


| Basic Information | |
|---|---|
| Family ID | F046937 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 150 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MSEHGKCPMGKHPWLATFFVLAFLLVFLAHKLGLL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.00 % |
| % of genes near scaffold ends (potentially truncated) | 8.00 % |
| % of genes from short scaffolds (< 2000 bps) | 76.00 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.16% β-sheet: 0.00% Coil/Unstructured: 69.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 15.33 |
| PF00155 | Aminotran_1_2 | 15.33 |
| PF13424 | TPR_12 | 9.33 |
| PF13847 | Methyltransf_31 | 4.67 |
| PF14559 | TPR_19 | 4.67 |
| PF13519 | VWA_2 | 2.67 |
| PF13414 | TPR_11 | 2.00 |
| PF01464 | SLT | 2.00 |
| PF08545 | ACP_syn_III | 1.33 |
| PF13360 | PQQ_2 | 1.33 |
| PF00550 | PP-binding | 0.67 |
| PF00072 | Response_reg | 0.67 |
| PF01790 | LGT | 0.67 |
| PF00092 | VWA | 0.67 |
| PF13462 | Thioredoxin_4 | 0.67 |
| PF13620 | CarboxypepD_reg | 0.67 |
| PF04655 | APH_6_hur | 0.67 |
| PF13361 | UvrD_C | 0.67 |
| PF12773 | DZR | 0.67 |
| PF00348 | polyprenyl_synt | 0.67 |
| PF09723 | Zn-ribbon_8 | 0.67 |
| PF07719 | TPR_2 | 0.67 |
| PF13450 | NAD_binding_8 | 0.67 |
| PF01252 | Peptidase_A8 | 0.67 |
| PF07927 | HicA_toxin | 0.67 |
| PF13492 | GAF_3 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.33 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.67 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.67 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.00 % |
| Unclassified | root | N/A | 24.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000828|JGI12467J12023_1203259 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005554|Ga0066661_10122666 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300005560|Ga0066670_10500567 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005562|Ga0058697_10280984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300005562|Ga0058697_10800225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005566|Ga0066693_10218993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300005607|Ga0070740_10000619 | All Organisms → cellular organisms → Bacteria | 67670 | Open in IMG/M |
| 3300005616|Ga0068852_100630542 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1078 | Open in IMG/M |
| 3300005985|Ga0081539_10000230 | All Organisms → cellular organisms → Bacteria | 131269 | Open in IMG/M |
| 3300006032|Ga0066696_10956934 | Not Available | 545 | Open in IMG/M |
| 3300006794|Ga0066658_10498287 | Not Available | 663 | Open in IMG/M |
| 3300006800|Ga0066660_10485140 | Not Available | 1038 | Open in IMG/M |
| 3300006918|Ga0079216_10661894 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009177|Ga0105248_13442455 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300009789|Ga0126307_10621776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
| 3300009789|Ga0126307_11025312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300010036|Ga0126305_10330394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 995 | Open in IMG/M |
| 3300010037|Ga0126304_10043869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2690 | Open in IMG/M |
| 3300010039|Ga0126309_10589416 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010039|Ga0126309_11229806 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010040|Ga0126308_10871883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300010040|Ga0126308_10946772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300010041|Ga0126312_10420862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 951 | Open in IMG/M |
| 3300010042|Ga0126314_11105009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300010045|Ga0126311_10000352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 21944 | Open in IMG/M |
| 3300010045|Ga0126311_10320348 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300010045|Ga0126311_10541350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300010045|Ga0126311_11640435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300010166|Ga0126306_10031889 | All Organisms → Viruses → Predicted Viral | 3568 | Open in IMG/M |
| 3300010166|Ga0126306_10200548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1506 | Open in IMG/M |
| 3300010166|Ga0126306_11024666 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012043|Ga0136631_10140695 | Not Available | 929 | Open in IMG/M |
| 3300012045|Ga0136623_10444432 | Not Available | 548 | Open in IMG/M |
| 3300012093|Ga0136632_10020972 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300012093|Ga0136632_10124510 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012093|Ga0136632_10147205 | Not Available | 1083 | Open in IMG/M |
| 3300012093|Ga0136632_10150663 | Not Available | 1070 | Open in IMG/M |
| 3300012186|Ga0136620_10193452 | Not Available | 905 | Open in IMG/M |
| 3300012187|Ga0136622_10028791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2370 | Open in IMG/M |
| 3300012187|Ga0136622_10339853 | Not Available | 630 | Open in IMG/M |
| 3300012188|Ga0136618_10051129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1829 | Open in IMG/M |
| 3300012678|Ga0136615_10507172 | Not Available | 518 | Open in IMG/M |
| 3300012684|Ga0136614_10343229 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300014488|Ga0182001_10000033 | All Organisms → cellular organisms → Bacteria | 32773 | Open in IMG/M |
| 3300014488|Ga0182001_10000445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 8418 | Open in IMG/M |
| 3300014488|Ga0182001_10014058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1776 | Open in IMG/M |
| 3300014488|Ga0182001_10088434 | Not Available | 933 | Open in IMG/M |
| 3300014488|Ga0182001_10112304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 867 | Open in IMG/M |
| 3300014488|Ga0182001_10548063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300014488|Ga0182001_10625988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300015158|Ga0167622_1064121 | Not Available | 613 | Open in IMG/M |
| 3300017787|Ga0183260_10067153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2635 | Open in IMG/M |
| 3300017789|Ga0136617_10221541 | Not Available | 1586 | Open in IMG/M |
| 3300017789|Ga0136617_11276060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300018431|Ga0066655_10608368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300018431|Ga0066655_10686269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300018432|Ga0190275_11513188 | Not Available | 749 | Open in IMG/M |
| 3300018465|Ga0190269_10074158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1613 | Open in IMG/M |
| 3300018465|Ga0190269_10405647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 845 | Open in IMG/M |
| 3300018465|Ga0190269_10704593 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018466|Ga0190268_10730903 | Not Available | 734 | Open in IMG/M |
| 3300018466|Ga0190268_11046924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300018466|Ga0190268_11248254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300018468|Ga0066662_10026056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3383 | Open in IMG/M |
| 3300018468|Ga0066662_10602301 | Not Available | 1028 | Open in IMG/M |
| 3300018468|Ga0066662_11038924 | Not Available | 814 | Open in IMG/M |
| 3300018468|Ga0066662_11325738 | Not Available | 739 | Open in IMG/M |
| 3300018468|Ga0066662_11986512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300018890|Ga0193595_1045418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1456 | Open in IMG/M |
| 3300018892|Ga0193607_1000752 | All Organisms → cellular organisms → Bacteria | 15671 | Open in IMG/M |
| 3300018918|Ga0193616_1107135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 782 | Open in IMG/M |
| 3300018920|Ga0190273_10547538 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300018920|Ga0190273_11081763 | Not Available | 670 | Open in IMG/M |
| 3300018920|Ga0190273_11131568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300018920|Ga0190273_11386857 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300018939|Ga0193593_1001390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6907 | Open in IMG/M |
| 3300018946|Ga0193599_1003040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6858 | Open in IMG/M |
| 3300019142|Ga0193597_1000118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 56714 | Open in IMG/M |
| 3300019377|Ga0190264_12340332 | Not Available | 503 | Open in IMG/M |
| 3300019767|Ga0190267_10392446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300019767|Ga0190267_10987983 | Not Available | 589 | Open in IMG/M |
| 3300019767|Ga0190267_11241922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300019767|Ga0190267_11367411 | Not Available | 534 | Open in IMG/M |
| 3300019767|Ga0190267_11523347 | Not Available | 517 | Open in IMG/M |
| 3300019767|Ga0190267_11550292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300019767|Ga0190267_11627847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300020146|Ga0196977_1000180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 39865 | Open in IMG/M |
| 3300020146|Ga0196977_1044983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1056 | Open in IMG/M |
| 3300020146|Ga0196977_1048908 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300020154|Ga0196965_1044281 | Not Available | 1164 | Open in IMG/M |
| 3300020202|Ga0196964_10025536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2439 | Open in IMG/M |
| 3300020202|Ga0196964_10206898 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 909 | Open in IMG/M |
| 3300020202|Ga0196964_10227079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300020215|Ga0196963_10028780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2354 | Open in IMG/M |
| 3300020215|Ga0196963_10238868 | Not Available | 791 | Open in IMG/M |
| 3300020215|Ga0196963_10294281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 715 | Open in IMG/M |
| 3300021067|Ga0196978_1000004 | All Organisms → cellular organisms → Bacteria | 561312 | Open in IMG/M |
| 3300021362|Ga0213882_10377371 | Not Available | 597 | Open in IMG/M |
| 3300021374|Ga0213881_10268513 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300021384|Ga0213876_10000479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 31639 | Open in IMG/M |
| 3300021384|Ga0213876_10002219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 11456 | Open in IMG/M |
| 3300021445|Ga0182009_10243479 | Not Available | 890 | Open in IMG/M |
| 3300024430|Ga0196962_10078835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300026142|Ga0207698_11856307 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300026312|Ga0209153_1000614 | All Organisms → cellular organisms → Bacteria | 15298 | Open in IMG/M |
| 3300026312|Ga0209153_1313299 | Not Available | 504 | Open in IMG/M |
| 3300026325|Ga0209152_10183418 | Not Available | 785 | Open in IMG/M |
| 3300026552|Ga0209577_10356066 | Not Available | 1075 | Open in IMG/M |
| 3300026552|Ga0209577_10430043 | Not Available | 933 | Open in IMG/M |
| 3300027618|Ga0208736_1167518 | Not Available | 507 | Open in IMG/M |
| 3300027706|Ga0209581_1001113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 35423 | Open in IMG/M |
| 3300027750|Ga0209461_10004046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2436 | Open in IMG/M |
| 3300027766|Ga0209796_10252653 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300030510|Ga0268243_1052840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 882 | Open in IMG/M |
| 3300030513|Ga0268242_1000027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20245 | Open in IMG/M |
| 3300030513|Ga0268242_1004788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2015 | Open in IMG/M |
| 3300031731|Ga0307405_11214944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300031740|Ga0307468_100228234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1288 | Open in IMG/M |
| 3300031852|Ga0307410_10610671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 911 | Open in IMG/M |
| 3300031901|Ga0307406_11952211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300031995|Ga0307409_101233600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300032126|Ga0307415_100541082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300034000|Ga0334918_014115 | Not Available | 1091 | Open in IMG/M |
| 3300034000|Ga0334918_044632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300034002|Ga0334920_000054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 42502 | Open in IMG/M |
| 3300034005|Ga0334930_016575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300034005|Ga0334930_051026 | Not Available | 699 | Open in IMG/M |
| 3300034005|Ga0334930_053781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300034007|Ga0334936_119738 | Not Available | 551 | Open in IMG/M |
| 3300034009|Ga0334944_003311 | All Organisms → cellular organisms → Bacteria | 3166 | Open in IMG/M |
| 3300034024|Ga0334927_005218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4458 | Open in IMG/M |
| 3300034026|Ga0334946_000882 | All Organisms → Viruses → Predicted Viral | 4686 | Open in IMG/M |
| 3300034030|Ga0334952_000691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16361 | Open in IMG/M |
| 3300034031|Ga0334953_034034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300034135|Ga0334929_001695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6212 | Open in IMG/M |
| 3300034135|Ga0334929_037081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300034137|Ga0334943_009212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1849 | Open in IMG/M |
| 3300034137|Ga0334943_083427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300034143|Ga0334961_000528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 8232 | Open in IMG/M |
| 3300034143|Ga0334961_006993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1840 | Open in IMG/M |
| 3300034143|Ga0334961_018297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1175 | Open in IMG/M |
| 3300034144|Ga0334962_004981 | Not Available | 1514 | Open in IMG/M |
| 3300034172|Ga0334913_000065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 101809 | Open in IMG/M |
| 3300034172|Ga0334913_000170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 49061 | Open in IMG/M |
| 3300034251|Ga0334947_083467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300034376|Ga0334923_031596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
| 3300034377|Ga0334931_018973 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300034377|Ga0334931_042254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300034392|Ga0334912_039233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 591 | Open in IMG/M |
| 3300034760|Ga0334948_010092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2211 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.67% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 11.33% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 10.67% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.33% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.67% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 4.67% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 3.33% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.33% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.33% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.33% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.33% |
| Polar Desert | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert | 0.67% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.67% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000828 | Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate C) D5C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018890 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018892 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018918 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300018939 | Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018946 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019142 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid late stage, 3 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020154 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_20 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021067 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027618 | Polar desert microbial communities from Antarctic Dry Valleys - UQ255 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
| 3300034002 | Biocrust microbial communities from Mojave Desert, California, United States - 16HMC | Environmental | Open in IMG/M |
| 3300034005 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNS | Environmental | Open in IMG/M |
| 3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
| 3300034009 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS | Environmental | Open in IMG/M |
| 3300034024 | Biocrust microbial communities from Mojave Desert, California, United States - 23HNC | Environmental | Open in IMG/M |
| 3300034026 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS | Environmental | Open in IMG/M |
| 3300034030 | Biocrust microbial communities from Mojave Desert, California, United States - 48SNC | Environmental | Open in IMG/M |
| 3300034031 | Biocrust microbial communities from Mojave Desert, California, United States - 49SNC | Environmental | Open in IMG/M |
| 3300034135 | Biocrust microbial communities from Mojave Desert, California, United States - 25HNC | Environmental | Open in IMG/M |
| 3300034137 | Biocrust microbial communities from Mojave Desert, California, United States - 39SMC | Environmental | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| 3300034144 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 58SNS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034251 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| 3300034392 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 8HMS | Environmental | Open in IMG/M |
| 3300034760 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 44SMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12467J12023_12032591 | 3300000828 | Soil | AAMSESDKCPMGNHPWLATFLVVAFLLVFAAKKLGWL* |
| Ga0066661_101226662 | 3300005554 | Soil | MSEHGTCPMGRHPWLATFFVLAFVLVFLAHKLGLL* |
| Ga0066670_105005672 | 3300005560 | Soil | MSEHGKCPMGKHPWPATFFVLAFLLVFLAHKLGLL* |
| Ga0058697_102809841 | 3300005562 | Agave | SEHGKCPMGKHPWLATFLVIAFFLVFAAHKLGLL* |
| Ga0058697_108002252 | 3300005562 | Agave | MSEHGKCPMGKHPWLATFLVLAFVLIFFAHKLGLL* |
| Ga0066693_102189932 | 3300005566 | Soil | MSEHGKCPMGKYPWLATFLVLAFVLVFLAHKLGLL* |
| Ga0070740_1000061947 | 3300005607 | Surface Soil | MSEHGKCPMGKHPWLATFFVLAFVLVFIAHKLGLL* |
| Ga0068852_1006305421 | 3300005616 | Corn Rhizosphere | MSMSEHDKCPMGKHPWAATFFVLAFVLVFFAHKLGLL* |
| Ga0081539_1000023092 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MSTQGKCPMGNHPWLATFLVIAFLLIFAAKKLGLF* |
| Ga0066696_109569342 | 3300006032 | Soil | MSEHGKCPMGKHPWLATFFVLAFLLVFLAHKLGLL* |
| Ga0066658_104982872 | 3300006794 | Soil | MSEHGKCPMGKHPWLATFFVLAFVLVFLAHKLGLL* |
| Ga0066660_104851402 | 3300006800 | Soil | MSEHGKCPMGKHPWLATFLVLAFVLVFVAHKLGLL* |
| Ga0079216_106618942 | 3300006918 | Agricultural Soil | MSEHGKCPMGKHPWLATFFVLTFLLVFLAHKLGLL* |
| Ga0105248_134424551 | 3300009177 | Switchgrass Rhizosphere | MSEHGKCPMGKYPWLATFFALAFILVFLAHKLGLL* |
| Ga0126307_106217762 | 3300009789 | Serpentine Soil | SEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL* |
| Ga0126307_110253121 | 3300009789 | Serpentine Soil | MSEHGKCPMGKYPRLATFFALAFALIFLAHKLGLL* |
| Ga0126305_103303942 | 3300010036 | Serpentine Soil | MSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL* |
| Ga0126304_100438692 | 3300010037 | Serpentine Soil | MSEHGKCPMGKYPWLATFFALTFVLVFLAHKLGLL* |
| Ga0126309_105894162 | 3300010039 | Serpentine Soil | MSEHGKCPMGKYPWAATFFALAFILVFLAHKLGLL* |
| Ga0126309_112298062 | 3300010039 | Serpentine Soil | MSEHGKCPMGKHPWLATFGTLTFLLVFLAHKLGLL* |
| Ga0126308_108718831 | 3300010040 | Serpentine Soil | MSEHGKCPMGKHPWLATFFVLAFLLVFFAHKLGLL* |
| Ga0126308_109467721 | 3300010040 | Serpentine Soil | MSEHGKCPMGTHPWLATFFALAFVLVFLAHKLGLL* |
| Ga0126312_104208622 | 3300010041 | Serpentine Soil | MSEHGKCPMGKYPWLATFFALAFALVFLAHKLGLL* |
| Ga0126314_111050092 | 3300010042 | Serpentine Soil | MSEHGKCPMGKHPWLATFFVLAFILIFFAHKLGLL* |
| Ga0126311_1000035214 | 3300010045 | Serpentine Soil | MSEHGKCPMGKYPWLATFLVIAFFLVFAAHKLGLL* |
| Ga0126311_103203482 | 3300010045 | Serpentine Soil | MSERDKCPMGKHPWLATFGALTFLLVFLAHKLGLL* |
| Ga0126311_105413502 | 3300010045 | Serpentine Soil | MSERDKCPMGKHPLLATFGVLTFLLVFLAHKLGLL* |
| Ga0126311_116404352 | 3300010045 | Serpentine Soil | MNEHGKCPMGKYPWLATFFALAFALVFLAHKLGLL* |
| Ga0126306_100318893 | 3300010166 | Serpentine Soil | MSEHGKCPMGKYPWLATFLAVAFFLVFAAHKLGLL* |
| Ga0126306_102005481 | 3300010166 | Serpentine Soil | MSEHGKCPMGKYPRLATFFAVAFILVFLAHKLGLL* |
| Ga0126306_110246662 | 3300010166 | Serpentine Soil | MSEHGKCPMGKYPRLATFFALAFVLVFLALKLGLL* |
| Ga0136631_101406952 | 3300012043 | Polar Desert Sand | VKAMSEEQKCPMGKHPWLATLLAVAFLLVFAAKQLGLI* |
| Ga0136623_104444322 | 3300012045 | Polar Desert Sand | MNDNSKCPMGNHPWLATFLAVAFILLFLSKKFGLL* |
| Ga0136632_100209724 | 3300012093 | Polar Desert Sand | MSEHNKCPMGTHPWLATFLALAFILVFLANKLGLL* |
| Ga0136632_101245103 | 3300012093 | Polar Desert Sand | MYKTMSEENKCPMGKHPWLATFLAVAFLLVFAAKQLGFL* |
| Ga0136632_101472052 | 3300012093 | Polar Desert Sand | MSEEQKCPMGKHPWLATLLAVAFLLVFAAKQLGLI* |
| Ga0136632_101506632 | 3300012093 | Polar Desert Sand | MSDNSKCPMGNHPWLATFLAVAFILLFLSKKFGLL* |
| Ga0136620_101934521 | 3300012186 | Polar Desert Sand | MAEEEGKCPMGKNPRLATFLVVAFVLLFLARKLALW* |
| Ga0136622_100287913 | 3300012187 | Polar Desert Sand | MDEEDKCPMGKRPWLATFLVVAFLLFFLAHKLGVL* |
| Ga0136622_103398532 | 3300012187 | Polar Desert Sand | MAKEEGKCPLGKNPWLATFLVVTFVLLFLARKLALW* |
| Ga0136618_100511292 | 3300012188 | Polar Desert Sand | MCKMMSEENKCPMGKHPWLATFLAVAFLLVFAAKQLGFL* |
| Ga0136615_105071721 | 3300012678 | Polar Desert Sand | MCKTMSEENKCPMGKHPWLATFLAVAFLLVFAAKQLGFL* |
| Ga0136614_103432292 | 3300012684 | Polar Desert Sand | MSDNSKCPMGNHPWLATFLAVAFILLFLSKKLGLL* |
| Ga0182001_100000336 | 3300014488 | Soil | MSSGGKCPMGKHPWLATMLVVAFLLCVVAKWLGWLY* |
| Ga0182001_100004458 | 3300014488 | Soil | MAEHGKCPMGKHPWLATFFALAFILGYFAHKLGLL* |
| Ga0182001_100140582 | 3300014488 | Soil | MSDDGKCPMGKHPWLATFLALAFILTFLASKLGLL* |
| Ga0182001_100884341 | 3300014488 | Soil | MSEHGKCPMGKHPWLATFGALTFLLVFLAHKLGLL* |
| Ga0182001_101123042 | 3300014488 | Soil | MSEHGKCPMGNHPWLATFFVLAFLLVFIAHKLGLL* |
| Ga0182001_105480632 | 3300014488 | Soil | VSEGGKCPMGKHPWLATFLALAFILVFLASKLGLL* |
| Ga0182001_106259882 | 3300014488 | Soil | MSEHGKCPMGKHPWAATFFVLTFLLVFVAHKLGWL* |
| Ga0167622_10641212 | 3300015158 | Glacier Forefield Soil | ENADKCPMGNHPWLATFLALAFILIFVAHKMGLV* |
| Ga0183260_100671531 | 3300017787 | Polar Desert Sand | MAEEEGKCPLGKNPWLATFLVVAFVLLFLARKLALW |
| Ga0136617_102215412 | 3300017789 | Polar Desert Sand | MSEPDKCPMGKYPWLATFLALAFILVFLASKLGLL |
| Ga0136617_112760602 | 3300017789 | Polar Desert Sand | MSEEQKCPMGKHPWLATLLAVAFLLVFAAKQLGLI |
| Ga0066655_106083681 | 3300018431 | Grasslands Soil | MSEHGKCPMGKYPWLATFLVLAFVLVFLAHKLGLL |
| Ga0066655_106862692 | 3300018431 | Grasslands Soil | MSEHGKCPMGKHPWLATFFVLAFLLVFLAHKLGLL |
| Ga0190275_115131882 | 3300018432 | Soil | MSEHGKCPMGNHPWAASFFVLTFLLVFVAHKLGLL |
| Ga0190269_100741582 | 3300018465 | Soil | MAEHGKCPMGNHPWLATFFALAFILGYLAHKLGLL |
| Ga0190269_104056472 | 3300018465 | Soil | MSEHGKCPMGKHPWLATFGALTFLLVFLAHKLGLL |
| Ga0190269_107045932 | 3300018465 | Soil | MSEHGKCPMGKHPWLATFGVLTFLLVFVAHKLGLL |
| Ga0190268_107309032 | 3300018466 | Soil | MADESKCPMGRHAWLATFLVVAFVLLFFSRKLGLL |
| Ga0190268_110469242 | 3300018466 | Soil | MAEEEGKCPMGKNPWLATFLVVAFVLLFLAHKLGLV |
| Ga0190268_112482541 | 3300018466 | Soil | MREHGKCPMGKHPWLATFFALTFLLVFLAHKLGLL |
| Ga0066662_100260563 | 3300018468 | Grasslands Soil | MSEHGTCPMGRHPWLATFFVLAFVLVFLAHKLGLL |
| Ga0066662_106023011 | 3300018468 | Grasslands Soil | MSEHGKCPMGKHPWPATLFVLAFLLVFLAHKLGLL |
| Ga0066662_110389242 | 3300018468 | Grasslands Soil | MSEHGKCPMGKHPWLATFLVLAFVLVFVAHKLGLL |
| Ga0066662_113257381 | 3300018468 | Grasslands Soil | MSEHGKCPMGKHPWLATFLVLAFILVFLAHKLGLL |
| Ga0066662_119865122 | 3300018468 | Grasslands Soil | MSEHGKCPMGNHPWLATFFVLAFILVLVAHKLGLL |
| Ga0193595_10454182 | 3300018890 | Soil | MSEHGKCPMGKHPWLATFFVLTFLLVFLAHKLGLL |
| Ga0193607_100075215 | 3300018892 | Soil | MNESDKCPMGNHPWLATFLVVAFLLVFAAKKLGWL |
| Ga0193616_11071352 | 3300018918 | Soil | MSEHGKCPMGKHPWLATFFALTFVLVFLAHKLGLL |
| Ga0190273_105475382 | 3300018920 | Soil | MSESGKCPMGKHPWLATMLVIAFFLVFIAKSLGWLY |
| Ga0190273_110817631 | 3300018920 | Soil | MSDDGKCPMGKHPWLATFLALAFILTFLASKLGLL |
| Ga0190273_111315681 | 3300018920 | Soil | MNEPGKCPMGKYPWLATFLVIAFFLVFAAHKLGLL |
| Ga0190273_113868572 | 3300018920 | Soil | MSEHGKCPMGNHPRLATFFVFTFLLVFLAHKLGLL |
| Ga0193593_10013902 | 3300018939 | Soil | MSESDKCPMGNHPWLATFLVVAFLLVFAAKKLGWL |
| Ga0193599_10030402 | 3300018946 | Soil | MAEHGKCPMGNHPWLATFFALAFILVFAAHKLGLL |
| Ga0193597_100011831 | 3300019142 | Soil | MSESEKCPMGNHPWLATFLVVAFLLVFAAKKLGWL |
| Ga0190264_123403322 | 3300019377 | Soil | MSDDGKCPMGKHPWLATFLALAFILTYAASKLGLL |
| Ga0190267_103924462 | 3300019767 | Soil | MSEHGKCPMGKHPWLATFLALAFILVFLASKLGFI |
| Ga0190267_109879832 | 3300019767 | Soil | MSERDKCPMGKHPWLATFGALTFLLVFLAHKLGLL |
| Ga0190267_112419222 | 3300019767 | Soil | MSEHGKCPMGKHPWLATFGVLTFLLVFLAHKLGML |
| Ga0190267_113674112 | 3300019767 | Soil | MSDGGKCPLGKNAWLATFLVVAFVLLFLSRKLGLL |
| Ga0190267_115233471 | 3300019767 | Soil | MAEDEGKCPMGKNPWLATFLLVAFLLIFLAKKLGLL |
| Ga0190267_115502921 | 3300019767 | Soil | PYTQHPMSMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL |
| Ga0190267_116278471 | 3300019767 | Soil | MSEHGKCPMGKHPWLATFLVVAFFLVFAAHKLGLL |
| Ga0196977_100018023 | 3300020146 | Soil | MSEGGKCPMGRHPWLATFLALAFALAFLASKLGLL |
| Ga0196977_10449832 | 3300020146 | Soil | MSEHGKCPMGKHPWVATFFVLAFVLIFFAHKLGLL |
| Ga0196977_10489082 | 3300020146 | Soil | MSGGGKCPMGKHPWLAAFLALAFVLVFMASKLGLL |
| Ga0196965_10442812 | 3300020154 | Soil | MADEGKCPMGRHAWLATFLVVAFVLLFFSKKLGLL |
| Ga0196964_100255365 | 3300020202 | Soil | MSEGGKCPMGKHAWLATFLVVAFVLMFLSRKLGLL |
| Ga0196964_102068982 | 3300020202 | Soil | MSEHGKCPMGRHPWLATFFVLAFVLVFLAHKLGLL |
| Ga0196964_102270792 | 3300020202 | Soil | VSEGGNKCPMGKNPWLATFLALAFVLTYLASKLGLL |
| Ga0196963_100287804 | 3300020215 | Soil | MSERGKCPMGNHPWLATFLALAFILVFLASKLGLL |
| Ga0196963_102388681 | 3300020215 | Soil | MTEGGKCPMGKHPWLATFLALAFILTFLASKFGLL |
| Ga0196963_102942812 | 3300020215 | Soil | MSEHGKCPMGKHPWLATFFVLAFVLIFFAHKLGLL |
| Ga0196978_1000004439 | 3300021067 | Soil | MSEQGKCPMGKHPWVATFFVLAFVLIFFAHKLGLL |
| Ga0213882_103773711 | 3300021362 | Exposed Rock | PGTQHPMSLSEHGKCPMGKHPWLATFLVLAFVLVFLAHKLGLL |
| Ga0213881_102685132 | 3300021374 | Exposed Rock | MSEGGKCPMGKHPWLATMLVVAFFLCVIAKWLGWLY |
| Ga0213876_100004792 | 3300021384 | Plant Roots | MSLSEHGKCPMGKHPWLATFLVLAFVLVFLAHKLGLL |
| Ga0213876_100022193 | 3300021384 | Plant Roots | MSEHGKCPMGKHPWVATFFVLAFILIFFAHKLGLL |
| Ga0182009_102434792 | 3300021445 | Soil | MSEHGKCPMGKYPWLATFFALAFILVFLAHKLGLL |
| Ga0196962_100788353 | 3300024430 | Soil | MGEAAVSEGGKCPMGKHPWLATFLALAFALVFLASKLGLL |
| Ga0207698_118563072 | 3300026142 | Corn Rhizosphere | MSMSEHDKCPMGKHPWAATFFVLAFVLVFFAHKLGLL |
| Ga0209153_10006142 | 3300026312 | Soil | MSNGNKCPMGKHPWLATFLVIAFLLIFAAKKLGLF |
| Ga0209153_13132991 | 3300026312 | Soil | MSDGNKCPMGKYPWLATFLVIAFLLIFAAKKLGLF |
| Ga0209152_101834182 | 3300026325 | Soil | MSEHGKCPMGKHPWPATFFVLAFLLVFLAHKLGLL |
| Ga0209577_103560662 | 3300026552 | Soil | MSEHGKCPMGKHPWLATFLVLAFVLVFLAHKLGLL |
| Ga0209577_104300431 | 3300026552 | Soil | MSEHDKCPMGKHPWLATFFVLAFVLVFLAHKLGLL |
| Ga0208736_11675182 | 3300027618 | Polar Desert | MNDNSKCPMGNHPWLATFLAVAFILLFLSKKFGLL |
| Ga0209581_10011138 | 3300027706 | Surface Soil | MSEHGKCPMGKHPWLATFFVLAFVLVFIAHKLGLL |
| Ga0209461_100040463 | 3300027750 | Agave | MNEHGKCPMGKHPWLATFFVLAFVLVFLAHKLGLL |
| Ga0209796_102526531 | 3300027766 | Agave | MSEHGKCPMGKHPWAATFFVLAFLLVFLAHKLGLL |
| Ga0268243_10528402 | 3300030510 | Soil | MSEHGKCPMGKHPWLATFFVLAFVLVFLAHKLGLL |
| Ga0268242_10000276 | 3300030513 | Soil | MSSGGKCPMGKHPWLATMLVVAFLLCVVAKWLGWLY |
| Ga0268242_10047883 | 3300030513 | Soil | MAEHGKCPMGKHPWLATFFALAFILGYFAHKLGLL |
| Ga0307405_112149442 | 3300031731 | Rhizosphere | MSMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL |
| Ga0307468_1002282342 | 3300031740 | Hardwood Forest Soil | MSEHGKCPMGKHPWLATFFVLAFFLVFAAHKLGLL |
| Ga0307410_106106712 | 3300031852 | Rhizosphere | MSMSEHGKCPMGKYPRLATFFVLAFVLVFLAHKLGLL |
| Ga0307406_119522112 | 3300031901 | Rhizosphere | MSEHGKCPMGKHPWLATFFALAFILVFLAHKLGLL |
| Ga0307409_1012336002 | 3300031995 | Rhizosphere | SMSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL |
| Ga0307415_1005410821 | 3300032126 | Rhizosphere | MSEHGKCPMGKYPWLATFFALAFVLVFLAHKLGLL |
| Ga0334918_014115_117_227 | 3300034000 | Hypolithic Biocrust | MEEGNKCPMGNHPWLATFLVVAFILCFIASKLGWLY |
| Ga0334918_044632_416_523 | 3300034000 | Hypolithic Biocrust | MSEHGKCPMGKHPWVATFFVLAFLLVFLAHKLGLL |
| Ga0334920_000054_8936_9043 | 3300034002 | Hypolithic Biocrust | MSEHGKCPMGKHPWAATFFVLTFLLVFLAHKLGLL |
| Ga0334930_016575_842_949 | 3300034005 | Sub-Biocrust Soil | MSENDKCPMGKHPWLATFGVLTFLLVFLAHKLGLL |
| Ga0334930_051026_166_276 | 3300034005 | Sub-Biocrust Soil | MGEEGGKCPMGKNPWLATFLLLAFILILLGKKLGLL |
| Ga0334930_053781_422_529 | 3300034005 | Sub-Biocrust Soil | MSERGKCPMGNHPWAATFFVLTFLLVFVAHKLGWL |
| Ga0334936_119738_385_492 | 3300034007 | Biocrust | MAEHGKCPMGNHPWLATFFALAFILVFLAHKLGLL |
| Ga0334944_003311_1710_1817 | 3300034009 | Sub-Biocrust Soil | MSEHGKCPMGKHPWLATFFVLTFLLVFAAHKLGLL |
| Ga0334927_005218_2766_2873 | 3300034024 | Hypolithic Biocrust | MSEHGKCPMGKYPRLATFFALAFVLVFLAHKLGLL |
| Ga0334946_000882_2347_2454 | 3300034026 | Sub-Biocrust Soil | MSEHGKCPMGNHPWLATFFVLTFLLVFAAHKLGLL |
| Ga0334952_000691_3166_3273 | 3300034030 | Biocrust | MSEHGKCPMGKHPWLATFFVLTFLLVFAAHKLGML |
| Ga0334953_034034_95_202 | 3300034031 | Biocrust | MSENGKCPMGKHPWLATFFVLTFLMVFLAHKLGLL |
| Ga0334929_001695_3390_3497 | 3300034135 | Hypolithic Biocrust | MSEHGKCPMGKHPWLATFFVLTFLLVFIAHKLGLL |
| Ga0334929_037081_123_230 | 3300034135 | Hypolithic Biocrust | MSEHGKCPMGKYPWLATFFALAFVLVFFAHKLGLL |
| Ga0334943_009212_1379_1486 | 3300034137 | Biocrust | MSEHGKCPMGKHPWAATFFVLTFLLVFVAHKLGWL |
| Ga0334943_083427_73_180 | 3300034137 | Biocrust | MSEESKCPMGKYPRLAAFLALAFILLFLSKKFGLL |
| Ga0334961_000528_4205_4315 | 3300034143 | Sub-Biocrust Soil | VSEGGKCPMGKHPWLATMLVVAFLLCFIAKSLGWLY |
| Ga0334961_006993_322_459 | 3300034143 | Sub-Biocrust Soil | VRARGNLGGAVSEGGKCPMGNHPWLATFLALAFVLVFLASKLGLL |
| Ga0334961_018297_869_976 | 3300034143 | Sub-Biocrust Soil | MSEHGKCPMGNHPWLATFFALAFVLVFLAHKLGLL |
| Ga0334962_004981_1305_1415 | 3300034144 | Sub-Biocrust Soil | MTEEGGKCPMGKNPWLATFLVVAFVLLFLAHQLGLM |
| Ga0334913_000065_77023_77130 | 3300034172 | Sub-Biocrust Soil | MGDGGKCPMGKHPWLATFLLLAFLLVVAAKKLGLI |
| Ga0334913_000170_42160_42270 | 3300034172 | Sub-Biocrust Soil | MAEEGGKCPMGKNPWLATFLVVAFILIFAAKKLGLF |
| Ga0334947_083467_507_614 | 3300034251 | Sub-Biocrust Soil | MREPDKCPMGKHPWLATFFALTFMLVFLAHKLGLL |
| Ga0334923_031596_802_909 | 3300034376 | Hypolithic Biocrust | MNEHGKCPMGNHPWLATFFALAFILVFLAHKLGLL |
| Ga0334931_018973_1166_1276 | 3300034377 | Sub-Biocrust Soil | MSESGKCPMGKHPWLATMLVVAFFLVFIAKSLGWLY |
| Ga0334931_042254_407_514 | 3300034377 | Sub-Biocrust Soil | MSEENRCPMGNHPWLATFLALAFILLFLAKKLGLL |
| Ga0334912_039233_193_300 | 3300034392 | Sub-Biocrust Soil | LSEGAKCPMGKYPWLATFLALAFFLVFIASKLGLL |
| Ga0334948_010092_888_995 | 3300034760 | Sub-Biocrust Soil | MSDDGKCPMGKHPWLATFLALAFILTFLASKFGLL |
| ⦗Top⦘ |