 | Open in IMG/M |
| 3300028790|Ga0307283_10057054 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300028802|Ga0307503_10376254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300028811|Ga0307292_10143570 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300028828|Ga0307312_10937531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 574 | Open in IMG/M |
| 3300028875|Ga0307289_10182945 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300028880|Ga0307300_10318821 | Not Available | 530 | Open in IMG/M |
| 3300031094|Ga0308199_1157693 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031854|Ga0310904_10485476 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031858|Ga0310892_10485834 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 820 | Open in IMG/M |
| 3300031890|Ga0306925_10617536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1143 | Open in IMG/M |
| 3300031890|Ga0306925_11684976 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031896|Ga0318551_10211854 | Not Available | 1075 | Open in IMG/M |
| 3300031908|Ga0310900_10163989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1521 | Open in IMG/M |
| 3300031912|Ga0306921_11080932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 900 | Open in IMG/M |
| 3300032000|Ga0310903_10099250 | Not Available | 1235 | Open in IMG/M |
| 3300032017|Ga0310899_10051805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1506 | Open in IMG/M |
| 3300032075|Ga0310890_10526153 | Not Available | 903 | Open in IMG/M |
| 3300032159|Ga0268251_10559287 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300033475|Ga0310811_11091322 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Sulfobium → Candidatus Sulfobium mesophilum | 679 | Open in IMG/M |
| 3300033550|Ga0247829_10646682 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300033551|Ga0247830_10147805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 1714 | Open in IMG/M |
| 3300034149|Ga0364929_0080017 | Not Available | 1015 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.33% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.33% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.67% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.67% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_08252230 | 2124908009 | Soil | VPQLDIGLQVMYTHNNTAYKGPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP |
| 4NP_03974180 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | PKLDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQSVWSAMVRWQRNFYP |
| JGI11823J13286_10008051 | 3300001164 | Forest Soil | TAYKGNAVYGAPQNGSRPAVALIDDQNVWSAMFRWQRNFYP* |
| C688J14111_102124422 | 3300001305 | Soil | IGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| JGI12053J15887_105458902 | 3300001661 | Forest Soil | AYKGPGTYAANGPRPAVTSFDNQGVWSALVRWQRNFYP* |
| JGI24746J21847_10088332 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRLDIGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| JGI24738J21930_100169282 | 3300002075 | Corn Rhizosphere | YKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| JGI24749J21850_10291842 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| JGI24033J26618_10188002 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | LNTAYKRAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| JGI24034J26672_101092051 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | GLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0062593_1018920602 | 3300004114 | Soil | LDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQSVWSAMVRWQRNFYP* |
| Ga0062590_1028920542 | 3300004157 | Soil | QWNPVPKLDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGIWSAMVRWQRNFYP* |
| Ga0062592_1002442081 | 3300004480 | Soil | SHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP* |
| Ga0062591_1023278492 | 3300004643 | Soil | NPVPQLDIGLQVMYTHHNTAYKGPAALAANGSRPAVVDGLIDDQNVWSAMFRWQRNFYP* |
| Ga0066388_1068759222 | 3300005332 | Tropical Forest Soil | YTGLNTAYKGAGVYAANASRPPVTVFDDQGVWSAMVRWQRNFYP* |
| Ga0070671_1021125091 | 3300005355 | Switchgrass Rhizosphere | PQLDIGMEILYQHNNTAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0070705_1009938212 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAYKGPGVYSANTSRPAVALIDDQNVWSAMFRWQRNFYP* |
| Ga0070699_1017442251 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0070684_1007555551 | 3300005535 | Corn Rhizosphere | QLDIGLQVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP* |
| Ga0070686_1011498951 | 3300005544 | Switchgrass Rhizosphere | IGVDVTYTGLNTAYKGAGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0070665_1005488702 | 3300005548 | Switchgrass Rhizosphere | NPVPQLDIGLQVMYTHHNTAYKGAAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP* |
| Ga0058697_105833482 | 3300005562 | Agave | YKGPGTYAANGSRPAVGLFDDQGIWSAMFRWQRNFYP* |
| Ga0070664_1016119251 | 3300005564 | Corn Rhizosphere | LDIGLQVMYQHNNTAFKGPAALAANVSRPAVLNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0066903_1006902551 | 3300005764 | Tropical Forest Soil | GFEVLYSHHNTAYKGPALYTANPAKPAIALVDDQSVWSAIFRWQRNFYP* |
| Ga0066903_1028688082 | 3300005764 | Tropical Forest Soil | KGPALYTVNLPRPAVPLMDDQSVWTGLFRWQRNFYP* |
| Ga0066903_1029795692 | 3300005764 | Tropical Forest Soil | LYSQRNTAFKGPGVIPVNGSRPVVQAFDDQGVWSAMVRWQRNFFP* |
| Ga0068858_1006281401 | 3300005842 | Switchgrass Rhizosphere | TGLNTAYKGAGIYAANGSRPPVALLDDQGVWSAMFRWQRNFYP* |
| Ga0081455_101438414 | 3300005937 | Tabebuia Heterophylla Rhizosphere | GLEVLYSQRNTAFKGAAIVPASGARPPVLVLDDQGVWSAMFRWQRNFYP* |
| Ga0075368_104542501 | 3300006042 | Populus Endosphere | DVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGIWSAMVRWQRNFYP* |
| Ga0074062_100473391 | 3300006606 | Soil | LDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP* |
| Ga0075428_1009495732 | 3300006844 | Populus Rhizosphere | GPGTYAVNLPRPALPLFDDQDVWSAFFRWQRNFYP* |
| Ga0075431_1009053993 | 3300006847 | Populus Rhizosphere | TGLNTAYKGAGVYAANASRPPVFVFDDQGVWSAMVRWQRNFYP* |
| Ga0075431_1013301071 | 3300006847 | Populus Rhizosphere | WNPVPQLDIGLDVTYTYHNTAYKGAGLYTANAPRPAVALIDDQNVWSAFFRWQRNFYP* |
| Ga0075433_119148492 | 3300006852 | Populus Rhizosphere | NTAFKGVGIVPANASRPGVFVIDDQDVWSAMVRWQRNFYP* |
| Ga0075434_1021565352 | 3300006871 | Populus Rhizosphere | NTAYKGAGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0075434_1024405361 | 3300006871 | Populus Rhizosphere | VPQLDIGLQVMYTHHNTAYKGPAALAANGSRPAVPVVDGFIDDQNVWSAMFRWQRNFYP* |
| Ga0075424_1024409972 | 3300006904 | Populus Rhizosphere | TYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0074063_101340381 | 3300006953 | Soil | KGAAIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0099829_114266541 | 3300009038 | Vadose Zone Soil | HLNTAYKGVGTTPANGAQPAHTLVDDQNVWSAMFRWQRNFYP* |
| Ga0111539_123159302 | 3300009094 | Populus Rhizosphere | KGAAVVPASGSRPPVLVIDDQDAWSAMFRWQRNFYP* |
| Ga0075418_100757274 | 3300009100 | Populus Rhizosphere | FKGPAVVPASGSRPPVFVIDDQDVWSAMVRWQRNFYP* |
| Ga0075418_112410592 | 3300009100 | Populus Rhizosphere | MRPYTGLNTAYKGAGVYAANASRPAVTVFDDQGVWSAMVRWQRNFYP* |
| Ga0114129_133466392 | 3300009147 | Populus Rhizosphere | MKRRMRPYTGLNTAYKGAGVYAANASRPAVTVFDDQGVWSAMVRWQRNFYP* |
| Ga0111538_101600081 | 3300009156 | Populus Rhizosphere | QLDIGLQVMYQHNNTAFKGPATLAANLSRPAVINGIIDDQNVWSAMFRWQRNFYP* |
| Ga0075423_127942911 | 3300009162 | Populus Rhizosphere | IGVDVTYTGLNTAYKGAGIYAANGSRPPVALLDDQGVWSAMFRWQRNFYP* |
| Ga0075423_131617691 | 3300009162 | Populus Rhizosphere | FKGNAVVPASGSRPPVFVIDDQDAWSAMVRWQRNFYP* |
| Ga0105241_108381252 | 3300009174 | Corn Rhizosphere | NSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP* |
| Ga0105242_102349691 | 3300009176 | Miscanthus Rhizosphere | LYQHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP* |
| Ga0105242_122682601 | 3300009176 | Miscanthus Rhizosphere | HNTAYKGAAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP* |
| Ga0105248_125183731 | 3300009177 | Switchgrass Rhizosphere | HHNTAYKGAAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP* |
| Ga0126374_111364021 | 3300009792 | Tropical Forest Soil | LYSRRNTAFKGNGFVPATGSRPAVFALDDQDVWTAMVRWQRNFFP* |
| Ga0134080_106453962 | 3300010333 | Grasslands Soil | EVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP* |
| Ga0126370_122950862 | 3300010358 | Tropical Forest Soil | SKLNSAFKGPATVQPNVPRPGVTAIDDQGVWSAMFRWQRNFYP* |
| Ga0126372_111552311 | 3300010360 | Tropical Forest Soil | TAFKGPANVAANLPRPAVTLIDDQGVWSAFMRWQRNFYP* |
| Ga0126379_109488402 | 3300010366 | Tropical Forest Soil | MYTGLNTAYKGAGIYAANGSRPPVTVFDDQGVWSAMVRWQRNFYP* |
| Ga0126379_115337362 | 3300010366 | Tropical Forest Soil | PQLDIGFEVLYTHHNTAYRGPGLYTANPAQSAIPLFDNQNVWSGIVRWQRNFYP* |
| Ga0134128_121903311 | 3300010373 | Terrestrial Soil | AALAANGSRPAVPVVDGFIDDQNVWSAMFRWQRNFYP* |
| Ga0134126_105927112 | 3300010396 | Terrestrial Soil | VPRLDIGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0134121_104164201 | 3300010401 | Terrestrial Soil | TAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0134123_122244351 | 3300010403 | Terrestrial Soil | AALAANGSRPAVVNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0151489_16429922 | 3300011106 | Soil | LNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0137364_104254601 | 3300012198 | Vadose Zone Soil | PGIVPATGSRPAVPAFDDQGVWSAMVRWQRNFYP* |
| Ga0137380_102517011 | 3300012206 | Vadose Zone Soil | STGLVTGTNGSRPAVTLIDDQNVWSAMLRWQRNFYP* |
| Ga0150985_1215562081 | 3300012212 | Avena Fatua Rhizosphere | WNPVPQLDIGLQVMYTHNNTAYKGPAALAANGSRPAGVNGIIDDQNVWSAMFRWQRNFYP |
| Ga0150985_1223608331 | 3300012212 | Avena Fatua Rhizosphere | KGAASLPTNGSRPAVINAVLDDQNVWSAMFRWQRNFYP* |
| Ga0137371_100986882 | 3300012356 | Vadose Zone Soil | PQLDIGLEVLYSQRNTAFKGLGTVAATGSRPAVAVLDDQGVWSAMVRWQRNFYP* |
| Ga0137371_108383641 | 3300012356 | Vadose Zone Soil | TGINTAYKGPGIYATNGSRPAVGLFDDQGVWSAMFRWQRNFYP* |
| Ga0150984_1139565761 | 3300012469 | Avena Fatua Rhizosphere | AQLDIGLEVLYSRRNTAFKGNAIVPPTGSRPTVFALDDQDVWSAMVRWQRNFYP* |
| Ga0137398_103209301 | 3300012683 | Vadose Zone Soil | TRLNTAFKGNAVVVANGSRPAVPLLSDQDVWSAMFRWQRNFYP* |
| Ga0137397_110480131 | 3300012685 | Vadose Zone Soil | VMYTRLNTAFKGNAVVVANGSRPAVPLLSDQDVWSAMFRWQRNFYP* |
| Ga0157287_11204231 | 3300012885 | Soil | PVPQLDIGMEVLYQHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP* |
| Ga0157295_100204043 | 3300012906 | Soil | DVTYTGLNTAYKGAGIYAANGSRPAVALLDDQGVWSAMFLWQRNFYP* |
| Ga0157302_105532862 | 3300012915 | Soil | GLNTAYKRAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0137413_108973542 | 3300012924 | Vadose Zone Soil | VPQLDIGFEVLYTHHNTAYKGPALYTANNPRPAVTLIDDQNVWSAIVRWQRNFYP* |
| Ga0162652_1000089842 | 3300012941 | Soil | PIRASTPRKGAAIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP* |
| Ga0137410_117713692 | 3300012944 | Vadose Zone Soil | LYTHVNTAYKGLGTTAANGSRNPVTLIDDQNVWSAMLRWQRNFYP* |
| Ga0126369_132408402 | 3300012971 | Tropical Forest Soil | GLEVLYSHRNTAFKGVAIVPASGSRPPVFVLDDQGVWSAMVRWQRNFYP* |
| Ga0157375_112680221 | 3300013308 | Miscanthus Rhizosphere | LYQHNNTAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0157375_115207921 | 3300013308 | Miscanthus Rhizosphere | IGLQVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP* |
| Ga0157375_122774161 | 3300013308 | Miscanthus Rhizosphere | KGAAIYAANGSRPAVALLDDQSVWSAMVRWQRNFYP* |
| Ga0157375_129667171 | 3300013308 | Miscanthus Rhizosphere | FKGPAIVPASGSRPPVFALDDQNVWSAMFRWQRNFYP* |
| Ga0134078_100579991 | 3300014157 | Grasslands Soil | LDIGLEVLYSQRNTAFKGLGTVAATGSRPAVAVLDDQGVWSAMVRWQRNFYP* |
| Ga0163163_103000151 | 3300014325 | Switchgrass Rhizosphere | NTAFKGAAIVPANGSRPVVFALDDQNVLSAMFRWQRNFYP* |
| Ga0157380_120110502 | 3300014326 | Switchgrass Rhizosphere | QHNNTAFKGPATLAANLSRPAVLNGVIDDQNVWSAMFRWQRKFYP* |
| Ga0157379_102448342 | 3300014968 | Switchgrass Rhizosphere | GAGIYAANGSRPPVALLDDQGVWSAMFRWQRNFYP* |
| Ga0157376_112282871 | 3300014969 | Miscanthus Rhizosphere | NNTAFKGPANLAANLSRPAVLNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0137411_13826404 | 3300015052 | Vadose Zone Soil | MSSHTAFQGPANLTANSHAGVLNGVIDDQNVWAAMFRWQRNFYP* |
| Ga0173483_102990102 | 3300015077 | Soil | QLDIGLQVMYQHNNTAFKGPAALAANVSRPAVLNGVIDDQNVWSAMFRWQRNFYP* |
| Ga0137409_108518361 | 3300015245 | Vadose Zone Soil | LEILYSHHNTAYKGAALYTANAPRPVVTLIDDQNVWSAFFRWQRNFYP* |
| Ga0137409_108631042 | 3300015245 | Vadose Zone Soil | NTAYKGAANVAANGSRPAVALIDDQNVWSAMLRWQRNFYP* |
| Ga0132258_140045452 | 3300015371 | Arabidopsis Rhizosphere | LNTAYKGPGVYSANPPRPAVVVLDDQNVWSAMFRWQRNFYP* |
| Ga0132255_1020028151 | 3300015374 | Arabidopsis Rhizosphere | SHLTSAYKGPGIYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP* |
| Ga0132255_1041952062 | 3300015374 | Arabidopsis Rhizosphere | IGLDITYTGLNTAYKLARVLAANTSRPAVTVFDDQGVWSAMVRWQRNFYP* |
| Ga0184605_100841541 | 3300018027 | Groundwater Sediment | GNAVVAANGSRPPVPLLSDQDVWSAMFRWQRNFYP |
| Ga0184608_103340061 | 3300018028 | Groundwater Sediment | NNTAFKGPATLAANASRPLVVNGVIDDQNVWSAMFRWQRNFYP |
| Ga0184638_12200942 | 3300018052 | Groundwater Sediment | GLEVLYTHLNTAYKGAGVYPANGSRPAVTSIDDQNIWSAMFRWQRNFYP |
| Ga0184621_100018207 | 3300018054 | Groundwater Sediment | MYTRLNTAYKGPATFAANGSRPAVANGIIDDQNVWSAMFRWQRNFYP |
| Ga0184624_103960141 | 3300018073 | Groundwater Sediment | LDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0184633_102010362 | 3300018077 | Groundwater Sediment | VMYTRLNTAYKGPATFAANGSRPAVANGIIDDQNVWSAMFRWQRNFYP |
| Ga0190269_120109612 | 3300018465 | Soil | MEVMYTHHNTAFKGPATLAANGSRPLVVNGIIDDQNVWSAMFRWQRNFYP |
| Ga0190270_104812351 | 3300018469 | Soil | ATLAANGSRPLVINGFMDHQNVWSAMFRWQRNFYP |
| Ga0173481_102485922 | 3300019356 | Soil | TYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0193701_11074581 | 3300019875 | Soil | LQVMYTKLNTAYKGPATFAANGSRPAVANGIIDDQNVWSAMFRWQRNFYP |
| Ga0193729_10928891 | 3300019887 | Soil | TGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0193731_10040472 | 3300020001 | Soil | VIYTRLNTAFKGNAVVVANGSRPPVALLSDQDVWSAMFRWQRNFYP |
| Ga0193696_10618481 | 3300020016 | Soil | IGLDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0222621_10302241 | 3300021510 | Groundwater Sediment | LDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0222623_103464541 | 3300022694 | Groundwater Sediment | RTQWNPVPRLDIGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFY |
| Ga0207656_102735732 | 3300025321 | Corn Rhizosphere | GAAGYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0207671_102942334 | 3300025914 | Corn Rhizosphere | MEVLYQHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP |
| Ga0207693_100150431 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RTQWNPVPRLDIGLDVTYTGLNTAYKRAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFY |
| Ga0207646_119471362 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RRNTAFKGAAIVPANASRPAVFALDDQDVISAMFRWQRNFYP |
| Ga0207659_115912502 | 3300025926 | Miscanthus Rhizosphere | HLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP |
| Ga0207690_108976452 | 3300025932 | Corn Rhizosphere | IGLDVTYTGLNTAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0207667_105334072 | 3300025949 | Corn Rhizosphere | NNTAYKGPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP |
| Ga0207668_105147042 | 3300025972 | Switchgrass Rhizosphere | NTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0207677_116659831 | 3300026023 | Miscanthus Rhizosphere | GAAVHAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0209283_102434813 | 3300027875 | Vadose Zone Soil | AYKGPGITPANGAQPAHNFVDDQNVWSAQFRWQRNFYP |
| Ga0268265_100236625 | 3300028380 | Switchgrass Rhizosphere | TAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0137415_102983101 | 3300028536 | Vadose Zone Soil | THVNTAYKGVGTYAANGSRPAVTLIDDQNVWSAMLRWQRNFYP |
| Ga0247828_105753671 | 3300028587 | Soil | YKGPGIYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP |
| Ga0307295_101513361 | 3300028708 | Soil | TYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0307322_101149751 | 3300028710 | Soil | QWNPVPQLDIGMEVLYMHHDTAFKGPANLAANVSRPAVLAGVMDDQNVWSAMFRWQRNFY |
| Ga0307307_103082721 | 3300028718 | Soil | GLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0307317_100792032 | 3300028720 | Soil | VPKLDIGLDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0307297_102898411 | 3300028754 | Soil | GLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0307282_106184801 | 3300028784 | Soil | GLDVTYTGINTAYKGPGVYAANGSRPAVGLFDDEGIWSAIFRWQRNFYS |
| Ga0307323_103548851 | 3300028787 | Soil | YTHNNTAYKGPAALAANGSRPAVVNGIIDDRNVWSAMFRWQRNFYP |
| Ga0307283_100570542 | 3300028790 | Soil | PKLDIGLDVTYTGLNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0307503_103762542 | 3300028802 | Soil | FNPVPQLDIGLDLLYTGLNTAYRGPGTYAANASRPAVTSFDNQGVWSALMRWQRNFYP |
| Ga0307292_101435701 | 3300028811 | Soil | LNSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0307312_109375312 | 3300028828 | Soil | RLDIGLDVTYTGLNTAYKGAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0307289_101829451 | 3300028875 | Soil | NSAYKGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0307300_103188212 | 3300028880 | Soil | RLQGPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP |
| Ga0308199_11576931 | 3300031094 | Soil | AYKGAAVYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0310904_104854762 | 3300031854 | Soil | AYKGDGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0310892_104858341 | 3300031858 | Soil | DIGLQVLYSHLTSAYKGPGVYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP |
| Ga0306925_106175363 | 3300031890 | Soil | YTHVNTAYKGPAVYLANNARPAVGLIDDQNVWSGMFRWQRNFYP |
| Ga0306925_116849762 | 3300031890 | Soil | YTHHNTAYKGPALYTANAPRPAVTLMDDQNVWSGIVRWQRNFYP |
| Ga0318551_102118542 | 3300031896 | Soil | FNTAYKGPAVYAANVARPAVGLIDDQNVWSVLFRWQRNFYP |
| Ga0310900_101639893 | 3300031908 | Soil | QHNNTAYKGPATLAANGSRPAVINGVIDDQNVWSAMFRWQRNFYP |
| Ga0306921_110809323 | 3300031912 | Soil | GPAVYLANNARPAVGLIDDQNVWSGMFRWQRNFYP |
| Ga0310903_100992501 | 3300032000 | Soil | RRNTAFKGAAIVPANLSRPAVFALDDQSVWSAMFRWQRNFYP |
| Ga0310899_100518051 | 3300032017 | Soil | GPAALAANGSRPAVVNGIIDDQNVWSAMFRWQRNFYP |
| Ga0310890_105261531 | 3300032075 | Soil | GAAVYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0268251_105592872 | 3300032159 | Agave | YKGPGTYAANGSRPAVGLFDDQGIWSAMFRWQRNFYP |
| Ga0310811_110913222 | 3300033475 | Soil | LYSHLTSAYKGPGIYPANTPRPAIAFIDDQNVWSAMFRWQRNFYP |
| Ga0247829_106466821 | 3300033550 | Soil | PIPGSIARIGAAIYAANGSRPAVALLDDQGVWSAMVRWQRNFYP |
| Ga0247830_101478052 | 3300033551 | Soil | GAGIYAANGSRPAVALLDDQGVWSAMFRWQRNFYP |
| Ga0364929_0080017_901_1014 | 3300034149 | Sediment | FKGAALVPANPSRPVVFALDDQDVISAMFRWQRNFYP |
| ⦗Top⦘ |