


| Basic Information | |
|---|---|
| Family ID | F046519 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VTSGELAESPGGTGVSGPISESEVASDALSVVGRLNGT |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 38.26 % |
| % of genes near scaffold ends (potentially truncated) | 84.77 % |
| % of genes from short scaffolds (< 2000 bps) | 89.40 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.550 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.179 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.503 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.73% β-sheet: 0.00% Coil/Unstructured: 77.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 25.17 |
| PF08388 | GIIM | 5.30 |
| PF13181 | TPR_8 | 1.32 |
| PF01548 | DEDD_Tnp_IS110 | 0.66 |
| PF00239 | Resolvase | 0.66 |
| PF11867 | DUF3387 | 0.66 |
| PF01432 | Peptidase_M3 | 0.66 |
| PF04773 | FecR | 0.66 |
| PF02371 | Transposase_20 | 0.66 |
| PF13603 | tRNA-synt_1_2 | 0.66 |
| PF00583 | Acetyltransf_1 | 0.66 |
| PF07676 | PD40 | 0.66 |
| PF01035 | DNA_binding_1 | 0.66 |
| PF00069 | Pkinase | 0.66 |
| PF01243 | Putative_PNPOx | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.32 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.66 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.66 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.66 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.66 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.55 % |
| Unclassified | root | N/A | 32.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1013297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1323 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10134056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 601 | Open in IMG/M |
| 3300001086|JGI12709J13192_1012109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300001166|JGI12694J13545_1018780 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300001356|JGI12269J14319_10084856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1649 | Open in IMG/M |
| 3300001686|C688J18823_10031060 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
| 3300001867|JGI12627J18819_10327777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 618 | Open in IMG/M |
| 3300002023|plot21A_1016703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 503 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100250062 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100354796 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300002914|JGI25617J43924_10164354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 751 | Open in IMG/M |
| 3300002917|JGI25616J43925_10288182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 612 | Open in IMG/M |
| 3300004137|Ga0058883_1560485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 538 | Open in IMG/M |
| 3300004605|Ga0068952_1306660 | Not Available | 639 | Open in IMG/M |
| 3300004618|Ga0068963_1317117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300004633|Ga0066395_10009501 | All Organisms → cellular organisms → Bacteria | 3552 | Open in IMG/M |
| 3300004969|Ga0072327_1261494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 520 | Open in IMG/M |
| 3300005093|Ga0062594_101292717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 731 | Open in IMG/M |
| 3300005180|Ga0066685_10734304 | Not Available | 675 | Open in IMG/M |
| 3300005204|Ga0068997_10080716 | Not Available | 676 | Open in IMG/M |
| 3300005293|Ga0065715_10201304 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005327|Ga0070658_10663822 | Not Available | 905 | Open in IMG/M |
| 3300005334|Ga0068869_101405839 | Not Available | 618 | Open in IMG/M |
| 3300005435|Ga0070714_100151483 | Not Available | 2090 | Open in IMG/M |
| 3300005436|Ga0070713_100995342 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005445|Ga0070708_101001656 | Not Available | 783 | Open in IMG/M |
| 3300005454|Ga0066687_10684691 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005466|Ga0070685_10884121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 664 | Open in IMG/M |
| 3300005468|Ga0070707_101201212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 724 | Open in IMG/M |
| 3300005471|Ga0070698_100159847 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300005538|Ga0070731_10703022 | Not Available | 672 | Open in IMG/M |
| 3300005542|Ga0070732_10414882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 813 | Open in IMG/M |
| 3300005557|Ga0066704_10642664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 676 | Open in IMG/M |
| 3300005602|Ga0070762_10031852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2826 | Open in IMG/M |
| 3300005764|Ga0066903_100664337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1826 | Open in IMG/M |
| 3300005833|Ga0074472_10113728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 615 | Open in IMG/M |
| 3300005921|Ga0070766_10092620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1777 | Open in IMG/M |
| 3300006052|Ga0075029_101235060 | Not Available | 523 | Open in IMG/M |
| 3300006059|Ga0075017_100972015 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300006175|Ga0070712_100708809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 858 | Open in IMG/M |
| 3300006354|Ga0075021_11123004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia mimosarum | 515 | Open in IMG/M |
| 3300006423|Ga0075039_1336083 | Not Available | 989 | Open in IMG/M |
| 3300006796|Ga0066665_11193525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 580 | Open in IMG/M |
| 3300009012|Ga0066710_100908110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300009029|Ga0066793_10171133 | Not Available | 1266 | Open in IMG/M |
| 3300009089|Ga0099828_10068450 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
| 3300010325|Ga0134064_10154555 | Not Available | 796 | Open in IMG/M |
| 3300010366|Ga0126379_11396678 | Not Available | 806 | Open in IMG/M |
| 3300010366|Ga0126379_13717873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300010376|Ga0126381_100282418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 2265 | Open in IMG/M |
| 3300010403|Ga0134123_11363928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 747 | Open in IMG/M |
| 3300011003|Ga0138514_100060739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300011271|Ga0137393_10213480 | Not Available | 1631 | Open in IMG/M |
| 3300011271|Ga0137393_11084546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 681 | Open in IMG/M |
| 3300012096|Ga0137389_10172693 | Not Available | 1785 | Open in IMG/M |
| 3300012096|Ga0137389_11498017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1 | 570 | Open in IMG/M |
| 3300012169|Ga0153990_1030124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 1231 | Open in IMG/M |
| 3300012189|Ga0137388_10823844 | Not Available | 860 | Open in IMG/M |
| 3300012199|Ga0137383_10236171 | Not Available | 1340 | Open in IMG/M |
| 3300012363|Ga0137390_10144110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 2365 | Open in IMG/M |
| 3300012923|Ga0137359_10215060 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300012929|Ga0137404_12329807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 501 | Open in IMG/M |
| 3300012948|Ga0126375_11297509 | Not Available | 611 | Open in IMG/M |
| 3300014151|Ga0181539_1114326 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300014164|Ga0181532_10251873 | Not Available | 1014 | Open in IMG/M |
| 3300014165|Ga0181523_10253346 | Not Available | 1005 | Open in IMG/M |
| 3300014488|Ga0182001_10685373 | Not Available | 508 | Open in IMG/M |
| 3300014501|Ga0182024_10301942 | Not Available | 2116 | Open in IMG/M |
| 3300014839|Ga0182027_10147420 | Not Available | 2774 | Open in IMG/M |
| 3300015242|Ga0137412_10228151 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300016294|Ga0182041_11393119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 643 | Open in IMG/M |
| 3300016341|Ga0182035_12088124 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300016371|Ga0182034_11833235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 535 | Open in IMG/M |
| 3300016698|Ga0181503_1334698 | Not Available | 798 | Open in IMG/M |
| 3300017657|Ga0134074_1355745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300017933|Ga0187801_10008746 | All Organisms → cellular organisms → Bacteria | 3280 | Open in IMG/M |
| 3300017934|Ga0187803_10449175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300017939|Ga0187775_10494772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300017942|Ga0187808_10607829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300017966|Ga0187776_10325403 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300018057|Ga0187858_10099703 | Not Available | 1985 | Open in IMG/M |
| 3300019361|Ga0173482_10583887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 558 | Open in IMG/M |
| 3300020581|Ga0210399_10921845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 707 | Open in IMG/M |
| 3300020583|Ga0210401_11148374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300021479|Ga0210410_10735979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300021559|Ga0210409_10726216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300022523|Ga0242663_1146200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300022734|Ga0224571_113576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300023069|Ga0247751_1087002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300023255|Ga0224547_1046256 | Not Available | 565 | Open in IMG/M |
| 3300024055|Ga0247794_10321797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 524 | Open in IMG/M |
| 3300025111|Ga0208968_1101354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 874 | Open in IMG/M |
| 3300025481|Ga0208079_1070768 | Not Available | 716 | Open in IMG/M |
| 3300026536|Ga0209058_1366461 | Not Available | 500 | Open in IMG/M |
| 3300026551|Ga0209648_10718713 | Not Available | 545 | Open in IMG/M |
| 3300026920|Ga0208575_1010282 | Not Available | 895 | Open in IMG/M |
| 3300027019|Ga0207857_1060231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300027548|Ga0209523_1098617 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300027576|Ga0209003_1055192 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300027610|Ga0209528_1118570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 583 | Open in IMG/M |
| 3300027824|Ga0209040_10193669 | Not Available | 1060 | Open in IMG/M |
| 3300027855|Ga0209693_10166687 | Not Available | 1087 | Open in IMG/M |
| 3300027862|Ga0209701_10062744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2365 | Open in IMG/M |
| 3300027889|Ga0209380_10475767 | Not Available | 730 | Open in IMG/M |
| 3300027911|Ga0209698_10714154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 762 | Open in IMG/M |
| 3300029919|Ga0302141_1225341 | Not Available | 510 | Open in IMG/M |
| 3300030629|Ga0210268_1339333 | Not Available | 520 | Open in IMG/M |
| 3300030937|Ga0138302_1077566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 522 | Open in IMG/M |
| 3300031545|Ga0318541_10021506 | All Organisms → cellular organisms → Bacteria | 3094 | Open in IMG/M |
| 3300031715|Ga0307476_11017241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300031723|Ga0318493_10342935 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300031736|Ga0318501_10247001 | Not Available | 943 | Open in IMG/M |
| 3300031736|Ga0318501_10608373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300031736|Ga0318501_10823141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031747|Ga0318502_10881142 | Not Available | 544 | Open in IMG/M |
| 3300031770|Ga0318521_10148842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300031771|Ga0318546_10266690 | Not Available | 1181 | Open in IMG/M |
| 3300031771|Ga0318546_11178210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 538 | Open in IMG/M |
| 3300031777|Ga0318543_10194584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 899 | Open in IMG/M |
| 3300031779|Ga0318566_10067343 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300031796|Ga0318576_10636255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300031797|Ga0318550_10320103 | Not Available | 752 | Open in IMG/M |
| 3300031805|Ga0318497_10210978 | Not Available | 1074 | Open in IMG/M |
| 3300031845|Ga0318511_10626852 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031890|Ga0306925_10630136 | Not Available | 1129 | Open in IMG/M |
| 3300031912|Ga0306921_11423464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300031945|Ga0310913_11310524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 502 | Open in IMG/M |
| 3300031947|Ga0310909_10988310 | Not Available | 688 | Open in IMG/M |
| 3300031947|Ga0310909_11659645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300031959|Ga0318530_10038510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1753 | Open in IMG/M |
| 3300031981|Ga0318531_10563202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 516 | Open in IMG/M |
| 3300032001|Ga0306922_10808271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 980 | Open in IMG/M |
| 3300032039|Ga0318559_10565444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300032060|Ga0318505_10605077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300032076|Ga0306924_10618541 | Not Available | 1224 | Open in IMG/M |
| 3300032076|Ga0306924_12410382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 530 | Open in IMG/M |
| 3300032089|Ga0318525_10084872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 1602 | Open in IMG/M |
| 3300032090|Ga0318518_10739400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300032091|Ga0318577_10560532 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032094|Ga0318540_10158569 | Not Available | 1085 | Open in IMG/M |
| 3300032119|Ga0316051_1018534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 627 | Open in IMG/M |
| 3300032261|Ga0306920_102695717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. P-10 | 679 | Open in IMG/M |
| 3300032783|Ga0335079_10133953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2790 | Open in IMG/M |
| 3300032783|Ga0335079_10570468 | Not Available | 1197 | Open in IMG/M |
| 3300033289|Ga0310914_10752758 | Not Available | 871 | Open in IMG/M |
| 3300033289|Ga0310914_11888576 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300033887|Ga0334790_074489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 1169 | Open in IMG/M |
| 3300034124|Ga0370483_0129448 | Not Available | 842 | Open in IMG/M |
| 3300034163|Ga0370515_0191138 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.99% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.32% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.66% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.66% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Switchgrass Rhizosphere And Bulk Soil | Environmental → Terrestrial → Soil → Clay → Grasslands → Switchgrass Rhizosphere And Bulk Soil | 0.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.66% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002023 | Switchgrass rhizosphere and bulk soil microbial communities from Knoxville, Tennessee, USA - plot21A | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004969 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016698 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025111 | Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection A3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027019 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 22 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10132972 | 3300000580 | Forest Soil | MEEQCVTLGELAESPGGTGVSGPISESEVASEALSVVGRLHITYEAR* |
| AF_2010_repII_A1DRAFT_101340561 | 3300000597 | Forest Soil | IHPPYQGVGGRHGXEEQRVTSGELAGSLGGTGVSRPIRESEVASDARSVVGRLKSTKEAW |
| JGI12709J13192_10121091 | 3300001086 | Forest Soil | VTSGELAESSGGTGVNEPISRSEVGSDALSVVGRLNSTYEAW* |
| JGI12694J13545_10187802 | 3300001166 | Forest Soil | QRVTSGELAESPGGTGVSEPISASKVVSDALSVVGLPDST* |
| JGI12269J14319_100848561 | 3300001356 | Peatlands Soil | GTEEQRVTSGELTESPVGIGVSGPISASEMASDALSEVRRLNST* |
| C688J18823_100310606 | 3300001686 | Soil | VTSGGLAGSPGGTGVSGPISESEVASDALAVDGRLCSTTSAVKAA* |
| JGI12627J18819_103277771 | 3300001867 | Forest Soil | VTSGGLAESPGGTGVSRPISESEVASEAWSVVGRLNITYEA |
| plot21A_10167032 | 3300002023 | Switchgrass Rhizosphere And Bulk Soil | EEQRVTSGELTGSPGGTGVSRPISGGEVASDALSVVGPLRGT* |
| JGIcombinedJ26739_1002500622 | 3300002245 | Forest Soil | VTSGELAESPGGTGVSGPISESEVASDALSVVGRLNGTYE |
| JGIcombinedJ26739_1003547962 | 3300002245 | Forest Soil | VTSGGLAESPSGIGVSRPISESEVASEALSVDGRLCSTTSAAKAA* |
| JGI25617J43924_101643541 | 3300002914 | Grasslands Soil | EQCMTSGGLTESPGGTGVSGPISESERASDARSVVGRLNST* |
| JGI25616J43925_102881821 | 3300002917 | Grasslands Soil | VTSGELAESPGGTGVSGPISESEVASDALSVVGRLNGTYEAW* |
| Ga0058883_15604852 | 3300004137 | Forest Soil | VTSGELAESPGGTGVSGPISVSEVASDALSVVGQLKSTYEAW* |
| Ga0068952_13066601 | 3300004605 | Peatlands Soil | RVTSGGLAESLGGTGVSRPISASEMASDARSVVGLPNST* |
| Ga0068963_13171172 | 3300004618 | Peatlands Soil | VTSGELAGSAVGTGVSGPISESEKASDALSVVGRLHITYEAW* |
| Ga0066395_100095013 | 3300004633 | Tropical Forest Soil | MEERRVTSGGLAESQGGTGVNGPISENEKASDALSVDGRLRSTTHAVKAA* |
| Ga0072327_12614942 | 3300004969 | Peatlands Soil | RHGTEEQRVTSGGLTESPGGTGVSRPISDSEVASEARPVVGRLGST* |
| Ga0062594_1012927172 | 3300005093 | Soil | VTSGGLAESPGGTGVSRPISESEVASNALSVDGRLCSTTSAVKAV* |
| Ga0066685_107343042 | 3300005180 | Soil | RHGTEEQHVTSGELAESPGSTGVSRPISKSEVASHALSVVGLPNST* |
| Ga0068997_100807162 | 3300005204 | Natural And Restored Wetlands | RVTSGGLAGPSGGTGVSRPISESEAASDTPPVDGRLCSTSSAVKAA* |
| Ga0065715_102013041 | 3300005293 | Miscanthus Rhizosphere | VTSGELAESSGGTGVNEPISRGEVGSDALSVVGRLNSTYEAW* |
| Ga0070658_106638222 | 3300005327 | Corn Rhizosphere | EQRVTSGGLTGFPGGAGKSRPISESDVASDALSVDGRLSSTTSAVKAA* |
| Ga0066388_1025057091 | 3300005332 | Tropical Forest Soil | ESLGGTRVSRPISESERVQDALSVDGRLCSTRSAVKTAQPRNR* |
| Ga0068869_1014058392 | 3300005334 | Miscanthus Rhizosphere | EEQRVTSGGLAESAGGTGVSRPISASEMASDALSVDGRLCSTTSAVKAA* |
| Ga0070714_1001514831 | 3300005435 | Agricultural Soil | VTSGGLTESLGGTRVSGPISASEGASDALPVDGRLCSTTNAVKAV* |
| Ga0070713_1009953422 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSGELAESPGDTGVSEPISTSEVVSDALSVVGLLIVPEA* |
| Ga0070708_1010016561 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | HGTEEQRVTSGELAESPGGTGVSGPISGSERASDARSVVGLPNST* |
| Ga0066687_106846911 | 3300005454 | Soil | EEQRVTSGELAESPSGIGVSGPISASKMASDALSVVGLPNST* |
| Ga0070685_108841212 | 3300005466 | Switchgrass Rhizosphere | VTSGGLAESPGGTGVSGPISESEMASDVPSVDGRLCSTSSAVKAA* |
| Ga0070707_1012012122 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSGELAESPGGTGVSGPISESEVASEALSVVGRLNITYEAW* |
| Ga0070698_1001598471 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EEQRVTSGELAESPGDTGVSEPISTSEVVSDALSVVGLLIVPEA* |
| Ga0070731_107030222 | 3300005538 | Surface Soil | TSGGLAESPGGTGVSEPISESEMVSHAPSVVGLPHSI* |
| Ga0070732_104148821 | 3300005542 | Surface Soil | MEEQRATSGDLAEFPGGTGISEPISENEVASDALSGVGRLRMTYEAW* |
| Ga0066704_106426641 | 3300005557 | Soil | RHGTEEQRVTSGGLAESLVGTRVSRPISESERVSDALSVDGRLCSTRSAVKTEQPSNR* |
| Ga0070762_100318522 | 3300005602 | Soil | VTSGELAESPGGTGVSGPISESEVASDALSVVGRPNGTYEAW* |
| Ga0066903_1006643371 | 3300005764 | Tropical Forest Soil | EQCVTSGGLAESPGGTGVNGPISASEMASDAPSVVGLPHGVR* |
| Ga0074472_101137281 | 3300005833 | Sediment (Intertidal) | VTSGGLAGSPVGTGVSRPISESEVASDAPPVDGRLCSTSSAVK |
| Ga0070766_100926202 | 3300005921 | Soil | HGTEEQRVTSGELAGSPGGTGVSGPISESEVASDALSVVGRLNITYEAW* |
| Ga0075029_1012350601 | 3300006052 | Watersheds | TEEQRVTSGELAESLGDTGVSEPISKSEVVSDALSVVGLPNST* |
| Ga0075017_1009720153 | 3300006059 | Watersheds | VTSGELAESSGGTGVNEPISRSEVGSDALSVVGRLSS |
| Ga0070712_1007088093 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RHGTEEQRVTSGELAESPGGTGVSGPISVSEVASDALSVVGRLNSVC* |
| Ga0075021_111230041 | 3300006354 | Watersheds | CGWHGTEEQRVTSGELAESSSDIGVSEPINKSEVVSDALSVVGLPNST* |
| Ga0075039_13360831 | 3300006423 | Permafrost Soil | CVTSGGLAASSGGTGVSRPISEGEMASNALSVVGRLKSTRSMAKTM* |
| Ga0066665_111935251 | 3300006796 | Soil | RVTSGELAESPGGTGVNEPISRGEKASDALSVVGRLNSTYETW* |
| Ga0066710_1009081103 | 3300009012 | Grasslands Soil | GTEEQRVTSGELAESPGGTGVNEPISESEGASDARSVVGRLNST |
| Ga0066793_101711331 | 3300009029 | Prmafrost Soil | EEQRVTSGELAESSGGTGANEPISESEAASDALSVVGRLNSTYEAW* |
| Ga0099828_100684501 | 3300009089 | Vadose Zone Soil | TEEQRVTSGGLAESPGDTGVSGPISGSEMASDALSVVGLPNST* |
| Ga0134064_101545551 | 3300010325 | Grasslands Soil | QEVLTESLGGTGVSRPISESEVASEALSVYGRLNST* |
| Ga0126379_113966782 | 3300010366 | Tropical Forest Soil | GTEEQGVTSGGLAESPSGIGVSEAISVSETVSNALSVVGRLGSTASVAKVT* |
| Ga0126379_137178731 | 3300010366 | Tropical Forest Soil | MEEQHVTSGELAESPGGAGVNGPISESEVASDALSVVRRLNSTYEAR* |
| Ga0126381_1002824183 | 3300010376 | Tropical Forest Soil | VTSGGLAGSSDGIGVSELISESEVASKVLSVVGRLKSTRSLVKAK* |
| Ga0134123_113639281 | 3300010403 | Terrestrial Soil | VTSGELAESSGGTGVNEPISRGEVGSDALSVVGRLNSTY |
| Ga0138514_1000607392 | 3300011003 | Soil | VTSGELAESAGGTGESGPISESEVASDAPSVDGRL |
| Ga0137393_102134801 | 3300011271 | Vadose Zone Soil | GELAESSGGTGVNEPISRSEVGSDALSVVGRLNSTYEAW* |
| Ga0137393_110845461 | 3300011271 | Vadose Zone Soil | VTSGELAESSGGTGVNEPISRSEVGSDALSVVGRLNSTYEAW |
| Ga0137389_101726931 | 3300012096 | Vadose Zone Soil | RVTSGELAESSGGTGVNEPISRSEVGSDALSVVGRLNSTYEAW* |
| Ga0137389_114980171 | 3300012096 | Vadose Zone Soil | GTEEQRVTSGELAGSPSDTGVSEPISKSEVVSDALSVVGLPNST* |
| Ga0153990_10301241 | 3300012169 | Attine Ant Fungus Gardens | MEEQCVTSGGLTQSPEGTGVSEPISASEMVSEAASVIGRPHSTSSAVKAA |
| Ga0137388_108238441 | 3300012189 | Vadose Zone Soil | TEVQRVTSGELAKSPGGTGVSGSISGSEVASDALSVVGRLNST* |
| Ga0137383_102361711 | 3300012199 | Vadose Zone Soil | RHGTEEQRVTSGELAESPGGTGVSGPISVSEVASDALSVVGRLNST* |
| Ga0137390_101441102 | 3300012363 | Vadose Zone Soil | VTSGELAESSGGTGVNEPISRSEVGSDALSVVGRL |
| Ga0137359_102150601 | 3300012923 | Vadose Zone Soil | EQRVTSGELAESSGGTGVNEPISESEAASDALSVVGRLSSTYEAR* |
| Ga0137404_123298071 | 3300012929 | Vadose Zone Soil | VTSGELAESSGGTGVNEPISRSEVGSDALSVVGRLNS |
| Ga0126375_112975091 | 3300012948 | Tropical Forest Soil | TEEQRVTSGELAGSLDETGVSEPISESEAASDALSVDGRLRSTASMTKVV* |
| Ga0181539_11143261 | 3300014151 | Bog | RVTSGGLTESPGGTGVSEPISASEAGSDALAVVGRLNST* |
| Ga0181532_102518732 | 3300014164 | Bog | EEQRVTSGELAESSGGTGVSRPISESEVASDALSVVGRLNTTYEAW* |
| Ga0181523_102533462 | 3300014165 | Bog | VTSGELAESSGGTGVSRPISESEVASDALSVVGRLNTTYEAW* |
| Ga0182001_106853732 | 3300014488 | Soil | GELAESLGGAGLSKPISASEMVRDALSVVGPLHIT* |
| Ga0182024_103019421 | 3300014501 | Permafrost | EQRVTSGELAESPGGTGVSGPISRGEVASDALSVVGRLNST* |
| Ga0182027_101474204 | 3300014839 | Fen | WHGTEEQRVTSGELTGSLGGAGASRPISESEVASDALSVDGRLCST* |
| Ga0137412_102281511 | 3300015242 | Vadose Zone Soil | VTSGELAESSGGTGVNEPISRSEVGSDALSVVGRLNSTY |
| Ga0182041_113931191 | 3300016294 | Soil | MEEQHVTSGELAEFPGGTGVNGPISESEVASDALSVVRRLNSTYEAAHLE |
| Ga0182035_120881242 | 3300016341 | Soil | VTSGELAESPGGTGVSGPISVSEGASDALSVVGRLNSTYEM |
| Ga0182034_118332352 | 3300016371 | Soil | MEERRVTSGGLVGSPGGTGVSKPISDSEVASDALSVDGRLCSTTSAA |
| Ga0181503_13346981 | 3300016698 | Peatland | TEEQRVTSGGLAESLGGTRVSRPISESERVRDALSVDGRLCSTRSAVKTAQPRNR |
| Ga0134074_13557451 | 3300017657 | Grasslands Soil | RVTSGGLAESPGGTGVSEPISGCERVSEVLSVVGRLNST |
| Ga0187801_100087463 | 3300017933 | Freshwater Sediment | VTSGELAESPVGTGVSGPISESEVASEALPVVGRLHITYEAW |
| Ga0187803_104491751 | 3300017934 | Freshwater Sediment | RHGTEEQRVTSGELAESPGGTGVSGPISRGEVASDALSVVGRLNSTYEAW |
| Ga0187775_104947721 | 3300017939 | Tropical Peatland | VTSGELAESAGGTGVSGPISASEVASDALSVVGRLNSTYEAWRKPRD |
| Ga0187808_106078291 | 3300017942 | Freshwater Sediment | HGTEEQRVTSGGLAESPGGTGVSRPISESEVASDALSVVGRLNST |
| Ga0187776_103254032 | 3300017966 | Tropical Peatland | MEEQRVTSGELAKSADGNVVSKPISESEKASNALSVVGRLNSTLRRDESRVTG |
| Ga0187886_13281551 | 3300018018 | Peatland | ESAGGTGVSRPISESEVASDALPVDGRLCSTTSAVKAA |
| Ga0187858_100997031 | 3300018057 | Peatland | RVTSGELAESSGGTGVSRPISESEVASDALSVVGRLNITYEVW |
| Ga0173482_105838871 | 3300019361 | Soil | MEEQCVTSGGLAESPVGTGVSRPISESEMASDALS |
| Ga0210399_109218451 | 3300020581 | Soil | VTSGELAESPGGTGVSGPISESEVASDALSVVGRLNGT |
| Ga0210401_111483742 | 3300020583 | Soil | GRHGTEEQRVTSGELAESSGGTEVSKPISESEVASDALSVVGRLNITYEAW |
| Ga0210410_107359791 | 3300021479 | Soil | MEEQRVTSGGLIESSGGTGVSGPISTSEGASEARSVDG |
| Ga0210409_107262161 | 3300021559 | Soil | VTSGGLAESAGGTGVSRPISKDEVASDALSVDGRLCSTTSA |
| Ga0242663_11462002 | 3300022523 | Soil | AKSPGGTGVSGPISESEVASEALSVVGRLNSTYEAW |
| Ga0224571_1135762 | 3300022734 | Rhizosphere | EVLAESPGGTGVSKPISGSEVASEALSVYGRLNST |
| Ga0247751_10870021 | 3300023069 | Soil | VTSGGLAGSSGGTGVSRPISESEVASHALSVDGRLCSTTSAA |
| Ga0224547_10462561 | 3300023255 | Soil | GGLTESLGGTRVSEPISKREVVSDALSVVGLPNST |
| Ga0247794_103217971 | 3300024055 | Soil | MEEQCVTSGGLAESPVGTGVSRPISESEMASDALSVVGLPRSVR |
| Ga0208968_11013542 | 3300025111 | Soil | VCGRHGMEEQCVTSGGLAQSLGGTGGSEPISASEMASGATPVVGRPRGT |
| Ga0208079_10707681 | 3300025481 | Arctic Peat Soil | EQRVTSGGLVQSPGGTGESEPISESEVASDAVPVVG |
| Ga0209058_13664612 | 3300026536 | Soil | GREEQGVTSGGLAESPGGTGVSEPISGCERVSEVLSVVGRLKSTRSVVKTM |
| Ga0209648_107187131 | 3300026551 | Grasslands Soil | GELGESPGGTGVSGPISESEVASDALSVVGLPNST |
| Ga0208575_10102821 | 3300026920 | Soil | QRVTSGELAESSGGTGVSRPISESEVASDALSVVGRLNITYEAW |
| Ga0207857_10602312 | 3300027019 | Tropical Forest Soil | QYVTSGELAESPGGTGVGEPISVSEVVSDALSVVGRLLITYEAW |
| Ga0209523_10986171 | 3300027548 | Forest Soil | VTSGELSGSPGGTGVSRPISESEVASDALSVVGRLNST |
| Ga0209003_10551921 | 3300027576 | Forest Soil | VTSGELAESPDNTGVSEPISGSEVASEARSVVGLPNSTLSAAKA |
| Ga0209528_11185701 | 3300027610 | Forest Soil | VTSGELTESPGDTGVSEPISESEMASKALSVVGRLNITYEAWRKPRY |
| Ga0209040_101936692 | 3300027824 | Bog Forest Soil | TSGELAESAGGTGVSRPISESEVASDALSVVGRLNSTYEAR |
| Ga0209693_101666871 | 3300027855 | Soil | HGTEEQRVTSGELAGSPGGTGVSGPISESEVASEALSVVGRLNITYEAW |
| Ga0209701_100627444 | 3300027862 | Vadose Zone Soil | RVTSGELTESPVGIGVSGPISASERASDALSVVRRLNST |
| Ga0209380_104757671 | 3300027889 | Soil | GTEEQRVTSGELAGSPGGTGVSGPISESEVASEALSVVGRLNITYEAW |
| Ga0209698_107141541 | 3300027911 | Watersheds | EEQRVTSGELAESPGGTGVSGPISVSEVASDALSVVGRLNSARRAAR |
| Ga0302141_12253411 | 3300029919 | Bog | VTSGGLAGSPGGTGVSRPISESEGTSDALPVDGRLCNTTSAVKAA |
| Ga0210268_13393331 | 3300030629 | Soil | GWHGTEEQRVTSGELAESPGNTGVSEPISVSEVVSDALSVVGLPNGT |
| Ga0138302_10775661 | 3300030937 | Soil | MEEQCVTSGGLTESPGGTGVSRPISASERASEARSVVGRLNNWL |
| Ga0318541_100215064 | 3300031545 | Soil | VTSGELAESLGGTGVSKPISESEGASDALSVVGRLNTTYEAW |
| Ga0307476_110172412 | 3300031715 | Hardwood Forest Soil | QRVTSGELAGSPGGTGVSGPISESEVASDALSVVGRLNITYEAW |
| Ga0318493_103429351 | 3300031723 | Soil | GTEEQRVTSGELAGSPSDTGVSEPISKSEVVSDALSVVGLPNSAR |
| Ga0318501_102470011 | 3300031736 | Soil | GRHGTEEQRVTSGELAESPGGSGVSGPISVSEMASQSLSVVGQLNST |
| Ga0318501_106083731 | 3300031736 | Soil | MEEQRVTSGELAESPGGTGVSGPISESEVASDALSVVGRLNSTYKAW |
| Ga0318501_108231411 | 3300031736 | Soil | TEEQHVTSGELAESQGGTGVSKPISESEGASDALSVVGRLNTTYEAW |
| Ga0318502_108811421 | 3300031747 | Soil | MEEQCVTSGELAESPGNTGVSRPISVSEVASDARSVVGRLNSTLSMAKVM |
| Ga0318521_101488421 | 3300031770 | Soil | MEERRVTSGGLVGSPGGTGVSKPISDSEVASDALSVDGRLC |
| Ga0318546_102666902 | 3300031771 | Soil | GVCGQHGTEEQGVTSGGLAESPSGVGVSEAISESETVSNALSVVGRLGST |
| Ga0318546_111782101 | 3300031771 | Soil | VTSGELAESPGNTGVSKPISTSEMASDALSVVGQLNSTYE |
| Ga0318543_101945841 | 3300031777 | Soil | VTSGELAGSPSDTGVSEPISKSEVVSDALSVVGLPN |
| Ga0318566_100673431 | 3300031779 | Soil | GTEEQRVTSGELAESPVGIGVSGPISASEMASDALSVVRRLNST |
| Ga0318576_106362551 | 3300031796 | Soil | HGTEEQRVTSGELTGSLGGTGVSGPISRSEVASDARSAVGRLRITD |
| Ga0318550_103201032 | 3300031797 | Soil | TEEQGVTSGGLAESPSGVGVSEAISESETVSNALSVVGRLGST |
| Ga0318497_102109782 | 3300031805 | Soil | MEEQRVTSGELAESPGGTGVSGPISESEVASDALSVVGQLNST |
| Ga0318511_106268521 | 3300031845 | Soil | VTSGELAESPGGSGVSGPISASEVASNALAVVGRLNITYE |
| Ga0306925_106301361 | 3300031890 | Soil | RVTSGELAESPGGTGVSGPISVSEMASDALSVVGRLNSTYQA |
| Ga0306921_114234641 | 3300031912 | Soil | HGTEEQRVTSGGLAESPGGTGVSGPISESEVASKALSVVGQLNSTYEAW |
| Ga0310913_113105241 | 3300031945 | Soil | MEEQRVTSGELAGSPGGTGVSGPISESEVASEALSVVGRLH |
| Ga0310909_109883101 | 3300031947 | Soil | RHGTEEQRVTSGELAGSPSDTGVSEPISASEVVSDALSVVGLPNST |
| Ga0310909_116596451 | 3300031947 | Soil | SGGLAESPGGTGVSGPISESEVASKALSVVGQLNSTYEAW |
| Ga0318530_100385102 | 3300031959 | Soil | TEEQHVTSGELAESPGGTGVSRPISTSEVASDALSVVGQLNSTYEAW |
| Ga0318531_105632021 | 3300031981 | Soil | MEEQRVTSGELAGSPGDTGVSRPISASEVASDALSVDGRLSST |
| Ga0306922_108082712 | 3300032001 | Soil | MEEQHVTSGELAEFPGGTGVNGPISESEVASDALS |
| Ga0318559_105654442 | 3300032039 | Soil | MEEQRVTSGELAESPGGTGVSGPISESEVASDALSV |
| Ga0318505_106050772 | 3300032060 | Soil | MEEQRVTSGELAESPGGTGVSGPISESEVASDALSVVGRLN |
| Ga0306924_106185412 | 3300032076 | Soil | GRNVTSGELAEPLGGTGVSKPISKSEGVSDVLSVVGRLHSTDETW |
| Ga0306924_124103821 | 3300032076 | Soil | MEEQRVTSGELAGSPGGTGVSGPISESEVASEALSVVGRLHMRAEQRAV |
| Ga0318525_100848721 | 3300032089 | Soil | ELAESPGGTGVSGPISVSEGASDALSVVGRLNSAC |
| Ga0318518_107394001 | 3300032090 | Soil | TSGELAESPGGSGVSGPISASEVASNALAVVGRLNITYEAW |
| Ga0318577_105605321 | 3300032091 | Soil | MEEQCVTSGELTGSPGGAGVSGPISASEVASDALSAVGRLNSTYKVRRK |
| Ga0318540_101585692 | 3300032094 | Soil | GTEEQRVTSGELAESLVGIGVSGPISASEMASDALSVVRRLNST |
| Ga0316051_10185341 | 3300032119 | Soil | MEEQCVTSGELTESPGGTGVSRPISASEMASEARSVVGRL |
| Ga0306920_1026957171 | 3300032261 | Soil | SGELAESPGGTGVSGPISESEVASDALSVVGRLNTTDEAW |
| Ga0335079_101339534 | 3300032783 | Soil | VTSGELAESSGGTGVSEPISASEVASDALSVVGRLNSTYK |
| Ga0335079_105704681 | 3300032783 | Soil | DCGRHGTAGQRVTSGELAESPVGTGVSGPISESEVASEALSVVGRLHSTYETW |
| Ga0310914_107527582 | 3300033289 | Soil | AESPGGTGVSRPISTSEVASDALSVVGQLNSTYEAW |
| Ga0310914_118885761 | 3300033289 | Soil | MEEQCVTSGELAESPGNTGVSRPISVSEVASDARSVIGRLNSTLSMA |
| Ga0334790_074489_659_775 | 3300033887 | Soil | MTSGGLTESLGGTRVSEPISKSEVVSDALSVVGLPNST |
| Ga0370483_0129448_442_558 | 3300034124 | Untreated Peat Soil | MTSGGLAVSPGGTGVSEPISESEMASDALAVVGRLNST |
| Ga0370515_0191138_1_135 | 3300034163 | Untreated Peat Soil | TEEQRVTSGELAGSPGGSGVSKPISESERVSEALSVVGRLSSVR |
| ⦗Top⦘ |