


| Basic Information | |
|---|---|
| Family ID | F046589 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 45 residues |
| Representative Sequence | SNYWVPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.67 % |
| % of genes near scaffold ends (potentially truncated) | 94.04 % |
| % of genes from short scaffolds (< 2000 bps) | 86.75 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.861 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.815 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.748 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.291 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.19% β-sheet: 0.00% Coil/Unstructured: 73.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF13410 | GST_C_2 | 6.62 |
| PF04392 | ABC_sub_bind | 3.97 |
| PF00753 | Lactamase_B | 3.31 |
| PF13417 | GST_N_3 | 3.31 |
| PF03401 | TctC | 1.99 |
| PF00216 | Bac_DNA_binding | 1.99 |
| PF07045 | DUF1330 | 1.32 |
| PF00589 | Phage_integrase | 1.32 |
| PF01152 | Bac_globin | 0.66 |
| PF03703 | bPH_2 | 0.66 |
| PF05598 | DUF772 | 0.66 |
| PF06100 | MCRA | 0.66 |
| PF02397 | Bac_transf | 0.66 |
| PF00027 | cNMP_binding | 0.66 |
| PF04324 | Fer2_BFD | 0.66 |
| PF12536 | DUF3734 | 0.66 |
| PF00378 | ECH_1 | 0.66 |
| PF00248 | Aldo_ket_red | 0.66 |
| PF14497 | GST_C_3 | 0.66 |
| PF01381 | HTH_3 | 0.66 |
| PF13751 | DDE_Tnp_1_6 | 0.66 |
| PF01799 | Fer2_2 | 0.66 |
| PF13676 | TIR_2 | 0.66 |
| PF03734 | YkuD | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.97 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.99 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.99 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.32 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.66 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.66 |
| COG4716 | Myosin-crossreactive antigen (function unknown) | Function unknown [S] | 0.66 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.66 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.86 % |
| Unclassified | root | N/A | 29.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig516825 | Not Available | 538 | Open in IMG/M |
| 2170459003|FZN2CUW02FMNM3 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300000956|JGI10216J12902_107359127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300005178|Ga0066688_10231710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300005332|Ga0066388_104319045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300005332|Ga0066388_105389958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300005332|Ga0066388_105712439 | Not Available | 629 | Open in IMG/M |
| 3300005332|Ga0066388_106161140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300005332|Ga0066388_106387727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300005467|Ga0070706_100068150 | All Organisms → cellular organisms → Bacteria | 3290 | Open in IMG/M |
| 3300005518|Ga0070699_100075369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2936 | Open in IMG/M |
| 3300005553|Ga0066695_10058512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2305 | Open in IMG/M |
| 3300005555|Ga0066692_10509019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300005713|Ga0066905_100251996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1357 | Open in IMG/M |
| 3300005713|Ga0066905_100686924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300005713|Ga0066905_100851205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BRP22 | 794 | Open in IMG/M |
| 3300005713|Ga0066905_100874947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300005713|Ga0066905_100925549 | Not Available | 764 | Open in IMG/M |
| 3300005713|Ga0066905_100982865 | Not Available | 743 | Open in IMG/M |
| 3300005713|Ga0066905_101051101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
| 3300005713|Ga0066905_101422282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 62 | 628 | Open in IMG/M |
| 3300005713|Ga0066905_101614792 | Not Available | 593 | Open in IMG/M |
| 3300005713|Ga0066905_101881216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300005713|Ga0066905_102143499 | Not Available | 520 | Open in IMG/M |
| 3300005713|Ga0066905_102171594 | Not Available | 517 | Open in IMG/M |
| 3300005764|Ga0066903_101363823 | Not Available | 1329 | Open in IMG/M |
| 3300005764|Ga0066903_101600666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1235 | Open in IMG/M |
| 3300005764|Ga0066903_103151962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300005764|Ga0066903_104039809 | Not Available | 786 | Open in IMG/M |
| 3300005764|Ga0066903_106614021 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005764|Ga0066903_107321240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300005764|Ga0066903_107800600 | Not Available | 550 | Open in IMG/M |
| 3300006028|Ga0070717_10110084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2349 | Open in IMG/M |
| 3300006046|Ga0066652_101199802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300006173|Ga0070716_100064784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2126 | Open in IMG/M |
| 3300006797|Ga0066659_10090087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2060 | Open in IMG/M |
| 3300006852|Ga0075433_11875507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300006954|Ga0079219_10356247 | Not Available | 943 | Open in IMG/M |
| 3300007076|Ga0075435_102063558 | Not Available | 501 | Open in IMG/M |
| 3300009038|Ga0099829_11455272 | Not Available | 566 | Open in IMG/M |
| 3300009162|Ga0075423_13190013 | Not Available | 502 | Open in IMG/M |
| 3300009792|Ga0126374_10072424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1849 | Open in IMG/M |
| 3300009792|Ga0126374_10213655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1231 | Open in IMG/M |
| 3300009792|Ga0126374_10920700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 679 | Open in IMG/M |
| 3300009792|Ga0126374_11341028 | Not Available | 580 | Open in IMG/M |
| 3300010043|Ga0126380_10595215 | Not Available | 869 | Open in IMG/M |
| 3300010043|Ga0126380_11678786 | Not Available | 570 | Open in IMG/M |
| 3300010046|Ga0126384_10086546 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300010046|Ga0126384_10150419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1792 | Open in IMG/M |
| 3300010046|Ga0126384_10434042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
| 3300010047|Ga0126382_10573470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
| 3300010048|Ga0126373_10228818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1818 | Open in IMG/M |
| 3300010360|Ga0126372_10118018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2042 | Open in IMG/M |
| 3300010360|Ga0126372_10860167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 905 | Open in IMG/M |
| 3300010361|Ga0126378_10783642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1063 | Open in IMG/M |
| 3300010361|Ga0126378_11037599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300010366|Ga0126379_11245216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 850 | Open in IMG/M |
| 3300010366|Ga0126379_12760566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300010376|Ga0126381_103885584 | Not Available | 583 | Open in IMG/M |
| 3300010376|Ga0126381_105078643 | Not Available | 504 | Open in IMG/M |
| 3300010376|Ga0126381_105087333 | Not Available | 504 | Open in IMG/M |
| 3300010398|Ga0126383_11537773 | Not Available | 755 | Open in IMG/M |
| 3300010868|Ga0124844_1140247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 918 | Open in IMG/M |
| 3300011271|Ga0137393_10190395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1728 | Open in IMG/M |
| 3300012202|Ga0137363_11053933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 691 | Open in IMG/M |
| 3300012203|Ga0137399_11138844 | Not Available | 657 | Open in IMG/M |
| 3300012205|Ga0137362_10343097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1293 | Open in IMG/M |
| 3300012205|Ga0137362_11135789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 664 | Open in IMG/M |
| 3300012350|Ga0137372_11165784 | Not Available | 523 | Open in IMG/M |
| 3300012357|Ga0137384_11079066 | Not Available | 644 | Open in IMG/M |
| 3300012361|Ga0137360_10456831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1083 | Open in IMG/M |
| 3300012917|Ga0137395_10891881 | Not Available | 643 | Open in IMG/M |
| 3300012923|Ga0137359_11484052 | Not Available | 566 | Open in IMG/M |
| 3300012948|Ga0126375_10112633 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300012948|Ga0126375_10161885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1425 | Open in IMG/M |
| 3300012948|Ga0126375_11312268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300012989|Ga0164305_10957365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300015372|Ga0132256_100226986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1926 | Open in IMG/M |
| 3300015372|Ga0132256_102907950 | Not Available | 576 | Open in IMG/M |
| 3300016319|Ga0182033_10689079 | Not Available | 894 | Open in IMG/M |
| 3300016387|Ga0182040_11904877 | Not Available | 510 | Open in IMG/M |
| 3300018433|Ga0066667_10691381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300018433|Ga0066667_10777537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300018433|Ga0066667_11916159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 541 | Open in IMG/M |
| 3300021560|Ga0126371_10339369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1635 | Open in IMG/M |
| 3300021560|Ga0126371_12097180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300021560|Ga0126371_12403862 | Not Available | 637 | Open in IMG/M |
| 3300021560|Ga0126371_13782329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300025905|Ga0207685_10024779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2062 | Open in IMG/M |
| 3300025922|Ga0207646_11896462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
| 3300026301|Ga0209238_1145841 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300026329|Ga0209375_1234552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300026332|Ga0209803_1368630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 500 | Open in IMG/M |
| 3300026498|Ga0257156_1057722 | Not Available | 801 | Open in IMG/M |
| 3300026551|Ga0209648_10345691 | Not Available | 1027 | Open in IMG/M |
| 3300026551|Ga0209648_10411714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 876 | Open in IMG/M |
| 3300026551|Ga0209648_10770919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300026557|Ga0179587_10759056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300027071|Ga0209214_1023597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300027748|Ga0209689_1217454 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300031543|Ga0318516_10006813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5308 | Open in IMG/M |
| 3300031544|Ga0318534_10803649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300031545|Ga0318541_10181880 | Not Available | 1161 | Open in IMG/M |
| 3300031545|Ga0318541_10235837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300031545|Ga0318541_10299862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300031549|Ga0318571_10060294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1155 | Open in IMG/M |
| 3300031561|Ga0318528_10365633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 774 | Open in IMG/M |
| 3300031572|Ga0318515_10093796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300031573|Ga0310915_10416326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 954 | Open in IMG/M |
| 3300031640|Ga0318555_10624041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300031680|Ga0318574_10029277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2768 | Open in IMG/M |
| 3300031682|Ga0318560_10159451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1195 | Open in IMG/M |
| 3300031724|Ga0318500_10073095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1510 | Open in IMG/M |
| 3300031748|Ga0318492_10104848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1392 | Open in IMG/M |
| 3300031748|Ga0318492_10180621 | Not Available | 1073 | Open in IMG/M |
| 3300031763|Ga0318537_10025105 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300031769|Ga0318526_10062544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1440 | Open in IMG/M |
| 3300031770|Ga0318521_10012966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3667 | Open in IMG/M |
| 3300031770|Ga0318521_10029306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2678 | Open in IMG/M |
| 3300031771|Ga0318546_10204517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1349 | Open in IMG/M |
| 3300031771|Ga0318546_11108992 | Not Available | 556 | Open in IMG/M |
| 3300031781|Ga0318547_10045140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2347 | Open in IMG/M |
| 3300031782|Ga0318552_10640971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300031795|Ga0318557_10106247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1245 | Open in IMG/M |
| 3300031819|Ga0318568_11036954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300031835|Ga0318517_10016463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2775 | Open in IMG/M |
| 3300031845|Ga0318511_10314330 | Not Available | 709 | Open in IMG/M |
| 3300031860|Ga0318495_10349735 | Not Available | 654 | Open in IMG/M |
| 3300031880|Ga0318544_10347506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300031890|Ga0306925_10292478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. YIM 130001 | 1753 | Open in IMG/M |
| 3300031893|Ga0318536_10050187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2012 | Open in IMG/M |
| 3300031910|Ga0306923_10022570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6684 | Open in IMG/M |
| 3300031910|Ga0306923_12501045 | Not Available | 509 | Open in IMG/M |
| 3300031954|Ga0306926_10816169 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300031954|Ga0306926_11493611 | Not Available | 780 | Open in IMG/M |
| 3300032010|Ga0318569_10486699 | Not Available | 575 | Open in IMG/M |
| 3300032035|Ga0310911_10180256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300032035|Ga0310911_10642130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300032039|Ga0318559_10302520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300032039|Ga0318559_10408175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300032043|Ga0318556_10699300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300032055|Ga0318575_10382093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300032063|Ga0318504_10020955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2474 | Open in IMG/M |
| 3300032064|Ga0318510_10540982 | Not Available | 507 | Open in IMG/M |
| 3300032067|Ga0318524_10078753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1611 | Open in IMG/M |
| 3300032089|Ga0318525_10198838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
| 3300032180|Ga0307471_103544835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 552 | Open in IMG/M |
| 3300032205|Ga0307472_102310979 | Not Available | 544 | Open in IMG/M |
| 3300032261|Ga0306920_101017836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1205 | Open in IMG/M |
| 3300032261|Ga0306920_101443727 | Not Available | 984 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_13475150 | 2124908045 | Soil | YGSGLYSGYGCPAYSNYWIPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| E4A_05798690 | 2170459003 | Grass Soil | YSNYWVPYGTSSSAPYGVYASSYALACERLKSGYADPYGPIFY |
| JGI10216J12902_1073591272 | 3300000956 | Soil | SNYWVPYGTSSSAPYGVYASSYALACERLKSGYADPYGPIFY* |
| Ga0066688_102317102 | 3300005178 | Soil | VAGSGGYGYSPPTYSNYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0066388_1043190451 | 3300005332 | Tropical Forest Soil | WIPYGTSWTAPYGVSASSYAQACERLKSGYAAPYGPIFY* |
| Ga0066388_1053899582 | 3300005332 | Tropical Forest Soil | CGWVPYGTSYAAPCGVYASSYAIARERLRSGYADPYGPIFY* |
| Ga0066388_1057124393 | 3300005332 | Tropical Forest Soil | SGYGCPAYSNYWVPYGTSSAAPYGIYASSYAIACERLKSAYAAPYGPIFY* |
| Ga0066388_1061611401 | 3300005332 | Tropical Forest Soil | GGYGYSSPAYSSYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0066388_1063877272 | 3300005332 | Tropical Forest Soil | GYGCPAYSNYWVPYGTSSSAPYGVYASSYALACERLKSGYADPYGPIFY* |
| Ga0070706_1000681506 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGSGGYGYSPPTYSSYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0070699_1000753694 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LYSGYGYPVSYYLPYGTSYAGPYGIYSSSYAIAYKRLQSGYAAPYGPIFY* |
| Ga0066695_100585125 | 3300005553 | Soil | YGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066692_105090192 | 3300005555 | Soil | VAGSGGYGYSSPAYSSYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0066905_1002519961 | 3300005713 | Tropical Forest Soil | TSSSAPYGIYASSYAQACERLKSGYAAPYGPIFY* |
| Ga0066905_1006869243 | 3300005713 | Tropical Forest Soil | YGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066905_1008512053 | 3300005713 | Tropical Forest Soil | YGCPASNYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066905_1008749471 | 3300005713 | Tropical Forest Soil | PYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066905_1009255491 | 3300005713 | Tropical Forest Soil | LYSGYGCPAYSGYWVPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066905_1009828651 | 3300005713 | Tropical Forest Soil | GTSSSAPWGVYASSFAMACERVKSGYAAPYGPIFY* |
| Ga0066905_1010511011 | 3300005713 | Tropical Forest Soil | GCPTYSSYWVPYGTSSSAPYGIYASSYALACERLKSGYAAPYGPIFY* |
| Ga0066905_1014222822 | 3300005713 | Tropical Forest Soil | SGNGCPAYSSYWVPYGTSWSAPYGISASSYAQACERLKSGYAAPYGPIFY* |
| Ga0066905_1016147921 | 3300005713 | Tropical Forest Soil | RYGCPASNYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066905_1018812162 | 3300005713 | Tropical Forest Soil | GTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0066905_1021434991 | 3300005713 | Tropical Forest Soil | GTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066905_1021715942 | 3300005713 | Tropical Forest Soil | SSYWVPYGTSSSAPFGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066903_1013638231 | 3300005764 | Tropical Forest Soil | ASNYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066903_1016006661 | 3300005764 | Tropical Forest Soil | GLDSGYGCPAYSNYWVPYGTSSAAPYGIAASSYAIACERLKSGYAAPNGPIFY* |
| Ga0066903_1031519622 | 3300005764 | Tropical Forest Soil | VAGSGGYGYSSPAYSNYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY* |
| Ga0066903_1040398092 | 3300005764 | Tropical Forest Soil | WVPYGTSSSAPYGIYSSSYAIACERLKSGYAAPYGPIFY* |
| Ga0066903_1066140212 | 3300005764 | Tropical Forest Soil | YGCPAYSNYWIPYGTSAAAPYGIAASSYAIACERLKSGYAAPNGPIFY* |
| Ga0066903_1073212401 | 3300005764 | Tropical Forest Soil | WVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0066903_1078006002 | 3300005764 | Tropical Forest Soil | GTSYAAPYGVYSSSYAIAYERLKSGYAAPYGPIFY* |
| Ga0070717_101100845 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0066652_1011998022 | 3300006046 | Soil | LPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0070716_1000647841 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TSWSAPYGISASSYAQACERLKSGYAAPYGPIFY* |
| Ga0066659_100900875 | 3300006797 | Soil | PYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0075433_118755073 | 3300006852 | Populus Rhizosphere | YWVPYGTSSSAPWGVYASSYALACERVKSGYAAPYGPIFY* |
| Ga0079219_103562471 | 3300006954 | Agricultural Soil | YSVASSSYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0075435_1020635581 | 3300007076 | Populus Rhizosphere | WVPYGTSWSAPYGISAGSYAQACERLKSGYAAPYGPIFY* |
| Ga0099829_114552721 | 3300009038 | Vadose Zone Soil | IPYGTSYAAPYGIYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0075423_131900132 | 3300009162 | Populus Rhizosphere | YSGYGCPAYSSYWVPYGTSWSAPYGISASSYGQACERLKSGYAAPYGPIFY* |
| Ga0126374_100724241 | 3300009792 | Tropical Forest Soil | SGYGCPAYSSYWVPYGTSSSAPYGIYASSYAQACERLKSGYAAPYGPIFY* |
| Ga0126374_102136553 | 3300009792 | Tropical Forest Soil | NGLYSGYSSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY* |
| Ga0126374_109207002 | 3300009792 | Tropical Forest Soil | SGYGCPASGYWVPYGTSSSAPWGVYASSFALACERVKSGYADPYGPIFY* |
| Ga0126374_113410281 | 3300009792 | Tropical Forest Soil | NGLYSGYSSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY* |
| Ga0126380_105952152 | 3300010043 | Tropical Forest Soil | SNYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0126380_116787861 | 3300010043 | Tropical Forest Soil | TSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0126384_100865461 | 3300010046 | Tropical Forest Soil | GTSSSAPYGIYASSYAQACERLKSGYAAPYGPIFY* |
| Ga0126384_101504191 | 3300010046 | Tropical Forest Soil | YSSYYLPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY* |
| Ga0126384_104340423 | 3300010046 | Tropical Forest Soil | VPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0126382_105734702 | 3300010047 | Tropical Forest Soil | SSPAYSSYYLPYGTSYAAPYGIYASSYAIAHERLKSGYAAPYGPIFY* |
| Ga0126373_102288184 | 3300010048 | Tropical Forest Soil | SGLNSGYGCPASGYWVPYGTSSSAPWGVYASSFALACERVKSGYADPYGPIFY* |
| Ga0126372_101180181 | 3300010360 | Tropical Forest Soil | NGLHSGYGYPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY* |
| Ga0126372_108601671 | 3300010360 | Tropical Forest Soil | NGLHSGYGYPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY* |
| Ga0126378_107836421 | 3300010361 | Tropical Forest Soil | LYSGYSSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY* |
| Ga0126378_110375991 | 3300010361 | Tropical Forest Soil | TSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0126379_112452161 | 3300010366 | Tropical Forest Soil | GCPASGYWVPYGTSSSAPWGVYASSFALACERVKSGYADPYGPIFY* |
| Ga0126379_127605661 | 3300010366 | Tropical Forest Soil | PYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY* |
| Ga0126381_1038855841 | 3300010376 | Tropical Forest Soil | AYSSYWVPYGTSAAAPYGIAASSYAIACERLKSGYAAPNGPIFY* |
| Ga0126381_1050786431 | 3300010376 | Tropical Forest Soil | NYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0126381_1050873331 | 3300010376 | Tropical Forest Soil | AYSNYWVPYGTSSSAPYGIYASSYAIACERVKSGYAAPYGPIFY* |
| Ga0126383_115377731 | 3300010398 | Tropical Forest Soil | YGCPAYSNYWVPYGTSSAAPYGIYASSYAIVYERLKSGYAAPYGPIFY* |
| Ga0124844_11402472 | 3300010868 | Tropical Forest Soil | YSNYWVPYGTSSSAPYGVYASSYALACERLKSGYADPYGPIFY* |
| Ga0137393_101903951 | 3300011271 | Vadose Zone Soil | YSSYWIPYGTSYAAPYGIYSSSYGIAHERLKSGYAAPYGPIFY* |
| Ga0137363_110539332 | 3300012202 | Vadose Zone Soil | YASAAGYGHGLYSGYGYPAYSSYYIPYGTSYAAPYGIYSSSYAIAHERLQSGYAAPYGPIFY* |
| Ga0137399_111388441 | 3300012203 | Vadose Zone Soil | SYYIPYGTSYAAPYGIYSSSYAKAYKRLQSGYAAPYGPIFY* |
| Ga0137362_103430972 | 3300012205 | Vadose Zone Soil | SYYIPYGTSYAAPYGIYSSSYAIAYKRLQSGYAAPYGPIFY* |
| Ga0137362_111357892 | 3300012205 | Vadose Zone Soil | GLYSGYGYPAYSSYYIPYGTSYAAPYGIYSSSYAKAYKRLQSGYAAPYGPIFY* |
| Ga0137372_111657841 | 3300012350 | Vadose Zone Soil | GTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY* |
| Ga0137384_110790662 | 3300012357 | Vadose Zone Soil | PYGTSYAAPYGIYSSSYAIAYERLRAGYAAPYGPIFY* |
| Ga0137360_104568311 | 3300012361 | Vadose Zone Soil | IPYGTSYAAPYGIYSSSYAIAYKRLQSGYAAPYGPIFY* |
| Ga0137395_108918811 | 3300012917 | Vadose Zone Soil | GLYSGYGHPAYSSYYIPYGTSYAAPYGIYSSSYAIAYKRLQSGYAAPYGPIFY* |
| Ga0137359_114840521 | 3300012923 | Vadose Zone Soil | SSYYIPYGTSYAAPYGIYSSSYAIAYKRLQSGYAAPYGPIFY* |
| Ga0126375_101126331 | 3300012948 | Tropical Forest Soil | GLHSGYGYPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY* |
| Ga0126375_101618851 | 3300012948 | Tropical Forest Soil | SSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY* |
| Ga0126375_113122681 | 3300012948 | Tropical Forest Soil | SGGYGYSSPAYSSYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0164305_109573651 | 3300012989 | Soil | PYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0132256_1002269863 | 3300015372 | Arabidopsis Rhizosphere | ASNYWVPYGTSSSAPYGIYASSYALACERLKSGYAAPYGPIFY* |
| Ga0132256_1029079501 | 3300015372 | Arabidopsis Rhizosphere | AGSGGYGYSSPTYSSYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYAAPYGPIFY* |
| Ga0182033_106890791 | 3300016319 | Soil | NYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0182040_119048772 | 3300016387 | Soil | SSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY |
| Ga0066667_106913811 | 3300018433 | Grasslands Soil | GSAVAGSGGYGYSPPTYSNYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0066667_107775371 | 3300018433 | Grasslands Soil | SYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0066667_119161592 | 3300018433 | Grasslands Soil | CPAYSNYWVPYGTSSAAPYGIYASSYAVACERLKSGYAAPYGPIFY |
| Ga0126371_103393694 | 3300021560 | Tropical Forest Soil | YYLPYGTSYAAPYGIYSSSYAIAYERLRAGYAAPYGPIFY |
| Ga0126371_120971801 | 3300021560 | Tropical Forest Soil | SYYLPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY |
| Ga0126371_124038622 | 3300021560 | Tropical Forest Soil | GLYSGYSSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0126371_137823291 | 3300021560 | Tropical Forest Soil | SGYGCPAYSNYWVPYGTSAAAPYGIAASSYAIACERLKSGYAAPNGPIFY |
| Ga0207685_100247795 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YWVPYGTSWSAPYGISASSYAQACERLKSGYAAPYGPIFY |
| Ga0207646_118964622 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PTYSSYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0209238_11458411 | 3300026301 | Grasslands Soil | RPVGPAVFGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0209375_12345522 | 3300026329 | Soil | YWLPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0209803_13686302 | 3300026332 | Soil | YGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0257156_10577221 | 3300026498 | Soil | GYGLYSGYGYPAYSSGYLPYGTSYAAPYGIYSSSYAIAYERLQAGYAAPYGPSSYYRRPFGIFY |
| Ga0209648_103456911 | 3300026551 | Grasslands Soil | GYGYSSPAYSSYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0209648_104117142 | 3300026551 | Grasslands Soil | PYGTSYAAPYGIYSSSYAIAYKRLQSGYAAPYGPIFY |
| Ga0209648_107709191 | 3300026551 | Grasslands Soil | SYYIPYGTSYAAPYGIYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0179587_107590562 | 3300026557 | Vadose Zone Soil | AYGTAAAGSGGYGYSPPTYSSYWIPYGTSYAAPYGIYSSSYGIAHERLKSGYAAPYGPIF |
| Ga0209214_10235971 | 3300027071 | Forest Soil | PAYSNYWVPYGTSSSAPYGVYASSYALACERLKSGYADPYGPIFY |
| Ga0209689_12174542 | 3300027748 | Soil | AYSNYWVPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318516_100068131 | 3300031543 | Soil | PYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318534_108036492 | 3300031544 | Soil | GYGYSSPAYSNYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318541_101818801 | 3300031545 | Soil | WVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318541_102358371 | 3300031545 | Soil | PAYSNYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318541_102998623 | 3300031545 | Soil | VPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318571_100602943 | 3300031549 | Soil | AYGAAVAGSGGYGYSSPAYSNYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIF |
| Ga0318528_103656332 | 3300031561 | Soil | YGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0318515_100937963 | 3300031572 | Soil | VAGSGGYGYSAPAYSNYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0310915_104163261 | 3300031573 | Soil | GTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318555_106240412 | 3300031640 | Soil | NYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318574_100292771 | 3300031680 | Soil | AAGYGNGLYSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318560_101594513 | 3300031682 | Soil | WIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318500_100730953 | 3300031724 | Soil | GTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318492_101048481 | 3300031748 | Soil | SGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLKSGYAAPYGPIFY |
| Ga0318492_101806211 | 3300031748 | Soil | WVPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318537_100251051 | 3300031763 | Soil | LYSGYGCPAYSSYWIPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318526_100625441 | 3300031769 | Soil | SAAGYGNGLYSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318521_100129666 | 3300031770 | Soil | YGNGLYSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318521_100293067 | 3300031770 | Soil | SGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318546_102045171 | 3300031771 | Soil | YGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318546_111089921 | 3300031771 | Soil | SSYWVPYGTSSSAPFGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318547_100451401 | 3300031781 | Soil | AGYGNGLYSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318552_106409711 | 3300031782 | Soil | SGLYSGYGCPAYSNYWVPYGTSSAAPYGIYASSYAKACERLKSGYAAPYGPIFY |
| Ga0318557_101062471 | 3300031795 | Soil | YSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318568_110369542 | 3300031819 | Soil | SNYWIPYGTSYAAPYGVYSSSYAIAHERLKSGYAAPYGPIFY |
| Ga0318517_100164637 | 3300031835 | Soil | GNGLYSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318511_103143303 | 3300031845 | Soil | SYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318495_103497351 | 3300031860 | Soil | SNYWVPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318544_103475062 | 3300031880 | Soil | SPAYSNYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0306925_102924783 | 3300031890 | Soil | GTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0306925_122485011 | 3300031890 | Soil | SSAPDCGWVPYGTSYAAPCGVYASSYAIARERLRSGYADPYGPIFY |
| Ga0318536_100501871 | 3300031893 | Soil | LYSGYSSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0306923_100225709 | 3300031910 | Soil | VAGSGGYGYSPPAYSNYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYG |
| Ga0306923_125010451 | 3300031910 | Soil | PASNYWVPYGTSSSAPYGIYASSYGIACERLKSGYAAPYGPIFY |
| Ga0306926_108161691 | 3300031954 | Soil | YSGYRCPASNYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0306926_114936111 | 3300031954 | Soil | NGLYSGYSSPAYSSYYLPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318569_104866992 | 3300032010 | Soil | PYGVTSQAPWGVYASSYALACERVKSGYAAPYGPIFY |
| Ga0310911_101802563 | 3300032035 | Soil | GYSSYWIPYGTSSSAPYGIYASSYAIACERLRSGYAAPYGPVFY |
| Ga0310911_106421301 | 3300032035 | Soil | YSNYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318559_103025201 | 3300032039 | Soil | SNYWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0318559_104081752 | 3300032039 | Soil | PYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318556_106993001 | 3300032043 | Soil | YGYSSPAYSNYWIPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318575_103820932 | 3300032055 | Soil | WVPYGTSYAAPCGVYASSYAIARERLRSGYADPYGPIFY |
| Ga0318504_100209551 | 3300032063 | Soil | LYSGYSSPAYSSYWIPYGTSYAAPYGIYASSYAIAYERLRAGYAAPYGPIFY |
| Ga0318510_105409822 | 3300032064 | Soil | VAGSGGYGYSPPAYSNYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0318524_100787534 | 3300032067 | Soil | PYGTSYAAPYGVYSSSYAIAYERLRAGYAAPYGPIFY |
| Ga0318525_101988382 | 3300032089 | Soil | GYSAPAYSNYWVPYGTSYAAPYGIYSSSYAIAHERLKSGYADPYGPIFY |
| Ga0307471_1035448352 | 3300032180 | Hardwood Forest Soil | AYSSHWVPYGTSWSAPYGISAGSYAQACERLKSGYAAPYGPIFY |
| Ga0307472_1023109791 | 3300032205 | Hardwood Forest Soil | SSYYIPYGTSYAAPYGIYSSSYAIAHERLQSGYAAPYGPIFY |
| Ga0306920_1010178363 | 3300032261 | Soil | YWVPYGTSSAAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| Ga0306920_1014437273 | 3300032261 | Soil | YWVPYGTSSSAPYGIYASSYAIACERLKSGYAAPYGPIFY |
| ⦗Top⦘ |