


| Basic Information | |
|---|---|
| Family ID | F046885 |
| Family Type | Metagenome |
| Number of Sequences | 150 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VSDSDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.00 % |
| % of genes near scaffold ends (potentially truncated) | 89.33 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.667 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.333 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 4.67 |
| PF04392 | ABC_sub_bind | 3.33 |
| PF00589 | Phage_integrase | 2.00 |
| PF00239 | Resolvase | 2.00 |
| PF13493 | DUF4118 | 1.33 |
| PF01391 | Collagen | 1.33 |
| PF05711 | TylF | 0.67 |
| PF13340 | DUF4096 | 0.67 |
| PF01068 | DNA_ligase_A_M | 0.67 |
| PF01844 | HNH | 0.67 |
| PF00311 | PEPcase | 0.67 |
| PF03401 | TctC | 0.67 |
| PF00816 | Histone_HNS | 0.67 |
| PF13586 | DDE_Tnp_1_2 | 0.67 |
| PF01609 | DDE_Tnp_1 | 0.67 |
| PF02668 | TauD | 0.67 |
| PF00128 | Alpha-amylase | 0.67 |
| PF13409 | GST_N_2 | 0.67 |
| PF01809 | YidD | 0.67 |
| PF13358 | DDE_3 | 0.67 |
| PF13424 | TPR_12 | 0.67 |
| PF01548 | DEDD_Tnp_IS110 | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.33 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.00 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 2.00 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.67 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.67 |
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.67 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.67 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.67 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.67 |
| COG2352 | Phosphoenolpyruvate carboxylase | Energy production and conversion [C] | 0.67 |
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.67 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.67 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.67 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.67 % |
| Unclassified | root | N/A | 35.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10014348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2177 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10064429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10091301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10168673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10173119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1085526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10114259 | Not Available | 566 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1002552 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1005875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1736 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1019400 | Not Available | 955 | Open in IMG/M |
| 3300004633|Ga0066395_10015873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2902 | Open in IMG/M |
| 3300005332|Ga0066388_100794039 | Not Available | 1540 | Open in IMG/M |
| 3300005332|Ga0066388_101476141 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300005332|Ga0066388_101757618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300005332|Ga0066388_105108345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 666 | Open in IMG/M |
| 3300005332|Ga0066388_107547715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300005435|Ga0070714_101952233 | Not Available | 573 | Open in IMG/M |
| 3300005561|Ga0066699_10602805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300005566|Ga0066693_10129574 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300005569|Ga0066705_10811373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
| 3300005713|Ga0066905_101412170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300005713|Ga0066905_101695578 | Not Available | 580 | Open in IMG/M |
| 3300005713|Ga0066905_101893897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300005764|Ga0066903_100315122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20 | 2491 | Open in IMG/M |
| 3300005764|Ga0066903_101658273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1215 | Open in IMG/M |
| 3300005764|Ga0066903_103237620 | Not Available | 880 | Open in IMG/M |
| 3300005764|Ga0066903_103251531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300005764|Ga0066903_103532682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300005764|Ga0066903_106229866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300005764|Ga0066903_106339876 | Not Available | 617 | Open in IMG/M |
| 3300005764|Ga0066903_106359585 | Not Available | 616 | Open in IMG/M |
| 3300005764|Ga0066903_108151178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Salinarimonadaceae → Salinarimonas → Salinarimonas rosea | 536 | Open in IMG/M |
| 3300005764|Ga0066903_108888838 | Not Available | 509 | Open in IMG/M |
| 3300006845|Ga0075421_101796668 | Not Available | 660 | Open in IMG/M |
| 3300009012|Ga0066710_103281674 | Not Available | 619 | Open in IMG/M |
| 3300009147|Ga0114129_12005759 | Not Available | 700 | Open in IMG/M |
| 3300009162|Ga0075423_10188591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2164 | Open in IMG/M |
| 3300009792|Ga0126374_10842841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 705 | Open in IMG/M |
| 3300010043|Ga0126380_12200045 | Not Available | 510 | Open in IMG/M |
| 3300010046|Ga0126384_10302949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1314 | Open in IMG/M |
| 3300010046|Ga0126384_10436976 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300010046|Ga0126384_11625010 | Not Available | 609 | Open in IMG/M |
| 3300010047|Ga0126382_11283653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300010047|Ga0126382_11832745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300010048|Ga0126373_10898858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 949 | Open in IMG/M |
| 3300010358|Ga0126370_12556426 | Not Available | 510 | Open in IMG/M |
| 3300010360|Ga0126372_10471922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1169 | Open in IMG/M |
| 3300010361|Ga0126378_10024092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5328 | Open in IMG/M |
| 3300010362|Ga0126377_11550465 | Not Available | 737 | Open in IMG/M |
| 3300010366|Ga0126379_12669308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300010376|Ga0126381_104619702 | Not Available | 531 | Open in IMG/M |
| 3300010398|Ga0126383_10283025 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300010398|Ga0126383_10578119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1192 | Open in IMG/M |
| 3300010398|Ga0126383_10743737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300010398|Ga0126383_12584932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300010398|Ga0126383_12897914 | Not Available | 560 | Open in IMG/M |
| 3300012202|Ga0137363_10593439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
| 3300012204|Ga0137374_10970630 | Not Available | 617 | Open in IMG/M |
| 3300012207|Ga0137381_11415245 | Not Available | 587 | Open in IMG/M |
| 3300012208|Ga0137376_11753084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300012210|Ga0137378_10338859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1398 | Open in IMG/M |
| 3300012349|Ga0137387_11183722 | Not Available | 540 | Open in IMG/M |
| 3300012351|Ga0137386_10094753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2106 | Open in IMG/M |
| 3300012354|Ga0137366_10886693 | Not Available | 629 | Open in IMG/M |
| 3300012357|Ga0137384_11470399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300012358|Ga0137368_10514567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 770 | Open in IMG/M |
| 3300012359|Ga0137385_11087943 | Not Available | 658 | Open in IMG/M |
| 3300012532|Ga0137373_10002797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19138 | Open in IMG/M |
| 3300012929|Ga0137404_11126995 | Not Available | 720 | Open in IMG/M |
| 3300012930|Ga0137407_10284496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1508 | Open in IMG/M |
| 3300012948|Ga0126375_10022339 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300012948|Ga0126375_10181587 | Not Available | 1362 | Open in IMG/M |
| 3300012948|Ga0126375_10327879 | Not Available | 1075 | Open in IMG/M |
| 3300012948|Ga0126375_11085985 | Not Available | 658 | Open in IMG/M |
| 3300012971|Ga0126369_13459031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300016270|Ga0182036_10012542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4566 | Open in IMG/M |
| 3300016270|Ga0182036_10741904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300016270|Ga0182036_11285769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300016270|Ga0182036_11934621 | Not Available | 500 | Open in IMG/M |
| 3300016294|Ga0182041_11250422 | Not Available | 678 | Open in IMG/M |
| 3300016319|Ga0182033_10347820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1239 | Open in IMG/M |
| 3300016341|Ga0182035_10703281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 881 | Open in IMG/M |
| 3300016341|Ga0182035_10779826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300016387|Ga0182040_10353265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
| 3300016387|Ga0182040_10599827 | Not Available | 891 | Open in IMG/M |
| 3300016404|Ga0182037_11126062 | Not Available | 687 | Open in IMG/M |
| 3300016422|Ga0182039_11518128 | Not Available | 610 | Open in IMG/M |
| 3300016422|Ga0182039_12103896 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300018433|Ga0066667_11171429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300018468|Ga0066662_10704502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300018482|Ga0066669_10354273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300021560|Ga0126371_11308614 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300021560|Ga0126371_12120959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300025933|Ga0207706_10204472 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300026305|Ga0209688_1036805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300027646|Ga0209466_1002906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3528 | Open in IMG/M |
| 3300031545|Ga0318541_10549071 | Not Available | 646 | Open in IMG/M |
| 3300031573|Ga0310915_10974092 | Not Available | 592 | Open in IMG/M |
| 3300031640|Ga0318555_10528327 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031640|Ga0318555_10553859 | Not Available | 623 | Open in IMG/M |
| 3300031679|Ga0318561_10030303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2604 | Open in IMG/M |
| 3300031680|Ga0318574_10195674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300031713|Ga0318496_10525511 | Not Available | 654 | Open in IMG/M |
| 3300031719|Ga0306917_10493342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300031724|Ga0318500_10554262 | Not Available | 580 | Open in IMG/M |
| 3300031744|Ga0306918_10622809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium septentrionale | 846 | Open in IMG/M |
| 3300031744|Ga0306918_11107332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300031751|Ga0318494_10478219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 725 | Open in IMG/M |
| 3300031763|Ga0318537_10213161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300031764|Ga0318535_10367756 | Not Available | 643 | Open in IMG/M |
| 3300031765|Ga0318554_10371575 | Not Available | 812 | Open in IMG/M |
| 3300031771|Ga0318546_10875804 | Not Available | 632 | Open in IMG/M |
| 3300031777|Ga0318543_10258872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 776 | Open in IMG/M |
| 3300031780|Ga0318508_1106141 | Not Available | 782 | Open in IMG/M |
| 3300031805|Ga0318497_10540207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 653 | Open in IMG/M |
| 3300031819|Ga0318568_10307720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300031832|Ga0318499_10403066 | Not Available | 523 | Open in IMG/M |
| 3300031833|Ga0310917_10740249 | Not Available | 665 | Open in IMG/M |
| 3300031835|Ga0318517_10415247 | Not Available | 608 | Open in IMG/M |
| 3300031879|Ga0306919_10622485 | Not Available | 832 | Open in IMG/M |
| 3300031879|Ga0306919_10672897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300031879|Ga0306919_11373903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031880|Ga0318544_10232366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300031880|Ga0318544_10420199 | Not Available | 520 | Open in IMG/M |
| 3300031890|Ga0306925_10094313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3180 | Open in IMG/M |
| 3300031890|Ga0306925_10971038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 868 | Open in IMG/M |
| 3300031910|Ga0306923_10299358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1838 | Open in IMG/M |
| 3300031912|Ga0306921_10433561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1532 | Open in IMG/M |
| 3300031941|Ga0310912_10599427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 857 | Open in IMG/M |
| 3300031945|Ga0310913_10747604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300031946|Ga0310910_10704749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300031947|Ga0310909_10105927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2266 | Open in IMG/M |
| 3300031947|Ga0310909_10243205 | Not Available | 1502 | Open in IMG/M |
| 3300031959|Ga0318530_10196435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 827 | Open in IMG/M |
| 3300032001|Ga0306922_10017096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7164 | Open in IMG/M |
| 3300032001|Ga0306922_11277871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
| 3300032025|Ga0318507_10545475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300032041|Ga0318549_10190582 | Not Available | 919 | Open in IMG/M |
| 3300032042|Ga0318545_10390547 | Not Available | 502 | Open in IMG/M |
| 3300032044|Ga0318558_10244019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300032054|Ga0318570_10377421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300032055|Ga0318575_10410055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium septentrionale | 688 | Open in IMG/M |
| 3300032064|Ga0318510_10337743 | Not Available | 633 | Open in IMG/M |
| 3300032066|Ga0318514_10396440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
| 3300032068|Ga0318553_10776707 | Not Available | 501 | Open in IMG/M |
| 3300032076|Ga0306924_11495196 | Not Available | 716 | Open in IMG/M |
| 3300032076|Ga0306924_12459995 | Not Available | 523 | Open in IMG/M |
| 3300032094|Ga0318540_10200910 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300032261|Ga0306920_101736309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
| 3300033289|Ga0310914_11446270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.33% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.33% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.67% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100143481 | 3300000597 | Forest Soil | SDPDGLRLIEAFMRIDNAALRRRIVMLVQEIAGDDH* |
| AF_2010_repII_A1DRAFT_100644292 | 3300000597 | Forest Soil | WMAQIDDFVSDPDGLRLIEAFMRIDNAALRRGIVMLMQKIAGDDD* |
| AF_2010_repII_A1DRAFT_100913012 | 3300000597 | Forest Soil | MAQIDDFISDSDGLRLIGAFMRINNADLRCRIVMLVQEIAGDDD* |
| AF_2010_repII_A1DRAFT_101686731 | 3300000597 | Forest Soil | SDPDGLRLIEAFMRIDNAALRRRIVMLVQEIAGDDD* |
| AF_2010_repII_A1DRAFT_101731193 | 3300000597 | Forest Soil | MAQINDFVSDSDGLRLIRAFMRIDVALRRRIVMLVQEIAGDDD* |
| AF_2010_repII_A100DRAFT_10855262 | 3300000655 | Forest Soil | WVAQIDHFISDPDGLRLIEAFMRIDNAALRRRIVMLVQEIAGDDH* |
| AF_2010_repII_A001DRAFT_101142593 | 3300000793 | Forest Soil | SALSLAQIDDFVSDLDGLRLIGAFMRIDNATLRLRIVILVQEIAGDDD* |
| AP72_2010_repI_A100DRAFT_10025524 | 3300000837 | Forest Soil | MAQIDDFVSDSDCLRLMRAFMRIDNTTLRRRIAMLVQEIAGDDH* |
| AP72_2010_repI_A100DRAFT_10058751 | 3300000837 | Forest Soil | FVSDPDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD* |
| AP72_2010_repI_A100DRAFT_10194003 | 3300000837 | Forest Soil | DPDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDEGN* |
| Ga0066395_100158737 | 3300004633 | Tropical Forest Soil | GSALSMAQIDDFVSDSDGLRLMRAFMQIDNATLRRRIAMLVQEIAGDDD* |
| Ga0066388_1007940394 | 3300005332 | Tropical Forest Soil | IDDFVSDPDGLRLIEAFMRIDNATLRLRIVMLVQEIAGDDD* |
| Ga0066388_1014761413 | 3300005332 | Tropical Forest Soil | DDFVSDSNGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0066388_1017576182 | 3300005332 | Tropical Forest Soil | VAQIDDFISNSDGLRLIGALMRIDNAAVQRRIVMLVQKIAGDDGN* |
| Ga0066388_1051083453 | 3300005332 | Tropical Forest Soil | AQIDDFVSDLDGLRLIRAFMRIDNAALRRRIVMLVQEIAAMAPGRA* |
| Ga0066388_1075477151 | 3300005332 | Tropical Forest Soil | PHDSLSMAQIDDFVSDPDGLRLIEAFMRIDNATLRLRIVILVQEIAGDDD* |
| Ga0070714_1019522331 | 3300005435 | Agricultural Soil | LSVAQIDDFISNSDGLRLIGAFMRLDNAAMRRRIVMLVQEIAGDDGN* |
| Ga0066699_106028052 | 3300005561 | Soil | MAQIDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEAI* |
| Ga0066693_101295744 | 3300005566 | Soil | TLGSKRSALLMAQIDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEPI* |
| Ga0066705_108113732 | 3300005569 | Soil | RSALLMAQIDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEAI* |
| Ga0066905_1014121702 | 3300005713 | Tropical Forest Soil | GLRLIGAFMRIDNAALRRRIVMLVQEIAGDDDNSGKLA* |
| Ga0066905_1016955781 | 3300005713 | Tropical Forest Soil | DGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDDN* |
| Ga0066905_1018938972 | 3300005713 | Tropical Forest Soil | SDGLRLIGAFMRIDNAAVRRRVVMLVQEIAGDDGN* |
| Ga0066903_1003151223 | 3300005764 | Tropical Forest Soil | MAQIDDFVSDSEGLRLISAFMRIDNAALRRRIVMLLQEIAGDND* |
| Ga0066903_1016582732 | 3300005764 | Tropical Forest Soil | MAQIDEFVSDLGCLRLMREFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0066903_1032376201 | 3300005764 | Tropical Forest Soil | VSDSDGLRLIGAFMRIDNADLRRRIVMLVQEIAGDDD* |
| Ga0066903_1032515311 | 3300005764 | Tropical Forest Soil | DGLRLIGAFLRIDNAALRRRIVMLVQEIAGDDGN* |
| Ga0066903_1035326823 | 3300005764 | Tropical Forest Soil | EVNDFISDINGLRLIGAFMRIDNAALRRRIVMLVQEIAGDND* |
| Ga0066903_1062298661 | 3300005764 | Tropical Forest Soil | ELSMAQIDDFISDSNGLRLIGAFMRIDNAAVRRRIVMLVQEIAGHDG* |
| Ga0066903_1063398761 | 3300005764 | Tropical Forest Soil | EVNDFISDINGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0066903_1063595851 | 3300005764 | Tropical Forest Soil | HGSELSLAQIDDFVSGSNGLRLMRAFMRIGNADLRRRLVMLVQEIADDDD* |
| Ga0066903_1081511781 | 3300005764 | Tropical Forest Soil | SLSMAQIDDFVSDPDGLRLIEAFMRIDNATLRLRIVMLVQEIAGDDD* |
| Ga0066903_1088888381 | 3300005764 | Tropical Forest Soil | NDFISDINGLRLIGAFMRIDKAALRRRIVMLVQEIAGDDD* |
| Ga0075421_1017966681 | 3300006845 | Populus Rhizosphere | SSEGLRLIGAFMRVHNADLRRNIVMLVQKIAGDDGN* |
| Ga0066710_1032816741 | 3300009012 | Grasslands Soil | SNGLRLIGAFTRIENARLRRKIVMLVQEIAGDDGN |
| Ga0114129_120057591 | 3300009147 | Populus Rhizosphere | SSEGLRLIGAFMRVHNADLRRKIVMLVQKIAGDDGN* |
| Ga0075423_101885915 | 3300009162 | Populus Rhizosphere | LKPEIRFYPDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDGN* |
| Ga0126374_108428411 | 3300009792 | Tropical Forest Soil | MAEINDFISDSDGLRLIRAVMRIDNVALRRRIAMLVQEIAGDDD* |
| Ga0126380_122000451 | 3300010043 | Tropical Forest Soil | SDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0126384_103029492 | 3300010046 | Tropical Forest Soil | GCLRLMRGFMRIDNAAVRRRIVMLVQEIAGDDGN* |
| Ga0126384_104369764 | 3300010046 | Tropical Forest Soil | VSDIDGLRLIRAFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0126384_116250101 | 3300010046 | Tropical Forest Soil | SNSDGLRLIGAFMRIDNAAVRRRVVMLVQEIAGDDGN* |
| Ga0126382_112836531 | 3300010047 | Tropical Forest Soil | DSDGLRLIGAFMRIDNAALRRRIVMLVQEITGDDDN* |
| Ga0126382_118327452 | 3300010047 | Tropical Forest Soil | DFVSDLDGLRLIGAFMRIDNAAVRRRIVMLVQEIVGDK* |
| Ga0126373_108988582 | 3300010048 | Tropical Forest Soil | VSDSDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0126370_125564262 | 3300010358 | Tropical Forest Soil | SNSDGLRLIGAFTRIDDAALRRRIVMLVQEIAGDDD* |
| Ga0126372_104719224 | 3300010360 | Tropical Forest Soil | NSDGLRLIGAFMRIDKAAVRRRIVMLVQEIAGDDGI* |
| Ga0126378_100240929 | 3300010361 | Tropical Forest Soil | DFVSDPDGLRLIEAFMRIDNATLRLRIVILVQEIAGDDD* |
| Ga0126377_115504651 | 3300010362 | Tropical Forest Soil | LSLAQIDHFVSDLDGLRLIRAFMRIDNPALRRSIARLVQEIAGDDDWDA* |
| Ga0126379_126693081 | 3300010366 | Tropical Forest Soil | DSDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDD* |
| Ga0126381_1046197022 | 3300010376 | Tropical Forest Soil | FIFDSDGLRLIRAFMRIDNAAVRRRIVKLAEEIAGDLAN* |
| Ga0126383_102830251 | 3300010398 | Tropical Forest Soil | DLDGLRLIGAFMRIDNATLRRRIVTLVQEIAGDDD* |
| Ga0126383_105781192 | 3300010398 | Tropical Forest Soil | DLGCLRLMRGFMRIDNAAVRRRIVMLVQEIAGDDGN* |
| Ga0126383_107437373 | 3300010398 | Tropical Forest Soil | LSMAQIDDFVSDPDGLRLIEAFMRIDNATLRLRIVILVQEIAGDDD* |
| Ga0126383_125849321 | 3300010398 | Tropical Forest Soil | GANESKLWMAQIDDFVSDPDGLRLIEAFVRIDNAALRRGIVMLMQKIAGDND* |
| Ga0126383_128979141 | 3300010398 | Tropical Forest Soil | SNRSALSMAQIDEFVSDLGCLRLMRGFMRIDNAALRRKIVMLVQEIAGDDGN* |
| Ga0137363_105934392 | 3300012202 | Vadose Zone Soil | LSIAQIDDFVSDSNGLRLIGAFMRIENAHLRSKIVMLVQEIAGDDGN* |
| Ga0137374_109706301 | 3300012204 | Vadose Zone Soil | HGSALSIAQIDDFVSDSNGLRLIRAFRRIDNAELQRRIVMLVQEIASDDGD* |
| Ga0137381_114152452 | 3300012207 | Vadose Zone Soil | MTSSPIGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDGN* |
| Ga0137376_117530841 | 3300012208 | Vadose Zone Soil | IDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEPI* |
| Ga0137378_103388591 | 3300012210 | Vadose Zone Soil | DGLRLIGAFMRIDNAAVRRRIVMLVQEIAGDDGN* |
| Ga0137387_111837221 | 3300012349 | Vadose Zone Soil | FISDSNGLRLIGAFMRIDNADLRRRIVMLVQEIAGDDD* |
| Ga0137386_100947531 | 3300012351 | Vadose Zone Soil | SIAQIDDFLSDSIGLRRIGAFMRIENAHLRSKIVMQEIAGDDGN* |
| Ga0137366_108866931 | 3300012354 | Vadose Zone Soil | SDGLRLIRAFMRIDNAALRRSIAKLVQEIAGDDD* |
| Ga0137384_114703991 | 3300012357 | Vadose Zone Soil | HGSELSIAQIDDFVSDPNGLRLIGAFRRIDNAELRRRIVMLVQGIAGDDGD* |
| Ga0137368_105145671 | 3300012358 | Vadose Zone Soil | DLDGLRLIGAFMRIDNATLRRRIVMLVQEIAGDDD* |
| Ga0137385_110879432 | 3300012359 | Vadose Zone Soil | NGLRLIGAFMRIDNAELRRRIVMLVQEIAGDDERPAGR* |
| Ga0137373_100027971 | 3300012532 | Vadose Zone Soil | ASHGSALSIAQIDDFVSDSNGLRLIRAFRRIDNAELQRRIVMLVQEIAGDDGD* |
| Ga0137404_111269951 | 3300012929 | Vadose Zone Soil | VSNSDGLRLIRAFMRIDNAAVRRRVAMLVQEIAGDDGN* |
| Ga0137407_102844962 | 3300012930 | Vadose Zone Soil | VSDSNGLRLIGAFMRIENAHLRRKIVMLVQEIAGDDGN* |
| Ga0126375_100223391 | 3300012948 | Tropical Forest Soil | DGLRLIRAFMRIDNAALRRRIVMFVQEIAGDDADTQ* |
| Ga0126375_101815871 | 3300012948 | Tropical Forest Soil | SDLDGLRLIRAFMRIDNVALRRRIVMLVQEIAGDDD* |
| Ga0126375_103278792 | 3300012948 | Tropical Forest Soil | VSDIDGLRLIRAFMRIDVALRRRIVMLVQEIAGDDH* |
| Ga0126375_110859851 | 3300012948 | Tropical Forest Soil | SDGLRLIGAFMRIDNAALRRRIVMLVQEIATDDGN* |
| Ga0126369_134590312 | 3300012971 | Tropical Forest Soil | MAQIDDFISDSDGLRLIGAFTRVDNAALRRRIVMLVQEIARDDD* |
| Ga0182036_100125428 | 3300016270 | Soil | FRWFKAIRAFMRIDNVALRRRIAMLVQEIAGDDGN |
| Ga0182036_107419041 | 3300016270 | Soil | VSDSDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDDNEGKLA |
| Ga0182036_112857693 | 3300016270 | Soil | GFIRDSTGLRLIRAFMRIDNATLRRRIAMLVQEIAGDDD |
| Ga0182036_119346211 | 3300016270 | Soil | NARGLRLIGAPMRIENAHLRRKIVMLVQEIAGDDGN |
| Ga0182041_112504221 | 3300016294 | Soil | MAQIDDFVSGSNGLRLIRAFMRIDNVALRRRIVMLVQEIAVDDD |
| Ga0182033_103478201 | 3300016319 | Soil | GSALSVAQIDDFISNSDGLRLIGAFMRLDNAAVRRRIVMLVQEIAGDDGN |
| Ga0182035_107032811 | 3300016341 | Soil | MAQIDDFVSGSNGLRLIRAFMRIDNVALRRRIVMLVQEI |
| Ga0182035_107798261 | 3300016341 | Soil | AQIDDFVSDPDGLRLIEAFMRIDNAALRRGIVMLMQKIAGDDD |
| Ga0182040_103532653 | 3300016387 | Soil | SDSDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDEGN |
| Ga0182040_105998271 | 3300016387 | Soil | ISNSDGLRLIGAFMRIDNAAVRRRIVMLVQEIAGDDGN |
| Ga0182037_111260622 | 3300016404 | Soil | GSALSIAQIDDFVSDSNGLRLIGAYMRIDNVALRRSIVMLVQEIAGDDD |
| Ga0182039_115181282 | 3300016422 | Soil | MAQIDDFVSDSDGLRLIGAFMRIDNAALRRRIVMLVQ |
| Ga0182039_121038961 | 3300016422 | Soil | MAQIDDFVSDSIGLRLIEAFMRIDNAALRRKIVMPVQEMAGDDGN |
| Ga0066667_111714291 | 3300018433 | Grasslands Soil | GSKRSALLMAQIDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEPI |
| Ga0066662_107045021 | 3300018468 | Grasslands Soil | SDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDGN |
| Ga0066669_103542734 | 3300018482 | Grasslands Soil | ASTLGSKRSALLMAQIDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEPI |
| Ga0126371_113086141 | 3300021560 | Tropical Forest Soil | MAQIDEFVSDLGCLRLMREFMRIDNAALRRRIVMLVQEI |
| Ga0126371_121209592 | 3300021560 | Tropical Forest Soil | KGRALLMAQIDDFVSDSHGLRLMESFMRIGNAALRRRIVMLVREIADDGN |
| Ga0207706_102044723 | 3300025933 | Corn Rhizosphere | VSDSNGLRLIGAFMRIDNIALRRRIAMLVQKIADDAGN |
| Ga0209688_10368051 | 3300026305 | Soil | TLGSKRSALLMAQIDDFVSDSHGLRLMEAFRRIDNAALRRRIVRLVREIAGDEPI |
| Ga0209466_10029061 | 3300027646 | Tropical Forest Soil | LSLAQIDDFVSDLDGLRLIRAFMRIDNAAMRRRIVILVQEIAGC |
| Ga0318541_105490712 | 3300031545 | Soil | ALSMAQTDDFVSDIDGLRLIGAYMRIDNVALRRSIVMLVQEIAGDDD |
| Ga0310915_109740922 | 3300031573 | Soil | SDGLRLIGAFMRIDNAAVRRRIVMLVQEIAGDDGN |
| Ga0318555_105283271 | 3300031640 | Soil | VSGSNGLRLMRAFMRIDNADLRRRIVMLVQEIAGDDD |
| Ga0318555_105538591 | 3300031640 | Soil | MAQIDEFVSDLGCLRLMRGFMRIDNAALIVMLVQEIAGD |
| Ga0318561_100303036 | 3300031679 | Soil | ISDSDGLRLIRAFMRIDNVALRRRIAMLVQEIAGDDGN |
| Ga0318574_101956741 | 3300031680 | Soil | VSDSDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDDN |
| Ga0318496_105255111 | 3300031713 | Soil | FVSDLNGLTLIRAFMRIDNAVLRRTIVMLVQEIAGDDD |
| Ga0306917_104933421 | 3300031719 | Soil | MAQIDDFVSDSDGLRLITALMRIDNAALRRRIVMLV |
| Ga0318500_105542622 | 3300031724 | Soil | MAQIDDLRLIRAFMRIDNVALRRRIVMLVQEIAGDDD |
| Ga0306918_106228094 | 3300031744 | Soil | VSDSDGLRLIRAFMRIDNADLRRRIVMLVQEIAGD |
| Ga0306918_111073322 | 3300031744 | Soil | SMAQIDDFVSDSNGLRLMRAFMRIGNADLRRRLVMLVQEIADDDH |
| Ga0318494_104782191 | 3300031751 | Soil | QIDDFVSDSEGLRLIGAFMRIDNAALRRRIVMLVQEITGDDG |
| Ga0318537_102131611 | 3300031763 | Soil | SDSNGLRLIGAFMRIDNADLRRKIMMLVQEIAGDDGN |
| Ga0318535_103677562 | 3300031764 | Soil | SNRSALSMAQIDEFVSDLGCLRLMRGFMRIDNAALRRKIVMLVQEIAGDDGN |
| Ga0318554_103715751 | 3300031765 | Soil | SDGLRLIRAFMRIDNVALRRRIAMLVQEIAGDDDN |
| Ga0318546_108758041 | 3300031771 | Soil | IDDFVSDLDGLKLMRAFMRINAALRRRIVMLVQEIAGDHD |
| Ga0318543_102588722 | 3300031777 | Soil | MAARYRWPNFVSDSDGLRLIGAFMRINNAALRRRIVMLVQEIAGDDDN |
| Ga0318508_11061411 | 3300031780 | Soil | LRFGLRLMRAFMRIDNADLRRRIVMLVQEIAGDDD |
| Ga0318497_105402071 | 3300031805 | Soil | IDDFVSDSEGLRLIGAFMRIDNAALRRRIVMLVQEITGDDG |
| Ga0318568_103077201 | 3300031819 | Soil | MAQIDDFVSDSDGLRLIRALMRIDNAALRRRIVMLVQEIADDND |
| Ga0318499_104030661 | 3300031832 | Soil | DSDGLRLIRAFMRIDNATLRRRIAMLVQEIAGDDD |
| Ga0310917_107402491 | 3300031833 | Soil | FVSDPDGLRLIEAFMRIDNAALRRGIVMLMQKIAGDDD |
| Ga0318517_104152471 | 3300031835 | Soil | HDSNRSALSMAQIDEFVSDLGCLRLMRGFMRIDNAALRRKIVMLVQEIAGDDGN |
| Ga0306919_106224851 | 3300031879 | Soil | ANARGLRLIGAPMRIENAHLRRKIVMLVQEIAGDDGN |
| Ga0306919_106728974 | 3300031879 | Soil | DSDGLRMIGAFMRIDNAALRRRIVMLVQEIAGDDY |
| Ga0306919_113739032 | 3300031879 | Soil | DDFVSNPDGLRLIEAFMRIDNAALRRRIVMLVQEIAADDD |
| Ga0318544_102323662 | 3300031880 | Soil | SDSDGLRLIRAFMRIDNAALRRRIVMLVQEIAGDDD |
| Ga0318544_104201992 | 3300031880 | Soil | GAARELRCVSDSYGLRLIETFMRIDNAALRCRIVMLVQEIAGDDGN |
| Ga0306925_100943137 | 3300031890 | Soil | AQIDDFISNSDGLRLIGAFMRLDNAAVRRRIVMLVQEIAGDDGN |
| Ga0306925_109710382 | 3300031890 | Soil | DFVSDSDGLRLIGAFMRIDNATLRRRIVMLVQEIAGDHD |
| Ga0306923_102993581 | 3300031910 | Soil | ALSVAQIDDFISNSDGLRLIGAFMRLDNAAVRRRIVMLVQEIAGDDGN |
| Ga0306921_104335613 | 3300031912 | Soil | MAQIDGFVSDPDGLRLIRAFMRIDNVALRRRIVMLMQEIAGDDD |
| Ga0310912_105994271 | 3300031941 | Soil | GSALSMAEIDDFVSDLDGLKLMRAFMRINAALRRRIVMLVQEIAGDHD |
| Ga0310913_107476041 | 3300031945 | Soil | VSDSNGLRLIEAFMRIDNAALRRRIVMLVQEIAGDDGN |
| Ga0310910_107047491 | 3300031946 | Soil | DDLVSDSIGLRLIDAFMRIDNAALRRKIVMLVQEIAGDDGN |
| Ga0310909_101059271 | 3300031947 | Soil | SDSNGLRLIGAFMRIENAHLRRKIVMLVQEIAGDDGN |
| Ga0310909_102432051 | 3300031947 | Soil | GLRLIGAFMRIDNAALRRRIVMLVQEIAGDDDNEGKLA |
| Ga0318530_101964351 | 3300031959 | Soil | MAEINDFISDSDGLLLRLIGAFMRIDNAALRRRIVMLVQEIAGDEGN |
| Ga0306922_100170969 | 3300032001 | Soil | VSDSIGLRLIDAFMRIDNAALRRKIVMLVQEIAGDDGN |
| Ga0306922_112778711 | 3300032001 | Soil | EGSPNASAPHGSNKSELWMAQIDGFVSDPDGLRLIRAFMRIDNVALRRRIVMLMQEIAGDDD |
| Ga0318507_105454752 | 3300032025 | Soil | LMAQIDDFVSDSDGLKLIGAFMRMDNAAMRRRIVMLVQEIAGDDD |
| Ga0318549_101905821 | 3300032041 | Soil | SDGLRLIRAFMRIDNVALRRRIAMLVQEIAGDDGN |
| Ga0318545_103905471 | 3300032042 | Soil | DSNGLRLIGAFMRIDNADLRRKIVMLVQEIAGDDGN |
| Ga0318558_102440193 | 3300032044 | Soil | MAEIDDFVSDLDGLRLMRAFMRIDNALQRRIVMLVQE |
| Ga0318570_103774211 | 3300032054 | Soil | DPDGLRLMRAFLRIDNAALRRRIVMLVQEIAGDHD |
| Ga0318575_104100551 | 3300032055 | Soil | NGSALSMAQIDAFVSDSDGLRLIRAFMRIDNPDLRLRIVTLVQEIAGD |
| Ga0318510_103377431 | 3300032064 | Soil | MAEIDDFVSDLDGLKLMRAFMRINAALRRRIVMLVQEIAGDHD |
| Ga0318514_103964401 | 3300032066 | Soil | IDDFISDSDGLRLIGAVMRIDNAGLRRRIVMLVQEIAGDDD |
| Ga0318553_107767071 | 3300032068 | Soil | TYAANARGLRLIGAPMRIENAHLRRKIVMLVQEIAGDDGN |
| Ga0306924_114951963 | 3300032076 | Soil | EIDDFVSDLDGLKLMRAFMRINAALRRRIVMLVQEIAGDHD |
| Ga0306924_124599951 | 3300032076 | Soil | SDLDGLRLISAFMRIDNAALRRRIVMLVQEIAGDDD |
| Ga0318540_102009102 | 3300032094 | Soil | ESDGLRLIGAFMRIDNAALRRRIVMLVQEIAGDDNN |
| Ga0306920_1017363091 | 3300032261 | Soil | APHDSLSMVQIDDFVSDPDGLRLIEAFMRIDNATLRLRIVMLVQEIAGDDD |
| Ga0310914_114462702 | 3300033289 | Soil | VAQIDDFISNSDGLRLIGAFMRLDNAAVRRRIVRLVQEIAGDDGN |
| ⦗Top⦘ |