


| Basic Information | |
|---|---|
| Family ID | F046563 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VAVTGLANLAVKVADLDAACAFYEAAGADVRDRMHWNNGERADVYLG |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.83 % |
| % of genes near scaffold ends (potentially truncated) | 99.34 % |
| % of genes from short scaffolds (< 2000 bps) | 92.72 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.265 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds (7.947 % of family members) |
| Environment Ontology (ENVO) | Unclassified (16.556 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.424 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.33% β-sheet: 20.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF06772 | LtrA | 7.28 |
| PF01408 | GFO_IDH_MocA | 4.64 |
| PF00884 | Sulfatase | 4.64 |
| PF07969 | Amidohydro_3 | 2.65 |
| PF17124 | ThiJ_like | 2.65 |
| PF03551 | PadR | 1.99 |
| PF13622 | 4HBT_3 | 1.99 |
| PF00582 | Usp | 1.32 |
| PF03795 | YCII | 1.32 |
| PF04101 | Glyco_tran_28_C | 1.32 |
| PF06445 | GyrI-like | 1.32 |
| PF09335 | SNARE_assoc | 1.32 |
| PF08448 | PAS_4 | 1.32 |
| PF04909 | Amidohydro_2 | 1.32 |
| PF11716 | MDMPI_N | 1.32 |
| PF00881 | Nitroreductase | 1.32 |
| PF12697 | Abhydrolase_6 | 1.32 |
| PF07690 | MFS_1 | 1.32 |
| PF02894 | GFO_IDH_MocA_C | 1.32 |
| PF00144 | Beta-lactamase | 0.66 |
| PF05726 | Pirin_C | 0.66 |
| PF13614 | AAA_31 | 0.66 |
| PF13673 | Acetyltransf_10 | 0.66 |
| PF01261 | AP_endonuc_2 | 0.66 |
| PF12681 | Glyoxalase_2 | 0.66 |
| PF13424 | TPR_12 | 0.66 |
| PF13649 | Methyltransf_25 | 0.66 |
| PF02518 | HATPase_c | 0.66 |
| PF02687 | FtsX | 0.66 |
| PF01450 | IlvC | 0.66 |
| PF11026 | DUF2721 | 0.66 |
| PF05982 | Sbt_1 | 0.66 |
| PF00171 | Aldedh | 0.66 |
| PF13193 | AMP-binding_C | 0.66 |
| PF10604 | Polyketide_cyc2 | 0.66 |
| PF13577 | SnoaL_4 | 0.66 |
| PF00444 | Ribosomal_L36 | 0.66 |
| PF01844 | HNH | 0.66 |
| PF04237 | YjbR | 0.66 |
| PF08245 | Mur_ligase_M | 0.66 |
| PF01152 | Bac_globin | 0.66 |
| PF00201 | UDPGT | 0.66 |
| PF13561 | adh_short_C2 | 0.66 |
| PF00730 | HhH-GPD | 0.66 |
| PF13426 | PAS_9 | 0.66 |
| PF01520 | Amidase_3 | 0.66 |
| PF05139 | Erythro_esteras | 0.66 |
| PF04138 | GtrA | 0.66 |
| PF00903 | Glyoxalase | 0.66 |
| PF01636 | APH | 0.66 |
| PF01575 | MaoC_dehydratas | 0.66 |
| PF03060 | NMO | 0.66 |
| PF02771 | Acyl-CoA_dh_N | 0.66 |
| PF04115 | Ureidogly_lyase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 7.28 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.99 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.99 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.99 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.32 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.32 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.32 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.32 |
| COG1819 | UDP:flavonoid glycosyltransferase YjiC, YdhE family | Carbohydrate transport and metabolism [G] | 1.32 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.32 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.66 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.66 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.66 |
| COG0257 | Ribosomal protein L36 | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.66 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.66 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.66 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.66 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.66 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.66 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.66 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.66 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.66 |
| COG2312 | Erythromycin esterase homolog | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.66 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.66 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.66 |
| COG3194 | Ureidoglycolate hydrolase (allantoin degradation) | Nucleotide transport and metabolism [F] | 0.66 |
| COG3329 | Na+-dependent bicarbonate transporter SbtA | Energy production and conversion [C] | 0.66 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.26 % |
| Unclassified | root | N/A | 39.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908007|FWIRElOz_GKZ9IRQ02JAH2N | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Neomegalonemataceae → Neomegalonema → Neomegalonema perideroedes | 526 | Open in IMG/M |
| 2170459005|F1BAP7Q02IQ8ZH | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 2170459013|GO6OHWN01CMFV7 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300001661|JGI12053J15887_10473308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 599 | Open in IMG/M |
| 3300003219|JGI26341J46601_10044468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1405 | Open in IMG/M |
| 3300003369|JGI24140J50213_10050466 | Not Available | 1477 | Open in IMG/M |
| 3300003861|Ga0031654_10094296 | Not Available | 837 | Open in IMG/M |
| 3300003987|Ga0055471_10246343 | Not Available | 566 | Open in IMG/M |
| 3300004092|Ga0062389_102349679 | Not Available | 704 | Open in IMG/M |
| 3300004479|Ga0062595_102424904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300005167|Ga0066672_10164039 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300005176|Ga0066679_10366287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 943 | Open in IMG/M |
| 3300005332|Ga0066388_108042559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300005335|Ga0070666_11527519 | Not Available | 500 | Open in IMG/M |
| 3300005455|Ga0070663_101850122 | Not Available | 542 | Open in IMG/M |
| 3300005456|Ga0070678_101221198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300005456|Ga0070678_102109651 | Not Available | 534 | Open in IMG/M |
| 3300005518|Ga0070699_101939676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300005569|Ga0066705_10207070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300005995|Ga0066790_10190185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 878 | Open in IMG/M |
| 3300006046|Ga0066652_100903578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 842 | Open in IMG/M |
| 3300006050|Ga0075028_100246027 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006050|Ga0075028_100956821 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006052|Ga0075029_100587600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 743 | Open in IMG/M |
| 3300006052|Ga0075029_101312603 | Not Available | 508 | Open in IMG/M |
| 3300006057|Ga0075026_100865664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces albidoflavus group → Streptomyces albidoflavus | 553 | Open in IMG/M |
| 3300006059|Ga0075017_100621332 | Not Available | 827 | Open in IMG/M |
| 3300006059|Ga0075017_101559691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300006102|Ga0075015_100143766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1236 | Open in IMG/M |
| 3300006102|Ga0075015_100785603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium cellulans | 570 | Open in IMG/M |
| 3300006173|Ga0070716_100941533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300006176|Ga0070765_101402186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300006196|Ga0075422_10603181 | Not Available | 508 | Open in IMG/M |
| 3300006572|Ga0074051_10727822 | Not Available | 547 | Open in IMG/M |
| 3300006795|Ga0075520_1008890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5068 | Open in IMG/M |
| 3300009093|Ga0105240_12309253 | Not Available | 557 | Open in IMG/M |
| 3300009094|Ga0111539_12570226 | Not Available | 590 | Open in IMG/M |
| 3300009143|Ga0099792_10656148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300009148|Ga0105243_11831954 | Not Available | 638 | Open in IMG/M |
| 3300009174|Ga0105241_11953988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300009176|Ga0105242_10022665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4943 | Open in IMG/M |
| 3300009523|Ga0116221_1028327 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
| 3300009525|Ga0116220_10271367 | Not Available | 743 | Open in IMG/M |
| 3300009686|Ga0123338_10387164 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009839|Ga0116223_10356932 | Not Available | 865 | Open in IMG/M |
| 3300009840|Ga0126313_11344740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 591 | Open in IMG/M |
| 3300010379|Ga0136449_100193094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3890 | Open in IMG/M |
| 3300010379|Ga0136449_101580050 | Not Available | 998 | Open in IMG/M |
| 3300010880|Ga0126350_11052345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3896 | Open in IMG/M |
| 3300012930|Ga0137407_10037178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3856 | Open in IMG/M |
| 3300012930|Ga0137407_11896811 | Not Available | 568 | Open in IMG/M |
| 3300012951|Ga0164300_10940971 | Not Available | 550 | Open in IMG/M |
| 3300012958|Ga0164299_11458572 | Not Available | 532 | Open in IMG/M |
| 3300012985|Ga0164308_12171082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300012987|Ga0164307_10366841 | Not Available | 1050 | Open in IMG/M |
| 3300012988|Ga0164306_11763517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300013308|Ga0157375_11488651 | Not Available | 799 | Open in IMG/M |
| 3300014058|Ga0120149_1239274 | Not Available | 509 | Open in IMG/M |
| 3300014164|Ga0181532_10494756 | Not Available | 671 | Open in IMG/M |
| 3300014201|Ga0181537_11163034 | Not Available | 521 | Open in IMG/M |
| 3300014325|Ga0163163_11599296 | Not Available | 713 | Open in IMG/M |
| 3300014325|Ga0163163_11658286 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300014489|Ga0182018_10042109 | Not Available | 2834 | Open in IMG/M |
| 3300014498|Ga0182019_11370193 | Not Available | 524 | Open in IMG/M |
| 3300014499|Ga0182012_10507831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300014502|Ga0182021_13419921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 528 | Open in IMG/M |
| 3300014638|Ga0181536_10387605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300014745|Ga0157377_11289672 | Not Available | 570 | Open in IMG/M |
| 3300014838|Ga0182030_11731898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300015374|Ga0132255_101765569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 939 | Open in IMG/M |
| 3300017924|Ga0187820_1060725 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300017948|Ga0187847_10089760 | Not Available | 1701 | Open in IMG/M |
| 3300017995|Ga0187816_10488300 | Not Available | 554 | Open in IMG/M |
| 3300018012|Ga0187810_10437702 | Not Available | 553 | Open in IMG/M |
| 3300018034|Ga0187863_10816266 | Not Available | 529 | Open in IMG/M |
| 3300018064|Ga0187773_10901228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
| 3300018090|Ga0187770_11582064 | Not Available | 534 | Open in IMG/M |
| 3300018476|Ga0190274_12684968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 595 | Open in IMG/M |
| 3300020213|Ga0163152_10474171 | Not Available | 576 | Open in IMG/M |
| 3300021384|Ga0213876_10017121 | All Organisms → cellular organisms → Bacteria | 3827 | Open in IMG/M |
| 3300021384|Ga0213876_10705238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300025505|Ga0207929_1102831 | Not Available | 533 | Open in IMG/M |
| 3300025907|Ga0207645_11206700 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 508 | Open in IMG/M |
| 3300025915|Ga0207693_11182799 | Not Available | 577 | Open in IMG/M |
| 3300025937|Ga0207669_10742805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
| 3300025939|Ga0207665_11017645 | Not Available | 659 | Open in IMG/M |
| 3300025961|Ga0207712_12129771 | Not Available | 502 | Open in IMG/M |
| 3300027497|Ga0208199_1037138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1055 | Open in IMG/M |
| 3300027826|Ga0209060_10346314 | Not Available | 677 | Open in IMG/M |
| 3300027898|Ga0209067_10160760 | Not Available | 1195 | Open in IMG/M |
| 3300027911|Ga0209698_10078531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Aciditerrimonas → Aciditerrimonas ferrireducens | 2804 | Open in IMG/M |
| 3300027911|Ga0209698_11332508 | Not Available | 525 | Open in IMG/M |
| 3300028563|Ga0265319_1261132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300028743|Ga0302262_10279810 | Not Available | 567 | Open in IMG/M |
| 3300028780|Ga0302225_10379426 | Not Available | 665 | Open in IMG/M |
| 3300028800|Ga0265338_10992611 | Not Available | 569 | Open in IMG/M |
| 3300028882|Ga0302154_10105536 | Not Available | 1514 | Open in IMG/M |
| 3300028906|Ga0308309_11340250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300029908|Ga0311341_10666991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300029914|Ga0311359_10211420 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300029920|Ga0302142_1084890 | Not Available | 983 | Open in IMG/M |
| 3300029922|Ga0311363_10416872 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300029984|Ga0311332_10664969 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300029987|Ga0311334_10703257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 827 | Open in IMG/M |
| 3300029988|Ga0302190_10165527 | Not Available | 933 | Open in IMG/M |
| 3300029992|Ga0302276_10316828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 669 | Open in IMG/M |
| 3300029994|Ga0302283_1206996 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300029998|Ga0302271_10531111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300030007|Ga0311338_10874140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300030010|Ga0302299_10168247 | Not Available | 1181 | Open in IMG/M |
| 3300030010|Ga0302299_10471513 | Not Available | 634 | Open in IMG/M |
| 3300030019|Ga0311348_10849705 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300030706|Ga0310039_10092195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1276 | Open in IMG/M |
| 3300031184|Ga0307499_10196364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031240|Ga0265320_10480157 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031250|Ga0265331_10079354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1527 | Open in IMG/M |
| 3300031344|Ga0265316_10929102 | Not Available | 607 | Open in IMG/M |
| 3300031344|Ga0265316_11072799 | Not Available | 559 | Open in IMG/M |
| 3300031455|Ga0307505_10646157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300031543|Ga0318516_10454789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300031572|Ga0318515_10347708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300031671|Ga0307372_10024445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 6923 | Open in IMG/M |
| 3300031713|Ga0318496_10586203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
| 3300031722|Ga0311351_10893145 | Not Available | 679 | Open in IMG/M |
| 3300031747|Ga0318502_10224846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1091 | Open in IMG/M |
| 3300031751|Ga0318494_10706819 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031794|Ga0318503_10211155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
| 3300031805|Ga0318497_10174380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1183 | Open in IMG/M |
| 3300031805|Ga0318497_10368827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 802 | Open in IMG/M |
| 3300031835|Ga0318517_10452454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300031890|Ga0306925_10599677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1163 | Open in IMG/M |
| 3300031910|Ga0306923_12157150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha rutila | 560 | Open in IMG/M |
| 3300031999|Ga0315274_11596887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300032044|Ga0318558_10490754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300032091|Ga0318577_10228308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 891 | Open in IMG/M |
| 3300032118|Ga0315277_10549301 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300032126|Ga0307415_101423177 | Not Available | 661 | Open in IMG/M |
| 3300032143|Ga0315292_10399812 | Not Available | 1153 | Open in IMG/M |
| 3300032143|Ga0315292_11339229 | Not Available | 585 | Open in IMG/M |
| 3300032156|Ga0315295_11166760 | Not Available | 757 | Open in IMG/M |
| 3300032160|Ga0311301_10700946 | Not Available | 1423 | Open in IMG/M |
| 3300032160|Ga0311301_11010520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
| 3300032160|Ga0311301_12349454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300032177|Ga0315276_10208278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2054 | Open in IMG/M |
| 3300032397|Ga0315287_10361980 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300032770|Ga0335085_11068948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 867 | Open in IMG/M |
| 3300032893|Ga0335069_12028161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300033803|Ga0314862_0112681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300033818|Ga0334804_030287 | Not Available | 1743 | Open in IMG/M |
| 3300034128|Ga0370490_0199342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 658 | Open in IMG/M |
| 3300034195|Ga0370501_0371940 | Not Available | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.28% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.62% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 5.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.30% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.64% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.32% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.32% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.32% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.66% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.66% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.66% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.66% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRElOz_08340770 | 2124908007 | Soil | MANLAVKVADLDAACAFYEAAGAEVRDRMEWNNGERAD |
| E41_10778550 | 2170459005 | Grass Soil | MAITGMANMGSKGRRLDAACAFYEGAGAEVRDRMHWNNG |
| N57_04269030 | 2170459013 | Grass Soil | MANLAVKVADLDAACAYYERAGADVRDRMHWGNGERAD |
| JGI12053J15887_104733083 | 3300001661 | Forest Soil | MSVREDSSVTVIGMANLAVKVADLDAAIAFYERAGAEVHNRMSWAGSERADVGFGALQLT |
| JGI26341J46601_100444683 | 3300003219 | Bog Forest Soil | MSVTGLANLAVKVADLDAAIAFYEGAGAVVRDRMVWGGGE |
| JGI24140J50213_100504662 | 3300003369 | Arctic Peat Soil | VVVTGLANLAVKVADLDAACRFYEAAGAQIRDRQHWRNSERADVYL |
| Ga0031654_100942961 | 3300003861 | Freshwater Lake Sediment | MPVTGVANLAVKVTDLDAAVAYYEAAGASVTDRMVWYGAERADVTLGP |
| Ga0055471_102463432 | 3300003987 | Natural And Restored Wetlands | VAVVGLANLALNVSDLDGACSFYRAAGAEIRDRMHWNGGERADVFLGPVM |
| Ga0062389_1023496791 | 3300004092 | Bog Forest Soil | MANLALKVADLDAACAFYERAGATVRDRMVWRDGERADVFL |
| Ga0062595_1024249042 | 3300004479 | Soil | MANLAVKVADLDAACAFYVAAGAEVRDRAQWNNGERADVFLGPVMITL |
| Ga0066672_101640391 | 3300005167 | Soil | MTVTGIANLAVKVSDMDAAVAFYERAGGIVRDRMTWNGIERADVHLGPIQI |
| Ga0066679_103662871 | 3300005176 | Soil | VRRHYPSGVAITGMANLAVKVADLDAACAFYVAAGADVRDRMQWNNGERAD |
| Ga0066388_1080425592 | 3300005332 | Tropical Forest Soil | MAITGMANLAVKVSDLDAACSFYERAGAEVRDRMMWGNGERADVYLGP |
| Ga0070666_115275192 | 3300005335 | Switchgrass Rhizosphere | VAITGMANLAIKVADLDAACAHYERAGADVRDRMSWHGGE |
| Ga0070663_1018501221 | 3300005455 | Corn Rhizosphere | VTVTGMANLAVKVTDLDAACDFYRAAGGDVRDRMEWGGGERADV |
| Ga0070678_1012211982 | 3300005456 | Miscanthus Rhizosphere | MSVTGMANLAVKVADLDAACAFYQRAGAEVRDRMEWNGAE |
| Ga0070678_1021096511 | 3300005456 | Miscanthus Rhizosphere | MAVTGMANLAVKVADLDAAVEFYERAGADVRDRMMWNGSERADVYLGP |
| Ga0070699_1019396761 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVTGLANLAVKVADIDAACAFYEAAGAEVRDRMTWNNGERA |
| Ga0066705_102070701 | 3300005569 | Soil | MANLAVKVVDLDAACAFYVAAGAEVRDRAQWNNGERADVFLGPVMITLF |
| Ga0066790_101901852 | 3300005995 | Soil | MTVTGLGNLAVKVGDLDAAIQFYEGAGATLGDRGPWHGGERA |
| Ga0066652_1009035782 | 3300006046 | Soil | MAVTGMANLAVKVANMDEAVAFYERAGAVVRDRMMWNGSERADVF |
| Ga0075028_1002460271 | 3300006050 | Watersheds | MANLAVKVTNLDEACAFYEGLGAEVRDRMHWNNSERADVY |
| Ga0075028_1009568211 | 3300006050 | Watersheds | VSVTGLANLAVKVADLDDACRFYKAAGAEIRDRMTWGNGERADVFLGP |
| Ga0075029_1005876002 | 3300006052 | Watersheds | VGVTGLANLAVKVADLDEACAFYERAGFDVRDRMQ |
| Ga0075029_1013126031 | 3300006052 | Watersheds | VAVVGLANLAVKVADLDAACRYYAAAGGDSRDRMAWRNGERADV |
| Ga0075026_1008656641 | 3300006057 | Watersheds | MANLAVKVADLDDACAFYEHAGAEVRDRMHWNGGERADVFLGPVMI |
| Ga0075017_1006213323 | 3300006059 | Watersheds | MANIAVKVADLDAACQFYSAAGAEVRDRMEWNNGERADVFLGPVMITLFT |
| Ga0075017_1015596912 | 3300006059 | Watersheds | VGVTGLANLAVKVADLDAACTFYESAGAQVRDRMEWAGG |
| Ga0075015_1001437661 | 3300006102 | Watersheds | VTVTGVANLAVKVADLDAAIAYYERAGASVADRIEWNGAER |
| Ga0075015_1007856031 | 3300006102 | Watersheds | MAITGMANLAVKVADLDAACAFYAAAGADVRDRMRWNDAE |
| Ga0070716_1009415331 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MANLAVKVADLDAACAFYEAAGAEVRDRMHWNNGERADVFLGPVMI |
| Ga0070765_1014021862 | 3300006176 | Soil | VAVTGMANLAIKVSDLDAAVSFYEGAGAEVRDRMHWNNGERADVFLGPIMIT |
| Ga0075422_106031812 | 3300006196 | Populus Rhizosphere | VAVTGLANLAIKVADLDAACAFYDAAGAEVRDRMAWE |
| Ga0074051_107278222 | 3300006572 | Soil | VAVTGMANLAVKVADLDAACRFYAAAGGDVRDRMHWGNGERADEFLGPVMI |
| Ga0075520_10088906 | 3300006795 | Arctic Peat Soil | VGVTGLANLAVKVADLDGAVAFYLAAGAEVRDRMEWAGGERVDV* |
| Ga0105240_123092531 | 3300009093 | Corn Rhizosphere | MANLAVKVADLDAAVEFYERAGAEVRDRMTWNGSERADVY |
| Ga0111539_125702262 | 3300009094 | Populus Rhizosphere | VAVAVTGMANLAVKVSDLDAAIAFYERGGFEVRDRMQWR |
| Ga0099792_106561482 | 3300009143 | Vadose Zone Soil | MANLAVKVADLDAACAFYVAAGADVRDRMQWNNGERADVFLGPVVITLF |
| Ga0105243_118319541 | 3300009148 | Miscanthus Rhizosphere | MANLAIKVADLDAACAYYERAGADVRDRMPWHGGERA |
| Ga0105241_119539882 | 3300009174 | Corn Rhizosphere | MAITGMANLAVKVVDLDAACAFYIAAGAEVRDRMRWNNGER |
| Ga0105242_100226651 | 3300009176 | Miscanthus Rhizosphere | MAITGLANLAIKVADLDAACAFYEAAGAEVRDRVHWNNG |
| Ga0116221_10283275 | 3300009523 | Peatlands Soil | MANLAVKVADLDAAVSFYEAAGAEVRDRMHWNNGERADVFLGPVMIT |
| Ga0116220_102713672 | 3300009525 | Peatlands Soil | VSVTGLANLAVKVADLDAAVAFYESAGAEVRDRMPWHGGERADV |
| Ga0123338_103871641 | 3300009686 | Glacier Valley | MTVTGMANLAVKVSDLDTAIAFYERSGAIVRDRMV |
| Ga0116223_103569322 | 3300009839 | Peatlands Soil | LAVTGIANLAVKVADLDAACAFYEEVGAQVRERMHWNNGERADVYLG |
| Ga0126313_113447401 | 3300009840 | Serpentine Soil | MANLAVKVADLDAACAYYERAGAEVRDRIEWNGAERA |
| Ga0136449_1001930947 | 3300010379 | Peatlands Soil | VAITGLANIAVKVADLDAACTFYSDAGAEIRDRVHWGNGERADVFLGP |
| Ga0136449_1015800501 | 3300010379 | Peatlands Soil | VGAVAVVGLANLAVKVADLDAACRFYLEAGAEVRDRMVWRNGER |
| Ga0126350_110523451 | 3300010880 | Boreal Forest Soil | VSVTGLANLAVKVTDLDDACRFYEEAGAEVRDRMEWGNGERADVF |
| Ga0137407_100371785 | 3300012930 | Vadose Zone Soil | MANLAIKVADLDAACAFYEAAGAQVRDRMHWNNGERADVFL |
| Ga0137407_118968112 | 3300012930 | Vadose Zone Soil | VPVTGLANLAVKVADLDGACAFYEAAGAEVRDRMTWNNGERADV |
| Ga0164300_109409712 | 3300012951 | Soil | MANLAVKVADLDRACAFYEVAGAEVRDRMLWNNGE |
| Ga0164299_114585722 | 3300012958 | Soil | MANLAVKVADLDAAVEFYERAGAEVRDRMTWNGSERADVYLGPVMIT |
| Ga0164308_121710821 | 3300012985 | Soil | MANLAVKVSDLDAACAFYEGAGATVRDRMQWNGGERAD |
| Ga0164307_103668412 | 3300012987 | Soil | MSVTGMANLAVKVADLDAACAYYEQAGAEIRDRMEWNGAERA |
| Ga0164306_117635172 | 3300012988 | Soil | VAVTGMANLAVKVADLDAACAFYERAGATVRDRMVWNGGERADVHLGPVMITLF |
| Ga0157375_114886511 | 3300013308 | Miscanthus Rhizosphere | VAITGMANLAIKVADLDAACAYYERAGADVRDRMSWHGGERAD |
| Ga0120149_12392743 | 3300014058 | Permafrost | MAITGMANLAVKVADLDAACAFYLAAGAQVRDRMVWN |
| Ga0181532_104947562 | 3300014164 | Bog | MMTVTGLANLAVKVADIDEACAFYTAAGADVRDRMMWRNG |
| Ga0181537_111630341 | 3300014201 | Bog | VSVTGLANLAVKVADLDEACRFYEEAGAEVRDRMVWGNGERADVFLGPVMLTL |
| Ga0163163_115992961 | 3300014325 | Switchgrass Rhizosphere | MANLAIKVADLDAACAYYERAGFEVRDRMEWNGAERAD |
| Ga0163163_116582861 | 3300014325 | Switchgrass Rhizosphere | MANLAVKVADLDAACAFYRAAGGEVRDRMVWGGGERADVFLGPVMITLF |
| Ga0182018_100421094 | 3300014489 | Palsa | VTVTGLANLAVKVGDLDAALAFYEAAGAEVHDRMPWHGGERADVFLGPVMI |
| Ga0182019_113701931 | 3300014498 | Fen | VGVTGLANLAVKVADLDGAVDFYLAAGAEVRDRMAWAG |
| Ga0182012_105078312 | 3300014499 | Bog | MAVTGLANLAIKVADLDEACAFYTRAGAGVRDRMHWRN |
| Ga0182021_134199212 | 3300014502 | Fen | MTVTGVANLAVKVADLDHAMAFYRRAGAEVRDRGPWCGGE |
| Ga0181536_103876052 | 3300014638 | Bog | MAVTGIANLAIKVADLDEACAYYVRAGAQVRDRMHWRNGERA |
| Ga0157377_112896722 | 3300014745 | Miscanthus Rhizosphere | MANLAVKVADLDAACAYYERAGGDVRDRMHWGNGERADVYL |
| Ga0182030_117318981 | 3300014838 | Bog | VAVTGLANLAVKVEDLDAACRFYADAGADVRDRMRWRNG |
| Ga0132255_1017655691 | 3300015374 | Arabidopsis Rhizosphere | MANLAVKVADLNAACAFYAAAGAEIRDRMAWNGAE |
| Ga0187820_10607252 | 3300017924 | Freshwater Sediment | MAVTGMANLAVKVKDLDAAVAFYEAMGAQVRDRMEWNGTERADVF |
| Ga0187847_100897602 | 3300017948 | Peatland | MTVTGMANLAVKVSDLDAAVDFYQKAGAEVRDRMAWHGGERA |
| Ga0187816_104883001 | 3300017995 | Freshwater Sediment | LANLAVKVSDLDAACTFYASAGAEVRDRMEWDGGERA |
| Ga0187810_104377022 | 3300018012 | Freshwater Sediment | VTVLSLANLAVKVADLDAACAFYEAAGGVVSNRIVWHGAERADVQLG |
| Ga0187863_108162661 | 3300018034 | Peatland | MTVTGMANLAVKVSDLDAALSFYEGSGAEIRDRMPWHGGERADVYLGS |
| Ga0187773_109012281 | 3300018064 | Tropical Peatland | VAVTGMANIAVKVADLDAACAFYEAAGAEIRNRMTWNGSERADVHLG |
| Ga0187770_115820641 | 3300018090 | Tropical Peatland | VTVTGMANLAVKVADLDAACAYYEAAGAVVRDRMHWAGAERA |
| Ga0190274_126849682 | 3300018476 | Soil | MANLAVKVADLDAACAYYERAGAEIRDRMEWNGSERADVFLGPVQITL |
| Ga0163152_104741712 | 3300020213 | Freshwater Microbial Mat | VAVTGMANMAVKVADLDAACAFYSAAGAEIRDRMMWNNGERADVFL |
| Ga0213876_100171211 | 3300021384 | Plant Roots | MITGMANLAVKVDDVDRAVAWYTERGFEVRDRMTWNGIERADVFLG |
| Ga0213876_107052382 | 3300021384 | Plant Roots | VAVTGLANLAVKVADLDAACAFYEAAGADVRDRMHWNNGERADVYLG |
| Ga0207929_11028312 | 3300025505 | Arctic Peat Soil | MAITGMANLAVKVADLDAACAFYVAAGAQVRDRMVWNNGERA |
| Ga0207645_112067001 | 3300025907 | Miscanthus Rhizosphere | MAITGMANLAVKVVDLDAACAFYIAAGAEVRDRMRWNNGE |
| Ga0207693_111827992 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVTGLANLAVKVSDLDSACAFYEASGAEVRDRMTWNNGERADVYL |
| Ga0207669_107428052 | 3300025937 | Miscanthus Rhizosphere | VTVTGMANMAVKVADLDAACAFYAAAGGEVRDRMEWNNGERADVYL |
| Ga0207665_110176451 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MANLAVKVADLDAACAFYEAAGAEVRDRMHWNNGERADVFLGPVMIT |
| Ga0207712_121297711 | 3300025961 | Switchgrass Rhizosphere | VTVTGMANLAVKVADLDAACDFYRAAGGDVRDRMAWG |
| Ga0208199_10371382 | 3300027497 | Peatlands Soil | VAVTGMANLAVKVADLDAAVSFYEAAGAEVRDRMHWN |
| Ga0209060_103463141 | 3300027826 | Surface Soil | VTVTGLANLAVKVSDLSAAVAFYERAGAEVRDRMAWEGAERADV |
| Ga0209067_101607601 | 3300027898 | Watersheds | MAVTGLANLAVKVADLDAACAFYDAAGARIRDRMTWRNGERADVHLGPV |
| Ga0209698_100785311 | 3300027911 | Watersheds | MAVTALANLAVKVADLDAACAFYDAAGARIRDRMTWRNGERADVHLGPV |
| Ga0209698_113325082 | 3300027911 | Watersheds | VAVVGLANLAVKVADLDAACRYYTAGGADVRDRMVWRNGE |
| Ga0265319_12611322 | 3300028563 | Rhizosphere | MANLAVKVADLDAACAFYEAAGAEVRDRMLWNNGERADVFLG |
| Ga0302262_102798101 | 3300028743 | Fen | MAVTGMANLAVKVADLDAAVAFYERAGAEVWDRMEWNGAERADVYLGPV |
| Ga0302225_103794262 | 3300028780 | Palsa | VAVVGLANLAVKVADLDAACAFYLRAGADVRDRMG |
| Ga0265338_109926111 | 3300028800 | Rhizosphere | MANLAIKVADLDAACAFYEAAGAQVRDRMHWNNGERADVFLGPVMITLFTH |
| Ga0302154_101055363 | 3300028882 | Bog | VAVVGMANLAVKVTDLDTACAFYESAGAEVRDRMHWNNGE |
| Ga0308309_113402501 | 3300028906 | Soil | MTVTGLANLAVKVKDLDAACRFYEASGATVRDRMLWRDGERAD |
| Ga0311341_106669912 | 3300029908 | Bog | VAVTGLANLAVKVADLDAACRFYEAAGAEVRDRMEWRNGERADVFLGPVMIT |
| Ga0311359_102114201 | 3300029914 | Bog | VGVTGLANLAVKVADLDGAVAFYLAAGAEVRDRMEWAGGERADV |
| Ga0302142_10848901 | 3300029920 | Bog | VGVTGLANLAVKVADLDGAVAFYLAAGAEVRDRMEWAGGERADVYLGPVMITLF |
| Ga0311363_104168723 | 3300029922 | Fen | VSVTGLANLAVKVADLDEACRFYEEAGAEVRDRMVWGNGERADVFL |
| Ga0311332_106649692 | 3300029984 | Fen | VTITGLANLAVKVADLDAACAFYERAGGEVHDRMLWRDGERAD |
| Ga0311334_107032571 | 3300029987 | Fen | MTVTGMANLAIKVSDLDSAVAFYEHAGATISNRIMWNGSERADV |
| Ga0302190_101655271 | 3300029988 | Bog | VGVTGLANLAVKVADLDGAVAFYRGAGAEVRDRMAWAGGERADVY |
| Ga0302276_103168282 | 3300029992 | Bog | VSVTGLANLAVKVADLDSAVLFYESSGAEVRDRMVWRGGERADVYLGPVMIT |
| Ga0302283_12069961 | 3300029994 | Fen | VSVTGLANLAVKVADLDEACRFYEGAGAEVRDRMVWGNGERADVFL |
| Ga0302271_105311112 | 3300029998 | Bog | VTVTGLANLAVKVADLDEACAFYEGAGAVVSHRMAWGG |
| Ga0311338_108741401 | 3300030007 | Palsa | VPVTGLANLAVKVKDLDDACRFYEGAGATVRDRMLWRDGERADVYLG |
| Ga0302299_101682471 | 3300030010 | Fen | MTVTAVANLAVKVADLDAAISFYELAGAEVRDRLPWCGGERA |
| Ga0302299_104715132 | 3300030010 | Fen | MTVTGMANLAIKVADLDAACAFYDAMGGAVRDRMTWNGGERADVFLGP |
| Ga0311348_108497052 | 3300030019 | Fen | VTITGLANLAVKVADLDAACAFYERAGGEVHDRML |
| Ga0310039_100921953 | 3300030706 | Peatlands Soil | LAVTGIANLAVKVADLDAACAFYEEVGAQVRERMHWNNGERADVY |
| Ga0307499_101963642 | 3300031184 | Soil | VAVTGMANLAVKVVDLDAACAFYEHAGAEVRDRMHWGNG |
| Ga0265320_104801571 | 3300031240 | Rhizosphere | MGVTGMANLAVKVADLDAACAYYERAGAEVRDRMEWNGAE |
| Ga0265331_100793541 | 3300031250 | Rhizosphere | MAVTGMANMAVKVADLDAACAFYEAAGAEVRDRMLWNNGERAD |
| Ga0265316_109291021 | 3300031344 | Rhizosphere | MANLAVKVADLDAACAFYEAAGAEVRDRMHWNNGERADVFLGPVMITLFTH |
| Ga0265316_110727992 | 3300031344 | Rhizosphere | MAITGMANLAVKVADLDAACAFYVRAGAEVRDRMHWNNGERADVFLGPVM |
| Ga0307505_106461572 | 3300031455 | Soil | MTVTGLANLAVKVVDLDAALAFYEAAGAVVGDRMEWQGAERAEVRL |
| Ga0318516_104547891 | 3300031543 | Soil | MANLAVKVVDLDAACEYYERAGAEVRDRIEWNGTE |
| Ga0318515_103477082 | 3300031572 | Soil | MTVTGLANLAVKVADLDAACAFYADAGGEVRDRMVWNNGERADVRLGPVVIT |
| Ga0307372_100244451 | 3300031671 | Soil | VSVTGLANLAVKVADLDEACHFYEAAGADVRDRMVWGNG |
| Ga0318496_105862032 | 3300031713 | Soil | MTVTGLANLAVKVADLDAACAFYAAAGGEVHDRMVWNN |
| Ga0311351_108931452 | 3300031722 | Fen | MTVTGMANLAVKVADLDAAVAFYEQAGAEVRDRMEWNGAERADVYLGPVMITL |
| Ga0318502_102248461 | 3300031747 | Soil | VTVTGMANLALKVRDLDESLRYFERLGASVRDRMM |
| Ga0318494_107068191 | 3300031751 | Soil | MANLAVKVVDLDAACEYYERAGAEVRDRIEWNGTERADVLL |
| Ga0318503_102111552 | 3300031794 | Soil | MTVTGLANLAVKVADLDAACAFYAAAGGEVRDRMVWNN |
| Ga0318497_101743801 | 3300031805 | Soil | MTVTGLANLAVKVADLDAACAFYAAAGGEVRDRMVWNNG |
| Ga0318497_103688272 | 3300031805 | Soil | VTGLANLAVKVADLDRACEFYESAGAAVRDRMEWGGGERADVYLGPVMIT |
| Ga0318517_104524542 | 3300031835 | Soil | VTVTGLANLAVKVSDLDAACGFYEAAGGEIRDRIEWNGAERADVV |
| Ga0306925_105996773 | 3300031890 | Soil | VTVTGMANLALKVRDLDESLRYFERLGASVRDRMMWAGGERADVYLGPVM |
| Ga0306923_121571501 | 3300031910 | Soil | VTVTGLANLAVKVSDLDAACGFYEAAGGEIRDRIEWNGAERADVVMGPLVIT |
| Ga0315274_115968871 | 3300031999 | Sediment | VAVTGLANLAVKVADLDAACAFYTAAGAEVCDRMH |
| Ga0318558_104907541 | 3300032044 | Soil | MTVTGLANLAVKVADLDAACAFYADAGGEIHDRMVWNNGERADVRL |
| Ga0318577_102283082 | 3300032091 | Soil | MTVTGLANLAVKVADLDAACAFYAAAGGEVHDRMVWNNGERAD |
| Ga0315277_105493011 | 3300032118 | Sediment | VAVTGMANLAVKVADLDAACAFYTAAGAEVRDRMHWNNGERADVFLGPVMI |
| Ga0307415_1014231772 | 3300032126 | Rhizosphere | VAVIGMANLAVKVADLDAACRFYERAGATVRDRIEWNGGERADVL |
| Ga0315292_103998122 | 3300032143 | Sediment | MAVTGMANFAVKVADLDEACAFYAAAGGEVRDRMQWNNGERADVYLG |
| Ga0315292_113392291 | 3300032143 | Sediment | MAVTGMANLAVKVVDLDAAIAFYERAGADVRDRMEWNGGDRADVFLGPVMI |
| Ga0315295_111667601 | 3300032156 | Sediment | VAVSGLANLAVKVADLDAACAFYTAAGAEVRDRMHWN |
| Ga0311301_107009461 | 3300032160 | Peatlands Soil | VAIIGMANLAIKVRDLDRACSFYAALGAQVRDRMVWNGLERADVFLGPLM |
| Ga0311301_110105203 | 3300032160 | Peatlands Soil | VAVTGMANLAIKVVDLDESLAFYERLGASVRDRMPWAGGERADV |
| Ga0311301_123494542 | 3300032160 | Peatlands Soil | VAITGLANIAVKVADLDAACTFYSDAGAEIRDRVHWGNGERADVFLGPVMIPLFT |
| Ga0315276_102082784 | 3300032177 | Sediment | VAVTGLANLAVKVADLDAACAFYTAAGAEVRDRMHWNNGE |
| Ga0315287_103619801 | 3300032397 | Sediment | VAVTGMANLAVKVADLDAACAFYTAAGAEVRDRMHWNHGERADVFLG |
| Ga0335085_110689483 | 3300032770 | Soil | MANLAVKVADLDAACAFYERAGAEVRDRIEWNGSERADVLLGPLQ |
| Ga0335069_120281611 | 3300032893 | Soil | MAVTGLSNLAVKVADLDEACAVYRSFGGQMRDRMPWAGGERVDVFLGP |
| Ga0314862_0112681_493_636 | 3300033803 | Peatland | MTVTGLANLAVKVADLDAACAFYEDAGGVVRDRMVWHNGERADVRLGP |
| Ga0334804_030287_3_149 | 3300033818 | Soil | VTGLANLAVKVADLDEAVEFYEASGAEVRDRMRWRNGERADVYLGPVMI |
| Ga0370490_0199342_3_143 | 3300034128 | Untreated Peat Soil | MAVTGVANLAVKVPDLDPAIEFYERAGAEVRDRAPWFGGERVDVYLG |
| Ga0370501_0371940_370_519 | 3300034195 | Untreated Peat Soil | MTVTGMANLAIKVSDLDSAVAFYERAGATISNRIMWNGSERADVQLGTLA |
| ⦗Top⦘ |