


| Basic Information | |
|---|---|
| Family ID | F046721 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 37 residues |
| Representative Sequence | NQMSWIKNLINRIKLEIRYRKKLKELRKRDPFIYK |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 150 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 32.21 % |
| % of genes near scaffold ends (potentially truncated) | 63.58 % |
| % of genes from short scaffolds (< 2000 bps) | 76.82 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (43.709 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (10.596 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.450 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (46.358 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 150 Family Scaffolds |
|---|---|---|
| PF02543 | Carbam_trans_N | 35.33 |
| PF02772 | S-AdoMet_synt_M | 7.33 |
| PF16861 | Carbam_trans_C | 7.33 |
| PF00970 | FAD_binding_6 | 5.33 |
| PF00438 | S-AdoMet_synt_N | 4.00 |
| PF07460 | NUMOD3 | 2.00 |
| PF04055 | Radical_SAM | 1.33 |
| PF06945 | DUF1289 | 1.33 |
| PF13186 | SPASM | 1.33 |
| PF01883 | FeS_assembly_P | 1.33 |
| PF08241 | Methyltransf_11 | 1.33 |
| PF02773 | S-AdoMet_synt_C | 1.33 |
| PF01583 | APS_kinase | 1.33 |
| PF13847 | Methyltransf_31 | 0.67 |
| PF13472 | Lipase_GDSL_2 | 0.67 |
| PF01041 | DegT_DnrJ_EryC1 | 0.67 |
| PF16363 | GDP_Man_Dehyd | 0.67 |
| PF08030 | NAD_binding_6 | 0.67 |
| PF13385 | Laminin_G_3 | 0.67 |
| PF01048 | PNP_UDP_1 | 0.67 |
| PF01467 | CTP_transf_like | 0.67 |
| PF07068 | Gp23 | 0.67 |
| PF03721 | UDPG_MGDP_dh_N | 0.67 |
| PF13394 | Fer4_14 | 0.67 |
| PF02310 | B12-binding | 0.67 |
| PF13733 | Glyco_transf_7N | 0.67 |
| PF02769 | AIRS_C | 0.67 |
| COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
|---|---|---|---|
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 35.33 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 12.67 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 1.33 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 1.33 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.67 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.67 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.67 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.67 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.67 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.67 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.67 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.67 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.67 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.67 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.29 % |
| Unclassified | root | N/A | 43.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10030622 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10051426 | Not Available | 2498 | Open in IMG/M |
| 3300001392|Lau_10083235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6861 | Open in IMG/M |
| 3300001392|Lau_10132950 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300001419|JGI11705J14877_10022908 | Not Available | 2458 | Open in IMG/M |
| 3300001460|JGI24003J15210_10006933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4760 | Open in IMG/M |
| 3300001460|JGI24003J15210_10009888 | All Organisms → Viruses → Predicted Viral | 3891 | Open in IMG/M |
| 3300001460|JGI24003J15210_10016744 | All Organisms → Viruses → Predicted Viral | 2857 | Open in IMG/M |
| 3300001460|JGI24003J15210_10166749 | Not Available | 547 | Open in IMG/M |
| 3300001472|JGI24004J15324_10151252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300001850|RCM37_1057593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300002201|metazooDRAFT_1267539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300002202|metazooDRAFT_1258293 | Not Available | 667 | Open in IMG/M |
| 3300003498|JGI26239J51126_1052448 | Not Available | 762 | Open in IMG/M |
| 3300004097|Ga0055584_101231232 | Not Available | 780 | Open in IMG/M |
| 3300004805|Ga0007792_10080748 | Not Available | 989 | Open in IMG/M |
| 3300005512|Ga0074648_1023363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3356 | Open in IMG/M |
| 3300005512|Ga0074648_1037780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2294 | Open in IMG/M |
| 3300005580|Ga0049083_10146403 | Not Available | 811 | Open in IMG/M |
| 3300005582|Ga0049080_10077591 | Not Available | 1137 | Open in IMG/M |
| 3300005805|Ga0079957_1005762 | All Organisms → cellular organisms → Bacteria | 10023 | Open in IMG/M |
| 3300005913|Ga0075108_10018414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2714 | Open in IMG/M |
| 3300005913|Ga0075108_10094488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300005933|Ga0075118_10087325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300006100|Ga0007806_1082229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300006115|Ga0007816_1036930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1117 | Open in IMG/M |
| 3300006120|Ga0007867_1029593 | Not Available | 1229 | Open in IMG/M |
| 3300006637|Ga0075461_10243643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300006752|Ga0098048_1004407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio → Bdellovibrio exovorus | 5535 | Open in IMG/M |
| 3300006868|Ga0075481_10100254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300006917|Ga0075472_10430939 | Not Available | 653 | Open in IMG/M |
| 3300006921|Ga0098060_1000053 | Not Available | 57936 | Open in IMG/M |
| 3300006990|Ga0098046_1115062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300007363|Ga0075458_10168872 | Not Available | 675 | Open in IMG/M |
| 3300007542|Ga0099846_1098300 | Not Available | 1079 | Open in IMG/M |
| 3300007609|Ga0102945_1002809 | All Organisms → cellular organisms → Bacteria | 4788 | Open in IMG/M |
| 3300007609|Ga0102945_1050430 | Not Available | 814 | Open in IMG/M |
| 3300008012|Ga0075480_10064571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2112 | Open in IMG/M |
| 3300008050|Ga0098052_1015464 | Not Available | 3789 | Open in IMG/M |
| 3300008107|Ga0114340_1135073 | Not Available | 931 | Open in IMG/M |
| 3300008267|Ga0114364_1093834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300008267|Ga0114364_1108228 | Not Available | 851 | Open in IMG/M |
| 3300008954|Ga0115650_1324393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300009026|Ga0102829_1099765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300009068|Ga0114973_10636513 | Not Available | 545 | Open in IMG/M |
| 3300009071|Ga0115566_10000064 | Not Available | 79463 | Open in IMG/M |
| 3300009071|Ga0115566_10005915 | Not Available | 9597 | Open in IMG/M |
| 3300009071|Ga0115566_10569426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300009149|Ga0114918_10414141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300009149|Ga0114918_10614250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300009154|Ga0114963_10190826 | Not Available | 1191 | Open in IMG/M |
| 3300009163|Ga0114970_10200714 | Not Available | 1173 | Open in IMG/M |
| 3300009164|Ga0114975_10525643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300009180|Ga0114979_10640839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300009184|Ga0114976_10221417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
| 3300009409|Ga0114993_10028173 | All Organisms → Viruses → Predicted Viral | 4598 | Open in IMG/M |
| 3300009422|Ga0114998_10432585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300009495|Ga0115571_1196415 | Not Available | 827 | Open in IMG/M |
| 3300009502|Ga0114951_10287406 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300009507|Ga0115572_10462034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 706 | Open in IMG/M |
| 3300009508|Ga0115567_10626259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300009508|Ga0115567_10754446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300009526|Ga0115004_10498862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300009785|Ga0115001_10095024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1953 | Open in IMG/M |
| 3300010334|Ga0136644_10331300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300010354|Ga0129333_10059529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3563 | Open in IMG/M |
| 3300010354|Ga0129333_10274777 | Not Available | 1513 | Open in IMG/M |
| 3300010354|Ga0129333_10436412 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 1155 | Open in IMG/M |
| 3300010885|Ga0133913_10793754 | Not Available | 2468 | Open in IMG/M |
| 3300010885|Ga0133913_12369249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1300 | Open in IMG/M |
| 3300010885|Ga0133913_12734539 | Not Available | 1192 | Open in IMG/M |
| 3300010885|Ga0133913_12804113 | Not Available | 1173 | Open in IMG/M |
| 3300011184|Ga0136709_1012003 | Not Available | 1223 | Open in IMG/M |
| 3300012525|Ga0129353_1497411 | Not Available | 500 | Open in IMG/M |
| 3300012525|Ga0129353_1497411 | Not Available | 500 | Open in IMG/M |
| 3300013004|Ga0164293_10353446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300013010|Ga0129327_10329539 | Not Available | 796 | Open in IMG/M |
| 3300013094|Ga0164297_10013220 | Not Available | 5824 | Open in IMG/M |
| 3300016737|Ga0182047_1521612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300016745|Ga0182093_1404511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300016747|Ga0182078_10957025 | Not Available | 1677 | Open in IMG/M |
| 3300017697|Ga0180120_10177878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300017742|Ga0181399_1021522 | Not Available | 1798 | Open in IMG/M |
| 3300017747|Ga0181352_1190330 | Not Available | 530 | Open in IMG/M |
| 3300017752|Ga0181400_1001740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8851 | Open in IMG/M |
| 3300017768|Ga0187220_1120832 | Not Available | 792 | Open in IMG/M |
| 3300017778|Ga0181349_1205613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300017779|Ga0181395_1108918 | Not Available | 885 | Open in IMG/M |
| 3300017780|Ga0181346_1222239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300017950|Ga0181607_10242610 | Not Available | 1038 | Open in IMG/M |
| 3300017951|Ga0181577_10515544 | Not Available | 746 | Open in IMG/M |
| 3300017967|Ga0181590_11125908 | Not Available | 505 | Open in IMG/M |
| 3300017969|Ga0181585_10178032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1538 | Open in IMG/M |
| 3300017986|Ga0181569_10625645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
| 3300017989|Ga0180432_10835896 | Not Available | 636 | Open in IMG/M |
| 3300017989|Ga0180432_11207681 | Not Available | 506 | Open in IMG/M |
| 3300018041|Ga0181601_10659252 | Not Available | 531 | Open in IMG/M |
| 3300018418|Ga0181567_10717339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300018428|Ga0181568_10735768 | Not Available | 768 | Open in IMG/M |
| 3300020159|Ga0211734_11320190 | Not Available | 519 | Open in IMG/M |
| 3300020160|Ga0211733_10989130 | Not Available | 1116 | Open in IMG/M |
| 3300020162|Ga0211735_10373177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300020173|Ga0181602_10323882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300020175|Ga0206124_10003621 | All Organisms → cellular organisms → Bacteria | 10776 | Open in IMG/M |
| 3300020178|Ga0181599_1334073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300020182|Ga0206129_10053119 | Not Available | 2512 | Open in IMG/M |
| 3300020194|Ga0181597_10050486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2615 | Open in IMG/M |
| 3300020220|Ga0194119_10894709 | Not Available | 517 | Open in IMG/M |
| 3300021354|Ga0194047_10018021 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
| 3300021519|Ga0194048_10102942 | Not Available | 1099 | Open in IMG/M |
| 3300021519|Ga0194048_10155464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 858 | Open in IMG/M |
| 3300021958|Ga0222718_10375102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300021962|Ga0222713_10319900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300021963|Ga0222712_10412799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300022407|Ga0181351_1088463 | Not Available | 1220 | Open in IMG/M |
| 3300022921|Ga0255765_1086616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1671 | Open in IMG/M |
| 3300023119|Ga0255762_10364340 | Not Available | 725 | Open in IMG/M |
| 3300023174|Ga0214921_10548088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300023296|Ga0222664_1013362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1823 | Open in IMG/M |
| 3300024262|Ga0210003_1003317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13152 | Open in IMG/M |
| 3300024262|Ga0210003_1357253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300024293|Ga0228651_1105652 | Not Available | 636 | Open in IMG/M |
| 3300024346|Ga0244775_11255122 | Not Available | 575 | Open in IMG/M |
| 3300025091|Ga0209616_1007430 | Not Available | 1223 | Open in IMG/M |
| 3300025396|Ga0208874_1024287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300025467|Ga0208260_1101635 | Not Available | 564 | Open in IMG/M |
| 3300025598|Ga0208379_1161690 | Not Available | 501 | Open in IMG/M |
| 3300025603|Ga0208414_1042860 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300025680|Ga0209306_1182597 | Not Available | 580 | Open in IMG/M |
| 3300025695|Ga0209653_1125631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300025880|Ga0209534_10419592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300026138|Ga0209951_1003643 | All Organisms → Viruses → Predicted Viral | 3334 | Open in IMG/M |
| 3300027747|Ga0209189_1064596 | Not Available | 1725 | Open in IMG/M |
| 3300027782|Ga0209500_10284187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300027791|Ga0209830_10236051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10326209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300027899|Ga0209668_10706990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300027971|Ga0209401_1307872 | Not Available | 547 | Open in IMG/M |
| 3300028392|Ga0304729_1226903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1040980 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10296418 | Not Available | 1116 | Open in IMG/M |
| 3300031519|Ga0307488_10225698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300031801|Ga0310121_10721074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 527 | Open in IMG/M |
| 3300031802|Ga0310123_10038546 | Not Available | 3385 | Open in IMG/M |
| 3300031857|Ga0315909_10140665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2006 | Open in IMG/M |
| 3300031857|Ga0315909_10307793 | Not Available | 1181 | Open in IMG/M |
| 3300034062|Ga0334995_0401923 | Not Available | 857 | Open in IMG/M |
| 3300034082|Ga0335020_0017044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4195 | Open in IMG/M |
| 3300034104|Ga0335031_0708890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 10.60% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.30% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.30% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.64% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.31% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.65% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.65% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.99% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.99% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.99% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.99% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.32% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.32% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.32% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.32% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.32% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.32% |
| Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 1.32% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.32% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.32% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.32% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.66% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.66% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.66% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.66% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.66% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.66% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.66% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.66% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.66% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.66% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.66% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.66% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300001392 | ELSC Metagenome | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
| 3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008954 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024293 | Seawater microbial communities from Monterey Bay, California, United States - 63D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025603 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100306223 | 3300000101 | Marine | MLVVKLIKSVINKIKMEIRYRKRLKELRKRDPFIYK* |
| TBL_comb47_HYPODRAFT_100514261 | 3300000553 | Freshwater | KKETNMNWITNLYNRIRLELRYRKKLKELRKRDPFIYK* |
| Lau_100832356 | 3300001392 | Black Smokers Hydrothermal Plume | VKNPIRTLWNKIKLEIRYRKKLKELKKRDPFIYK* |
| Lau_101329502 | 3300001392 | Black Smokers Hydrothermal Plume | VKNPIKTLWNKIKLEIRYRKKLKELKKRDPFIYK* |
| JGI11705J14877_100229081 | 3300001419 | Saline Water And Sediment | SMNIFKKLWNKIKLEIRYRKKLKELRKRDPFIYK* |
| JGI24003J15210_100069333 | 3300001460 | Marine | MLVVKFIKRIINKIKMEIRYRKRLKELRKRDPFIYK* |
| JGI24003J15210_100098886 | 3300001460 | Marine | MITWIKSLIDKIKLEIRYRKKLKELRKRDPFIYK* |
| JGI24003J15210_100167443 | 3300001460 | Marine | MISWIQKIYYKIKLEIQYRKKLKELKKRDPFIYK* |
| JGI24003J15210_101667492 | 3300001460 | Marine | MITWIKNLINKVKLEIRYRKKLKELRKRDPFIYK* |
| JGI24004J15324_101512522 | 3300001472 | Marine | MLTWIKGIINKIKLEIRYRKKLKELRKRDPFIYK* |
| RCM37_10575931 | 3300001850 | Marine Plankton | MILWIKNLYARIKLEIVYRKKLKELRKRDPFIYK* |
| metazooDRAFT_12675392 | 3300002201 | Lake | MLSWIRNLYNKIKLEINYRKKLKELRKRDPFIYK* |
| metazooDRAFT_12582931 | 3300002202 | Lake | PATKAFKMKWFKQIWNRITLEYRYRKKLKELRKRDPFIYK* |
| JGI26239J51126_10524482 | 3300003498 | Marine | VILNLLSGGRIYPMQWIKNLINRIKMEIQYRKRLKELRKRDPFIYK* |
| Ga0055584_1012312322 | 3300004097 | Pelagic Marine | MDGNRLMKWIRSLINRIKLELRYRKRLKELRKRDPFIYK* |
| Ga0007792_100807482 | 3300004805 | Freshwater | TNKGTKMKWIRNLYNRITLELRYRKKLKELRKRDPFIYK* |
| Ga0074648_10233635 | 3300005512 | Saline Water And Sediment | MVNWIKSIINKIKLEIRYRKRLKELRKRDPFIYK* |
| Ga0074648_10377802 | 3300005512 | Saline Water And Sediment | MIKWVKNIVNKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0049083_101464033 | 3300005580 | Freshwater Lentic | SSMNWLRKIYNRIKLEIAYRKKLKELRKRDPFIYK* |
| Ga0049080_100775911 | 3300005582 | Freshwater Lentic | LHGETNQMSWIKRILDRVKLEIRYRKKLKELRKRDPFIYK* |
| Ga0079957_10057626 | 3300005805 | Lake | MHTEDNDMTWIRHIIDRIKMEIRYRRKLKELRKRDPFIYK* |
| Ga0075108_100184143 | 3300005913 | Saline Lake | MFSWVRKIYDRIVLEIKYRKKLKKLRQRDPFIYK* |
| Ga0075108_100944883 | 3300005913 | Saline Lake | GAMKMNWFKKIIDRIKLEIRYRKKLKELKKRDPFTYR* |
| Ga0075118_100873253 | 3300005933 | Saline Lake | AMKMNWFKKIIDRIKLEIRYRKKLKELKKRDPFTYR* |
| Ga0007806_10822292 | 3300006100 | Freshwater | NSMNWLKNLYNRIALEIRYRKKLKELRKRDPFIYK* |
| Ga0007816_10369301 | 3300006115 | Freshwater | SRRNSMKWLRNLYNRIKLELHYRKKLKELRKRDPFIYK* |
| Ga0007867_10295931 | 3300006120 | Freshwater | RRNTMNWLRSLYNRIKLEIQYRKKLKELRKRDPFIYK* |
| Ga0075461_102436431 | 3300006637 | Aqueous | AMKWIKRLINKVKLEIRYRKKLKELRKRDPFIYK* |
| Ga0098048_10044073 | 3300006752 | Marine | MLVVRFIKRIIDKIKLEIRYRKRLKELRKRDPFIYK* |
| Ga0075481_101002542 | 3300006868 | Aqueous | MITWFKKIYNKIKLEIKYRKKLKELRKRDPFIYK* |
| Ga0075472_104309391 | 3300006917 | Aqueous | REIDMNWIRNLINRIKMEIRYRKKLKELRKRDQFIYK* |
| Ga0098060_100005334 | 3300006921 | Marine | MIKWIKNFYLKIKLNYRYKKKLKELRKRDPFIYK* |
| Ga0098046_11150623 | 3300006990 | Marine | LVVRFIKRIIDKIKLEIRYRKRLKELRKRDPFIYK* |
| Ga0075458_101688721 | 3300007363 | Aqueous | MNTKREIDMKWIKRLIQKIKMELHYRKRLKELRKRDPFIYK* |
| Ga0099846_10983001 | 3300007542 | Aqueous | KTLMNIFKRLWNKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0102945_10028092 | 3300007609 | Pond Water | MFTWFKKIYNKIKLEVRYRKKLKELRKRDPFIYK* |
| Ga0102945_10504302 | 3300007609 | Pond Water | MFTWFKKIYNKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0075480_100645714 | 3300008012 | Aqueous | MIKWFKKIYNKIKLEIKYRKKLKELRKRDPFIYK* |
| Ga0098052_10154642 | 3300008050 | Marine | MIKWIKKLVSKIRLEIRYRKKMKELKKRDPFIYK* |
| Ga0114340_11350731 | 3300008107 | Freshwater, Plankton | TKMKWIRRLWDRITLEYRYRKKLKELRKRDPFIYK* |
| Ga0114364_10938342 | 3300008267 | Freshwater, Plankton | EIEMNWIRQFWDRITLEYRYRKKLKELRKRDPFIYK* |
| Ga0114364_11082281 | 3300008267 | Freshwater, Plankton | IMKWIMNLYYRIRLEIRYRKKLRELRKRDPFIYK* |
| Ga0115650_13243932 | 3300008954 | Marine | MKKWVQNIIAKIKLEIQYRKRLKELRKRDPFIYK* |
| Ga0102829_10997651 | 3300009026 | Estuarine | NVMNWIRNLYNRIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0114973_106365131 | 3300009068 | Freshwater Lake | RISYMNWIRNLIAKIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0115566_1000006425 | 3300009071 | Pelagic Marine | MIKWFKSLINRVKLEIAYRKKLKELRKRDPFIYK* |
| Ga0115566_100059152 | 3300009071 | Pelagic Marine | MITWLKNLISKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0115566_105694261 | 3300009071 | Pelagic Marine | MKIIKKILCWPLRWPKNLINKIKLEIRYRKKLKEL |
| Ga0114918_104141411 | 3300009149 | Deep Subsurface | QKECIMITWIKKLVNKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0114918_106142502 | 3300009149 | Deep Subsurface | MKRIKKILSWPKNLINKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0114963_101908261 | 3300009154 | Freshwater Lake | AMNWIRRMWAKLTLEIRYRKKLRELRKRDPFIYK* |
| Ga0114970_102007141 | 3300009163 | Freshwater Lake | KEIEMKWIKSIWDRITLEIRYRKKLRELRKRDPFIYK* |
| Ga0114975_105256431 | 3300009164 | Freshwater Lake | KETDMNWLKRMWDKITLEIRYRRKLKELRKRDPFIYK* |
| Ga0114979_106408391 | 3300009180 | Freshwater Lake | YGETNIMSWIKNIISRIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0114976_102214171 | 3300009184 | Freshwater Lake | QRIMTMTWIKNLINRIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0114993_100281732 | 3300009409 | Marine | MIKWIKKLYNKVVLHYRIKKKLKELRKRDPFIYK* |
| Ga0114998_104325852 | 3300009422 | Marine | MKTIKKILNWPKTLINKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0114932_100171353 | 3300009481 | Deep Subsurface | MIKWIKKLVSKIRLEIRYRKKIKELKKRDPFIYK* |
| Ga0115571_11964152 | 3300009495 | Pelagic Marine | MDGNRLMKWIRSLINRIKLELRYRKRLKELRKRDP |
| Ga0114951_102874062 | 3300009502 | Freshwater | MKMNWIKNLIARIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0115572_104620341 | 3300009507 | Pelagic Marine | MDGNRLMKWIKNLINRIKLEIRYRKRLKELRKRDPF |
| Ga0115567_106262592 | 3300009508 | Pelagic Marine | MKTIKKILSWPKNLINKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0115567_107544461 | 3300009508 | Pelagic Marine | IMIKWFKNLISKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0115004_104988621 | 3300009526 | Marine | NRQKECIMITWIRNLINKIKLEVRYRKKLKELRKRDPFIYK* |
| Ga0115001_100950242 | 3300009785 | Marine | MKTIKKILSWPKNVINKIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0136644_103313002 | 3300010334 | Freshwater Lake | DKRIKMNWIKRLWARITLEIHYRKKLKELRKRDPFIYK* |
| Ga0129333_100595293 | 3300010354 | Freshwater To Marine Saline Gradient | MIKWIRNMVNRIKLEIRYRKKLKELRKRDPFIYK* |
| Ga0129333_102747771 | 3300010354 | Freshwater To Marine Saline Gradient | MISWIKTLISRITLEIKYRKRLKELRKRDPFTYD* |
| Ga0129333_104364121 | 3300010354 | Freshwater To Marine Saline Gradient | MISWIKALISRITLEIRYRKRLKELRKRDPFTYD* |
| Ga0133913_107937541 | 3300010885 | Freshwater Lake | YGETNQMSWIKNLINRVRLEIRYRKKLKELRKRDPFIYK* |
| Ga0133913_123692492 | 3300010885 | Freshwater Lake | MTMTWIKNIIDRIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0133913_127345392 | 3300010885 | Freshwater Lake | MTMNWIKNIINRIRLEIRYRKKLKELRKRDPFIYK* |
| Ga0133913_128041131 | 3300010885 | Freshwater Lake | NKEIGMNWIRRLWARITLEIRYRKKLKELRKRDPFIYK* |
| Ga0136709_10120031 | 3300011184 | Freshwater | RLYGTTTKENAMKWLRNWINSVKLEIRYRRKLKELRKRDPFIYK* |
| Ga0129353_14974111 | 3300012525 | Aqueous | HMFNWFRKIINEIKLEIRYRKKLKALKKRDPFIYK* |
| Ga0129353_14974112 | 3300012525 | Aqueous | MFNWFRKIVDKIKLELRYRMKLKALKKRDPFIYK* |
| Ga0164293_103534461 | 3300013004 | Freshwater | TEMNWIRRLWDRITLEIRYRKKLKELRKRDPFIYK* |
| Ga0129327_103295391 | 3300013010 | Freshwater To Marine Saline Gradient | RINLMNWFKKIINRIKMELRYRKKLKELKKRDPFIYK* |
| Ga0164297_100132202 | 3300013094 | Freshwater | MFNWIRNIINSIKREVTYRKRIKELRKRDPFIYK* |
| Ga0182047_15216121 | 3300016737 | Salt Marsh | CIMIKWFRNIINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0182093_14045111 | 3300016745 | Salt Marsh | TVTGATAMKWIKNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0182078_109570251 | 3300016747 | Salt Marsh | TNQEYEMSWIRKLINKIKLEIRYRKKLKELKKRDPFIYK |
| Ga0180120_101778781 | 3300017697 | Freshwater To Marine Saline Gradient | CIMITWIKNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0181399_10215225 | 3300017742 | Seawater | MLVVKLIKNVINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0181352_11903301 | 3300017747 | Freshwater Lake | FFKGTNMKWIITAWKRLLLEIRYRKKLRELRKRDPFIYK |
| Ga0181400_10017404 | 3300017752 | Seawater | MLVVKFVKRIINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0187220_11208321 | 3300017768 | Seawater | QRNGIMGFIKRIINKIKMEIRYRKRLKELRKRDPFIYK |
| Ga0181386_11317442 | 3300017773 | Seawater | LMISWIQKIYYKIKLEIQYRKKLKELKKRDPFIYK |
| Ga0181349_12056131 | 3300017778 | Freshwater Lake | KETEMNWIRRLWDRITLEIRYRKKLKELRKRDPFIYK |
| Ga0181395_11089181 | 3300017779 | Seawater | GETVMAFIKRIINKIKMEIRYRKRLKELRKRDPFIYK |
| Ga0181346_12222391 | 3300017780 | Freshwater Lake | ANKETEMNWIRRIWDRITLEIRYRKKLKELRKRDPFIYK |
| Ga0181607_102426103 | 3300017950 | Salt Marsh | KGRTIMGWIKRIINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0181577_105155441 | 3300017951 | Salt Marsh | CAINILLKETDMFNWITKIVDKIKLEIRYRKKLKELKKRDPFIYK |
| Ga0181590_111259082 | 3300017967 | Salt Marsh | MRMKWIRNLINRIKMEIRYRKKLKELRKKDPFIYK |
| Ga0181585_101780321 | 3300017969 | Salt Marsh | RTSLMNWLKKIINRIKMEIRYRKKLKELKKRDPFIYK |
| Ga0181569_106256452 | 3300017986 | Salt Marsh | MKIVNWFKRQIDRIRLEIRYRKKLKELRKKDPFIYK |
| Ga0180432_108358961 | 3300017989 | Hypersaline Lake Sediment | SNRKTLMNIFKRLWNKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0180432_112076811 | 3300017989 | Hypersaline Lake Sediment | KENNMTNWLKKIYNKIKREIRYRKKLKELRKRDPFIYK |
| Ga0181601_106592523 | 3300018041 | Salt Marsh | IKMKWLKNLINKIKLELRYRKKLKELRKKDPFIYK |
| Ga0181567_107173391 | 3300018418 | Salt Marsh | TTPIGSIAMNLIRRIINKIKMEIRYRKRLKELRRRDPFIYK |
| Ga0181568_107357682 | 3300018428 | Salt Marsh | GNKKMINWVKSIINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0211734_113201901 | 3300020159 | Freshwater | TNQMSWIKRMIDRIKLEIRYRKKLKELRKRDPFIYK |
| Ga0211733_109891301 | 3300020160 | Freshwater | MNIKKESDMKWIKRLINKIRMEIDYRKRLKELRKLDPFIYK |
| Ga0211735_103731772 | 3300020162 | Freshwater | ANKEINMKWIRRIWDRITLEIRYRKKLKELRKRDPFIYK |
| Ga0181602_103238821 | 3300020173 | Salt Marsh | EKACIMVTWIKNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0206124_100036216 | 3300020175 | Seawater | MDGNRLMKWIRSLINRIKLELRYRKRLKELRKRDPFIYK |
| Ga0181599_13340732 | 3300020178 | Salt Marsh | ATAMKWIKNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0206129_100531192 | 3300020182 | Seawater | MKTIKRILRFPKTLYNKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0181597_100504865 | 3300020194 | Salt Marsh | TTAMKWIKNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0194119_108947091 | 3300020220 | Freshwater Lake | PRDQKERTMKWIRNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0194047_100180215 | 3300021354 | Anoxic Zone Freshwater | MIYIRKIHMNWIKNLIFRIKMELTYRKRLKELRKRDPFIYK |
| Ga0194048_101029422 | 3300021519 | Anoxic Zone Freshwater | NKMSWIKNIYNRIMLEIRYRKKLKELRKRDPFIYK |
| Ga0194048_101554642 | 3300021519 | Anoxic Zone Freshwater | MRMNWLRRLYLRIHLEIRYRIKLREARKRDPFIYK |
| Ga0222718_103751022 | 3300021958 | Estuarine Water | MLVVRFIKRIINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0222713_103199002 | 3300021962 | Estuarine Water | KGIEMNWIKKIWARITLEIRYRKKLKELRKRDPFIYK |
| Ga0222712_104127991 | 3300021963 | Estuarine Water | SKGHNMNWIKTLWARITLEIRYRKKLKELRKRDPFIYK |
| Ga0181351_10884631 | 3300022407 | Freshwater Lake | NQMSWIKNLINRIKLEIRYRKKLKELRKRDPFIYK |
| Ga0255765_10866164 | 3300022921 | Salt Marsh | GRTIMGWIKRIINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0255762_103643402 | 3300023119 | Salt Marsh | PIGSIAMNLIRRLINKIKMEIRYRKRLKELRKRDPFIYK |
| Ga0214921_105480882 | 3300023174 | Freshwater | TKMNWIRRLWDRITLEIRYRKKLKELRKRDPFIYK |
| Ga0222664_10133623 | 3300023296 | Saline Water | THLTIAGAMKMNWFKKIIDRIKLEIRYRKKLKELKKRDPFTYR |
| Ga0210003_100331712 | 3300024262 | Deep Subsurface | MDMKWLKKIWQRIQLEIRYRRKLKELRKRDPFVYK |
| Ga0210003_13572532 | 3300024262 | Deep Subsurface | MITWIKKLINKIKLEIRYRKKLKELRKRDPFIYKXVIYLQAS |
| Ga0228651_11056523 | 3300024293 | Seawater | QDTIIKMKWLRNLINKIKLEIRYRKKLKALRKKDPFIYK |
| Ga0244775_112551221 | 3300024346 | Estuarine | MLVVKLIKSVINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0209616_10074301 | 3300025091 | Freshwater | RLYGTTTKENAMKWLRNWINSVKLEIRYRRKLKELRKRDPFIYK |
| Ga0208874_10242871 | 3300025396 | Freshwater | NSMNWLRNLYNRIKLEIRYRKKLKELRKRDPFIYK |
| Ga0208260_11016351 | 3300025467 | Freshwater | NKMSLIRQLYNRIMLEIRYRKKLRELRKRDPFIYK |
| Ga0208379_11616901 | 3300025598 | Freshwater | KRKKTMNWIKKLIARIQLEIRYRKKLKELRKRDPFIYK |
| Ga0208414_10428601 | 3300025603 | Saline Lake | AMKMNWFKKIIDRIKLEIRYRKKLKELKKRDPFTYR |
| Ga0209306_11825972 | 3300025680 | Pelagic Marine | MLVVKFIKRIINKIKLEIRYRKRLKELRKRDPFIYK |
| Ga0209653_11256312 | 3300025695 | Marine | MKTIKKILSWPKSLINKIKLEIRYRKKLKELRKKDPFIYK |
| Ga0209534_104195922 | 3300025880 | Pelagic Marine | QTTTGTTAMKWIKNLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0209951_10036434 | 3300026138 | Pond Water | EVINFIKKLYNKIVSKYRLQKKLKELRKKDPFIYK |
| Ga0209189_10645963 | 3300027747 | Freshwater Lake | MIMNWLRKIYDRVMLEIRYRKRLKELRKRDPFIYK |
| Ga0209500_102841873 | 3300027782 | Freshwater Lake | KECDMKWIKNIYNRIKLELRYRKKLKELRKRDPFIYK |
| Ga0209830_102360512 | 3300027791 | Marine | MKTIKKILSWPKNVINKIKLEIRYRKKLKELRKRDPFIYK |
| (restricted) Ga0233415_103262091 | 3300027861 | Seawater | KACIMITWIKNLISKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0209668_107069901 | 3300027899 | Freshwater Lake Sediment | TKMKWIRRLWDRIVLEIRYRKKLKELRKRDPFIYK |
| Ga0209401_13078722 | 3300027971 | Freshwater Lake | RISYMNWIRNLIAKIRLEIRYRKKLKELRKRDPFIYK |
| Ga0304729_12269032 | 3300028392 | Freshwater Lake | QCRKNSMNWLKNLYNRIVLEIRYRKKLKELRKRDPFIYK |
| (restricted) Ga0247831_10409803 | 3300028559 | Freshwater | DIAMKWLKNIINRIKLEIRYRKKLKELRKRDPFIYK |
| (restricted) Ga0247841_102964181 | 3300029286 | Freshwater | GTTNKGTKMKWIRNLYNRITLELRYRKKLKELRKRDPFIYK |
| Ga0307488_102256982 | 3300031519 | Sackhole Brine | MKTIKKILNWPKTLINKIKLEIRYRKKLKELRKRDPFIYK |
| Ga0310121_107210741 | 3300031801 | Marine | RGTKMIIVNWFKMLYNRIKLEIQYRKKLKELRKRDPFIYK |
| Ga0310123_100385464 | 3300031802 | Marine | MIIVNWFKMLYNRIKLEIQYRKKLKELRKRDPFIYK |
| Ga0315909_101406653 | 3300031857 | Freshwater | SKMNWLKRIYARITLEIRYRRKLKELRKRDPFIYK |
| Ga0315909_103077931 | 3300031857 | Freshwater | IEMNWIRQFWDRITLEYRYRKKLKELRKRDPFIYK |
| Ga0334995_0401923_3_113 | 3300034062 | Freshwater | DYNMQWIKNLYNKIRLEIRYRKKLKELRKRDPFIYK |
| Ga0335020_0017044_4068_4193 | 3300034082 | Freshwater | PAFKRGHFMNCIKRLWDRITLEIRYRKKLKELRKRDPFIYK |
| Ga0335031_0708890_2_109 | 3300034104 | Freshwater | NSMSWLRNLYNRIKLEIAYRKKLKELRKRDPFIYK |
| ⦗Top⦘ |