


| Basic Information | |
|---|---|
| Family ID | F046512 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LHMFFEPAEWKGKQVPRFTRIVDPDVIAQLEAIKARMYPNP |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.65 % |
| % of genes near scaffold ends (potentially truncated) | 84.77 % |
| % of genes from short scaffolds (< 2000 bps) | 88.74 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.053 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.828 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.464 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.993 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 8.70% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 23.84 |
| PF00144 | Beta-lactamase | 13.91 |
| PF01738 | DLH | 3.31 |
| PF05598 | DUF772 | 1.99 |
| PF00486 | Trans_reg_C | 1.99 |
| PF01613 | Flavin_Reduct | 1.99 |
| PF01244 | Peptidase_M19 | 1.99 |
| PF00496 | SBP_bac_5 | 1.32 |
| PF02371 | Transposase_20 | 1.32 |
| PF07866 | DUF1653 | 1.32 |
| PF13738 | Pyr_redox_3 | 1.32 |
| PF10282 | Lactonase | 1.32 |
| PF00743 | FMO-like | 1.32 |
| PF03949 | Malic_M | 1.32 |
| PF01425 | Amidase | 1.32 |
| PF02515 | CoA_transf_3 | 1.32 |
| PF12679 | ABC2_membrane_2 | 0.66 |
| PF13414 | TPR_11 | 0.66 |
| PF05988 | DUF899 | 0.66 |
| PF02417 | Chromate_transp | 0.66 |
| PF04909 | Amidohydro_2 | 0.66 |
| PF04828 | GFA | 0.66 |
| PF08402 | TOBE_2 | 0.66 |
| PF13683 | rve_3 | 0.66 |
| PF01699 | Na_Ca_ex | 0.66 |
| PF02146 | SIR2 | 0.66 |
| PF04073 | tRNA_edit | 0.66 |
| PF01370 | Epimerase | 0.66 |
| PF00126 | HTH_1 | 0.66 |
| PF00106 | adh_short | 0.66 |
| PF06210 | DUF1003 | 0.66 |
| PF00903 | Glyoxalase | 0.66 |
| PF03050 | DDE_Tnp_IS66 | 0.66 |
| PF02646 | RmuC | 0.66 |
| PF02615 | Ldh_2 | 0.66 |
| PF14870 | PSII_BNR | 0.66 |
| PF00211 | Guanylate_cyc | 0.66 |
| PF00890 | FAD_binding_2 | 0.66 |
| PF02780 | Transketolase_C | 0.66 |
| PF04115 | Ureidogly_lyase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 23.84 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 13.91 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 13.91 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 13.91 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 1.99 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 1.99 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.32 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 1.32 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 1.32 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.32 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 1.32 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.32 |
| COG4728 | Uncharacterized conserved protein, DUF1653 family | Function unknown [S] | 1.32 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.66 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.66 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.66 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.66 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.66 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.66 |
| COG3194 | Ureidoglycolate hydrolase (allantoin degradation) | Nucleotide transport and metabolism [F] | 0.66 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.66 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.66 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.05 % |
| Unclassified | root | N/A | 7.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN01CGM9R | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 2170459019|G14TP7Y01C71EY | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 2189573001|GZR05M102GKRA0 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300002568|C688J35102_118157989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10126565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
| 3300004635|Ga0062388_102344714 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005175|Ga0066673_10024442 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300005175|Ga0066673_10596812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300005337|Ga0070682_101599880 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300005436|Ga0070713_101225029 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005437|Ga0070710_10786229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus | 679 | Open in IMG/M |
| 3300005454|Ga0066687_10477245 | Not Available | 734 | Open in IMG/M |
| 3300005458|Ga0070681_11091928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300005530|Ga0070679_101413917 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005530|Ga0070679_102056748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300005541|Ga0070733_10056004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2471 | Open in IMG/M |
| 3300005587|Ga0066654_10255513 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300005602|Ga0070762_10662418 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005610|Ga0070763_10206356 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005610|Ga0070763_10984200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300005764|Ga0066903_100877383 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005764|Ga0066903_103929447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300005885|Ga0075284_1004886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300006028|Ga0070717_11027797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
| 3300006175|Ga0070712_101472772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300006796|Ga0066665_10120090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1957 | Open in IMG/M |
| 3300006800|Ga0066660_10101106 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300006954|Ga0079219_11626062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300007004|Ga0079218_13532024 | Not Available | 531 | Open in IMG/M |
| 3300007788|Ga0099795_10561019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300009038|Ga0099829_10012707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5526 | Open in IMG/M |
| 3300009038|Ga0099829_10045192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3232 | Open in IMG/M |
| 3300009038|Ga0099829_10243630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1464 | Open in IMG/M |
| 3300009784|Ga0123357_10637262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300009792|Ga0126374_10259613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
| 3300010046|Ga0126384_11598111 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010048|Ga0126373_10174609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2063 | Open in IMG/M |
| 3300010048|Ga0126373_12641970 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010049|Ga0123356_12298390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300010325|Ga0134064_10427906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300010359|Ga0126376_10973391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300010361|Ga0126378_12296073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300010366|Ga0126379_10494438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300010376|Ga0126381_100083138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4035 | Open in IMG/M |
| 3300010376|Ga0126381_101185762 | Not Available | 1103 | Open in IMG/M |
| 3300010376|Ga0126381_102118202 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300010376|Ga0126381_102352136 | Not Available | 765 | Open in IMG/M |
| 3300010376|Ga0126381_102617509 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300011269|Ga0137392_11481917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300012096|Ga0137389_10533303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1008 | Open in IMG/M |
| 3300012202|Ga0137363_10092748 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300012202|Ga0137363_10756968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300012205|Ga0137362_11609045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300012208|Ga0137376_11241022 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012210|Ga0137378_10421398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1238 | Open in IMG/M |
| 3300012285|Ga0137370_10754257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300012469|Ga0150984_115051243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
| 3300012923|Ga0137359_10020208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5644 | Open in IMG/M |
| 3300012923|Ga0137359_10260890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1545 | Open in IMG/M |
| 3300012944|Ga0137410_11348071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300015241|Ga0137418_10262418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1460 | Open in IMG/M |
| 3300015374|Ga0132255_101688136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
| 3300016294|Ga0182041_11709678 | Not Available | 582 | Open in IMG/M |
| 3300016319|Ga0182033_11956365 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300016357|Ga0182032_10706498 | Not Available | 847 | Open in IMG/M |
| 3300016371|Ga0182034_12082622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300016387|Ga0182040_10896643 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300016404|Ga0182037_10064516 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300016404|Ga0182037_10416842 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300017943|Ga0187819_10369346 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300017970|Ga0187783_10461038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300017973|Ga0187780_10413971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300018058|Ga0187766_10484916 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300018433|Ga0066667_10822493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300018433|Ga0066667_12127298 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300020580|Ga0210403_10087118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2523 | Open in IMG/M |
| 3300020581|Ga0210399_11429288 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300020582|Ga0210395_10069923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2580 | Open in IMG/M |
| 3300020583|Ga0210401_10789736 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300021476|Ga0187846_10215862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300021478|Ga0210402_10409822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1258 | Open in IMG/M |
| 3300021560|Ga0126371_13048385 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300021560|Ga0126371_13785449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300022510|Ga0242652_1026043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300022522|Ga0242659_1066147 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300022528|Ga0242669_1139330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus | 500 | Open in IMG/M |
| 3300022532|Ga0242655_10090911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300022726|Ga0242654_10069881 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300025915|Ga0207693_11103907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300027071|Ga0209214_1032245 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027371|Ga0209418_1003735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2045 | Open in IMG/M |
| 3300027645|Ga0209117_1140280 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300027729|Ga0209248_10247571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300027738|Ga0208989_10018021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2428 | Open in IMG/M |
| 3300027869|Ga0209579_10252689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
| 3300028906|Ga0308309_10276022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1414 | Open in IMG/M |
| 3300030935|Ga0075401_11763341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300030991|Ga0073994_12274536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300031231|Ga0170824_102337234 | Not Available | 643 | Open in IMG/M |
| 3300031231|Ga0170824_117787273 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300031231|Ga0170824_125068173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300031236|Ga0302324_101657758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300031251|Ga0265327_10308179 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium | 696 | Open in IMG/M |
| 3300031446|Ga0170820_12638469 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300031446|Ga0170820_17317749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1153 | Open in IMG/M |
| 3300031469|Ga0170819_17169610 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031548|Ga0307408_101746561 | Not Available | 594 | Open in IMG/M |
| 3300031573|Ga0310915_10176125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1488 | Open in IMG/M |
| 3300031573|Ga0310915_10336506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300031573|Ga0310915_11074419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300031679|Ga0318561_10822085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300031682|Ga0318560_10177619 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031708|Ga0310686_103682249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300031719|Ga0306917_10947669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300031744|Ga0306918_10653760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300031744|Ga0306918_11288021 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031744|Ga0306918_11572916 | Not Available | 501 | Open in IMG/M |
| 3300031753|Ga0307477_10698712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300031754|Ga0307475_11416279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031765|Ga0318554_10305973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 904 | Open in IMG/M |
| 3300031782|Ga0318552_10020356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2930 | Open in IMG/M |
| 3300031782|Ga0318552_10368897 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031797|Ga0318550_10341165 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031805|Ga0318497_10300059 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300031833|Ga0310917_10867424 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031835|Ga0318517_10114820 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300031879|Ga0306919_11192078 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031890|Ga0306925_10398875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1474 | Open in IMG/M |
| 3300031893|Ga0318536_10709949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031897|Ga0318520_10085757 | Not Available | 1740 | Open in IMG/M |
| 3300031912|Ga0306921_10088920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3565 | Open in IMG/M |
| 3300031912|Ga0306921_11819833 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031912|Ga0306921_11900044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300031946|Ga0310910_10079266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2389 | Open in IMG/M |
| 3300031947|Ga0310909_10504142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1015 | Open in IMG/M |
| 3300031954|Ga0306926_12025351 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032008|Ga0318562_10307135 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300032025|Ga0318507_10089743 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300032035|Ga0310911_10097587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1608 | Open in IMG/M |
| 3300032035|Ga0310911_10483804 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032051|Ga0318532_10105262 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300032054|Ga0318570_10050548 | Not Available | 1724 | Open in IMG/M |
| 3300032054|Ga0318570_10162049 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300032055|Ga0318575_10478918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300032064|Ga0318510_10228168 | Not Available | 760 | Open in IMG/M |
| 3300032064|Ga0318510_10458763 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032205|Ga0307472_101918242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300032261|Ga0306920_100424188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1977 | Open in IMG/M |
| 3300032261|Ga0306920_103027565 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300033233|Ga0334722_11114857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300033289|Ga0310914_11851684 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.32% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.32% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.66% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.66% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.66% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_01995370 | 2170459013 | Grass Soil | MFFKPAEWKGKEVPRFTRIVDPDLIAQLEAIKSRMYPKP |
| 4MG_05150370 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | LRPLRMFFEPAKWNGKEVPRFTRILEPHVIAQLEAIKARMYPSP |
| FD2_07482150 | 2189573001 | Grass Soil | PAQWKGKEVARFTRIVNPDVIAELEAIRARMYPGP |
| C688J35102_1181579891 | 3300002568 | Soil | LHMFYEPAAWKGKKMPRFTRIIDLDVIAKLEAIKIRLYPSP* |
| JGIcombinedJ51221_101265651 | 3300003505 | Forest Soil | DLRPLHMFFEPAEWKGEKVPRFTKIVDEAVIAQLAPIKARMYPNP* |
| Ga0062388_1023447141 | 3300004635 | Bog Forest Soil | MFFEPAEWKGKMVPRFTRITDPDVIAQLRAFKACMYPAS* |
| Ga0066673_100244421 | 3300005175 | Soil | RHGGLFDLRPLNMFFQPAPVERENGAAFARIADPAVIAQLETIKARMYPSL* |
| Ga0066673_105968121 | 3300005175 | Soil | LRPLHMFFDPAEWQGKQVPRFARIVDPGVIAQLAAIKARMYPSP* |
| Ga0070682_1015998802 | 3300005337 | Corn Rhizosphere | SYAYRNGGLYDLRPLHMFYDPAALNGRQVPRFTRISDPTVIAQLAAIKARMYPEH* |
| Ga0070713_1012250291 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFEPAQWKGKEVARFTRIVDPDVIAELEAIKARMYPNP* |
| Ga0070710_107862292 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YRNGGLFDLRPLHMFFEPAEWKGKQVPRFTRIVDPDVIAQLAAIKARMYPNL* |
| Ga0066687_104772452 | 3300005454 | Soil | GLFDLRPLHMFFEPAQRQGKEVPRFTRIVDPDVIAQLGAIKSRLYPDC* |
| Ga0070681_110919282 | 3300005458 | Corn Rhizosphere | LYDLRPLHMFYDPAALNGREVPRFTRITDPGVIAQLAEIKARLYPEP* |
| Ga0070679_1014139172 | 3300005530 | Corn Rhizosphere | LFDLRPLHMFYDPAERDGRKVSRFTRITDPAAIAQLAAIKARMYPEG* |
| Ga0070679_1020567481 | 3300005530 | Corn Rhizosphere | RPLHMFFERAEWQGKMVPRFTRIVDPELIAQLAAIKARMYPNP* |
| Ga0070733_100560042 | 3300005541 | Surface Soil | MFDLRPLHMFYDPAKVKGKEVPRFTRITDPDVIAQLQVIKARMYPDL* |
| Ga0066654_102555132 | 3300005587 | Soil | FFERAEWKGQQVPRFTRIVDPDVIAQLEPIRARMYPSP* |
| Ga0070762_106624182 | 3300005602 | Soil | GAYAYRNGGLFDLRPLHMFFEPAEWKGKEAARFTRIVDPDVIAQLEAIKARMYPNP* |
| Ga0070763_102063561 | 3300005610 | Soil | EPAEWKGKEVARFTRIVDPDVIAELEAIRARMYPNP* |
| Ga0070763_109842002 | 3300005610 | Soil | LFDLRPLHMFFEPAEWKGEKVPRFTKIVDEAVIAQLAAIKARMYPNP* |
| Ga0066903_1008773831 | 3300005764 | Tropical Forest Soil | LRPLRMFFTPAKRDGKEVPRFTRIVDPDVIAELTAIKARMYPGL* |
| Ga0066903_1039294472 | 3300005764 | Tropical Forest Soil | LFDLRPLHMFFKPAEWKGKAVPRFTKIADPEVIAQLEAIKARMYPDP* |
| Ga0075284_10048861 | 3300005885 | Rice Paddy Soil | APGELNGKKVPRFTKIVDPRVIEQLAAIKSRMYPDG* |
| Ga0070717_110277971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEWKGKQVPRFTRIADPEVIAQLAAIKARLYPNS* |
| Ga0070712_1014727722 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PLHMFFDPAEWKGKQVPRFTRIADPEVIAQLEAIKARLYPNS* |
| Ga0066665_101200901 | 3300006796 | Soil | PLQMFFQPAEWKGKEVPRFTKIVNRDVILQLEAIKAQMYPNP* |
| Ga0066660_101011065 | 3300006800 | Soil | MFFEPAEWKGKRCARFTKIVDEAVIAQLAAIKVRMYPHP* |
| Ga0079219_116260622 | 3300006954 | Agricultural Soil | LHMFYEPAEWKGKQVQRFTRISNPEVIIQLEAIRARMYPKG* |
| Ga0079218_135320241 | 3300007004 | Agricultural Soil | MFYDPAELNGRKVPRFTRITDPGMIAQLAVIKARLYPDPG* |
| Ga0099795_105610192 | 3300007788 | Vadose Zone Soil | GGLFDLRPLHMFFEPAAWKGKEVPRFTRIIAPDVIAHLEAIKDRMYPLD* |
| Ga0099829_100127077 | 3300009038 | Vadose Zone Soil | YAYRNGGLFDLRPLHMFFDPAEWKGKEVPRFTRIVDPEVIAQLAAIRDRLYPIP* |
| Ga0099829_100451922 | 3300009038 | Vadose Zone Soil | MFFELAEWKGKEVPRFTKIVDHDVIAQLEAIKARMYPNP* |
| Ga0099829_102436302 | 3300009038 | Vadose Zone Soil | MFFEPAEWKGKAVPRFTRILDPAVIAQLAAIKARMYPNP* |
| Ga0123357_106372621 | 3300009784 | Termite Gut | LHMFFEPADWKGKQVPRFTRIVDPDVIARLEAIKARMYPNP* |
| Ga0126374_102596131 | 3300009792 | Tropical Forest Soil | LHMFFEQAEWKGKKVQRFTRIVDPDVITQLAAIKVRMYPHP* |
| Ga0126384_115981112 | 3300010046 | Tropical Forest Soil | YRNGGLFDLRPLHMFFKPAEWKGNKVPRFTRIIAPHVIAKLEAIKARMYPNL* |
| Ga0126373_101746092 | 3300010048 | Tropical Forest Soil | MFFEQAEWKGKKVRRFTRIVDPDVIAQLAAIKVRMYPHP* |
| Ga0126373_126419702 | 3300010048 | Tropical Forest Soil | NGGLFDLRPLHMFFKPAEWKGKMVARFTRIIAPDVIAELEAIRARMYPNL* |
| Ga0123356_122983901 | 3300010049 | Termite Gut | AEWKGKQVPRFTRIVDPDVIARLEAIKARMYPNP* |
| Ga0134064_104279061 | 3300010325 | Grasslands Soil | DLRPLHMFFQPAEWQGSKVPRFTRIIDPDVIAHLARIKARMYPSP* |
| Ga0126376_109733911 | 3300010359 | Tropical Forest Soil | TAEWQGLKVPRFTRILDPDVIEQLAAIKARMYPDP* |
| Ga0126378_122960732 | 3300010361 | Tropical Forest Soil | FDLRPLHMFFETAEWQGQRVPRFTRILDPEVIEQLAAIKARMYPDP* |
| Ga0126379_104944382 | 3300010366 | Tropical Forest Soil | MFFEQAEWKGKKVRRFTRIVDPDVITQLAAIKVRMYPHP* |
| Ga0126381_1000831382 | 3300010376 | Tropical Forest Soil | MFFEQAEWRGKKVQRFTRIVDPDVITQLAAIKVRMYPHP* |
| Ga0126381_1011857622 | 3300010376 | Tropical Forest Soil | RPLHMFFAPAERDGKDVPRFTRITDRQVIGQLAAIKRRLYPEP* |
| Ga0126381_1021182022 | 3300010376 | Tropical Forest Soil | MFFEPAERKGKKVPRFTRISDPEVIAQLEAIKARMYPDP* |
| Ga0126381_1023521361 | 3300010376 | Tropical Forest Soil | MFFEPAKWKGKEVPRFTRILEPQVIAQLEAIKARMYPALG* |
| Ga0126381_1026175091 | 3300010376 | Tropical Forest Soil | PLHMFFEPAERNGKMVPRFTRIVDPDVIARLEVIKARMYPSP* |
| Ga0137392_114819172 | 3300011269 | Vadose Zone Soil | MFDLRPLHMFYQPAKQNGKEVPRFTRITDPTVIAQLQAIRARMYPDP* |
| Ga0137389_105333031 | 3300012096 | Vadose Zone Soil | YRHGGLFDLRPLHMFFKPAEWQGKQVPRFTRIVDPDVIAQLAAIKARLYPNP* |
| Ga0137363_100927482 | 3300012202 | Vadose Zone Soil | MFFEPAEWKGKPVPRFTRIVAPDVIAQLEAIKSRMYPNP* |
| Ga0137363_107569681 | 3300012202 | Vadose Zone Soil | GGLFDLRPLHMFFAPAEWKGKTVARFTRILDPGVIAQLAAIKARMYPNP* |
| Ga0137362_116090452 | 3300012205 | Vadose Zone Soil | MFFEPAEWKGKEVPRFIRIVDPDVIAQLEATMARMCANS* |
| Ga0137376_112410222 | 3300012208 | Vadose Zone Soil | RPLHMFFEPAEWKGKEVSRFTRIVDADVIAQLEAIKARMYPNP* |
| Ga0137378_104213982 | 3300012210 | Vadose Zone Soil | FEPAEWKGKRVPRFTRIRDPGVIGQLAAIKARMYPNP* |
| Ga0137370_107542572 | 3300012285 | Vadose Zone Soil | DPADWKGKQVPRFTKIVDPDVIVQLAAIKARMYPSP* |
| Ga0150984_1150512433 | 3300012469 | Avena Fatua Rhizosphere | LHMFFEPAEWKGKQVPRFTRIVDPDVIAQLEAIKARMYPNP* |
| Ga0137359_100202082 | 3300012923 | Vadose Zone Soil | MFFEQAEWKGKEMPRFTRIVDPDVIAQLEAIRARMYANS* |
| Ga0137359_102608902 | 3300012923 | Vadose Zone Soil | MFFEPAEWKGNPVPRFTRIVAPDVIAQLEAIKSRMYPNP* |
| Ga0137410_113480712 | 3300012944 | Vadose Zone Soil | MFDLRPLHMFYEPARRSGKEVPRFTKLTNPDVIAQLKAIRARMYPDP* |
| Ga0137418_102624181 | 3300015241 | Vadose Zone Soil | FDLRPLHMFFDPAEWKDSKVPRFTRIVDPAVIIELEAIKARMYPNP* |
| Ga0132255_1016881361 | 3300015374 | Arabidopsis Rhizosphere | RNGGMFDLRPLHMFYQPAMVNGKEVQRFTKVTDPEVIAQLQAIRARMYPNP* |
| Ga0182041_117096781 | 3300016294 | Soil | AYRNGGLFDLRPLHMFYKPAEWQGKVVPRFTRIVDPDVIVELEAIRTRMYPGP |
| Ga0182033_119563652 | 3300016319 | Soil | RPLHMFFQPAEWKGKEVPRFTRIVDPDVIAQLQTIKSRMYPNP |
| Ga0182032_107064981 | 3300016357 | Soil | GGLFDLRPLHMFFNPAEWKGKMVPRFTRILDPEVIAQLAAIKARMYSDR |
| Ga0182034_120826221 | 3300016371 | Soil | RPMHMFFKPAEWKGKMVPRFTRILDPDVIAELETIKARMYPHP |
| Ga0182040_108966431 | 3300016387 | Soil | PLHMFFKPALWKGEEVQRFTKIADSDVISRLAAIKARMYPDP |
| Ga0182037_100645161 | 3300016404 | Soil | PAEWKGTTVPRFTRIVDPDVIAQLEAIKARMYPDA |
| Ga0182037_104168422 | 3300016404 | Soil | HMFFKPAERNGKTVPRFTRIVDPAVIAQLEAIKARMYPDP |
| Ga0187819_103693462 | 3300017943 | Freshwater Sediment | NGGLFDLRPLHMFFKPAHWKGKEVQRFTRIVDPDLIARLEAIKARMYPDP |
| Ga0187783_104610381 | 3300017970 | Tropical Peatland | LFDLRPLHMFFEPAERNGKKVPRFTRIVDPELIARLDAIKARMYPNP |
| Ga0187780_104139712 | 3300017973 | Tropical Peatland | FDLRPLAMFYKPALRDGKEVPRFARIADPAVIARLAAIRAQLYPEP |
| Ga0187766_104849162 | 3300018058 | Tropical Peatland | NGGLFDLRPLHMFFKPAEWQGRAVPRFTRIVDPAVIAQLAAIKARMYPDP |
| Ga0066667_108224932 | 3300018433 | Grasslands Soil | GLFDLRPQHMFFDPAEWQGKPVPRFTRIVAPGGIAQLAAIKARLYPSL |
| Ga0066667_121272981 | 3300018433 | Grasslands Soil | RPLHMFFEPAEWKGQQVPRFTRIVDPDVIAQLEPIRARMYPSP |
| Ga0210403_100871182 | 3300020580 | Soil | MFFKPAEWKGRAVPRFTRIVDPDLIAQLEAVKARMYPAP |
| Ga0210399_114292882 | 3300020581 | Soil | LHMFFEPAEWKGKEVARFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0210395_100699231 | 3300020582 | Soil | MLDYAYRNGGMFDLRPLYMFYKPAIVNGVEVLRFTKITDPEVIAQLARKIHQAT |
| Ga0210401_107897362 | 3300020583 | Soil | DLRPLHMFFKPAEWKGKEVPRFTKIVDPDVISRMAAIKAWMYPEP |
| Ga0187846_102158621 | 3300021476 | Biofilm | RPLHMFFQPAEWKGKKVSRFTRIVDPDMIAQLEAIKSRMYPNP |
| Ga0210402_104098222 | 3300021478 | Soil | MFFEPAEWKGKEVARFTRIVDPDVIAQLEAIKARLYPNP |
| Ga0126371_130483851 | 3300021560 | Tropical Forest Soil | ILSGREIPRFTRITDEGVIAQLRAIKARMYPVGFE |
| Ga0126371_137854491 | 3300021560 | Tropical Forest Soil | EPAERDGKPVPRFTRITDPGVIEQLAAIKARMYPGP |
| Ga0242652_10260432 | 3300022510 | Soil | LFDLRPLHMFFEPAEWKGKSVPRFTRIVAPDVIAQLEAIKSRMYPNP |
| Ga0242659_10661471 | 3300022522 | Soil | DLRPLNMFFEPAEWKGKMVARFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0242669_11393301 | 3300022528 | Soil | PLHMFFEPAEWKGKEVARFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0242655_100909112 | 3300022532 | Soil | PLHMFFEPAEWKGKSVPRFTRIVAPDVIAQLEAIKSRMYPNP |
| Ga0242654_100698811 | 3300022726 | Soil | YAYRNGGLFDLRPLHMFFEPAEWKGKEVARFTRIVDPDVIAQLEAIKARLYPNP |
| Ga0207693_111039073 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EPPEWKGKEVPRFARIVDPKVIAQLEAIKARMYPNA |
| Ga0209214_10322452 | 3300027071 | Forest Soil | MFFEPAEWKGEKVPRFTKIVDEAVIAQLAPIKARMYPNP |
| Ga0209418_10037353 | 3300027371 | Forest Soil | MFFQPAEWNGKEVPRFTRIVEPNVIAQLEAIKSRMYADH |
| Ga0209117_11402801 | 3300027645 | Forest Soil | RNGGMFDLRPLHMFYQPARRGGKEVQRFTRITDPDVIALLQAIRARMYPDP |
| Ga0209248_102475712 | 3300027729 | Bog Forest Soil | FEPAEWKGKEVPRFTRIVDTDVIAQLEAIKSRMYPNR |
| Ga0208989_100180214 | 3300027738 | Forest Soil | RPLHMFFEPAEWQGEKVPRFTRIVDPEVIAQLQAIKARMYPSP |
| Ga0209579_102526892 | 3300027869 | Surface Soil | LRPLYMFFQPAQWQGRQVQRFTRIVDPLVITELAAIKARLYPDR |
| Ga0308309_102760223 | 3300028906 | Soil | FEPAEWKGKEVARFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0075401_117633412 | 3300030935 | Soil | FDLRPLHMFFDPAEWKGRQVPRFTRIADPEVIAQLEAIKARLYPSS |
| Ga0073994_122745362 | 3300030991 | Soil | LFDLRPLHMFFDPAVWQGKKVPRFTRIVDPEVIAQLQAIKARMYPSP |
| Ga0170824_1023372341 | 3300031231 | Forest Soil | LHMFFQPAEWRGKEVPRFTRVIDPGVIAQLEAIKTRMYPNP |
| Ga0170824_1177872732 | 3300031231 | Forest Soil | FDLRPLDMFFKPAEWKGRAVPRFTRIVDPDLIAQLEAVKARMYAAP |
| Ga0170824_1250681731 | 3300031231 | Forest Soil | RNGGLFDLRPLHMFFDPAEWKGRQVPRFTRIADPEVIAQLEAIKSRMYPSP |
| Ga0302324_1016577582 | 3300031236 | Palsa | MFDLRPLYMFYKPAILNGIEVPRFTRITDPEVIVQLEAIKARMYPAS |
| Ga0265327_103081791 | 3300031251 | Rhizosphere | LGKLFDLRPLHMFYEPATVEGKSVSRFVKIEDPVVIAQLRIIKAQMYPEE |
| Ga0170820_126384691 | 3300031446 | Forest Soil | GLFDLRPLHMFFKLAEWKGKTVPRFTRIVDPEVIARLEAIKARMYPNP |
| Ga0170820_173177492 | 3300031446 | Forest Soil | ACFFDPAEWKGRQVPRFTRIADHEVIAQLEAIKARMYPSS |
| Ga0170819_171696102 | 3300031469 | Forest Soil | MFFEPAEWKGQQVPRFTRIVDPDVIAQLDAIKARMYPNR |
| Ga0307408_1017465611 | 3300031548 | Rhizosphere | YDLRPLHMFYDPAELNGRKVPRFTRITDPDVIARLAAIKAALYPEP |
| Ga0310915_101761251 | 3300031573 | Soil | GLYDLRPLHMFFKPAEWKEKEVPRFTRIVDPDVIAQLEAIKSRMYPNP |
| Ga0310915_103365061 | 3300031573 | Soil | DLRPLHMFFKPAEWMGKMVPRFTRILDPDVIAELEAIKVRMYTHP |
| Ga0310915_110744192 | 3300031573 | Soil | PLHMFFEPAEWKGRKVPRFTRIVDPAVIARLEAIKARMYPNP |
| Ga0318561_108220852 | 3300031679 | Soil | FFTPAEWKEKEVPRFTRIVDPDVIAQLEAIKSRMYPNP |
| Ga0318560_101776192 | 3300031682 | Soil | LQMFFKPAEWKGKKVPRFTRIAAPDVIAKLEAIKARMYPNP |
| Ga0310686_1036822493 | 3300031708 | Soil | EPAKWNGKEVPRFTKITDPELIAQLRAIRARMYPDP |
| Ga0306917_109476692 | 3300031719 | Soil | PAEWKEKKVPRFTRIVDPDVIAQLEAIKSRMYPNP |
| Ga0306918_106537602 | 3300031744 | Soil | EWKGKEVSRFTRIVDPDVIVQLEAIKARMYPNREHG |
| Ga0306918_112880211 | 3300031744 | Soil | HMFFQPAEWKGEEVPRFTRIVDPDVIAQLQTIKSRMYPNP |
| Ga0306918_115729161 | 3300031744 | Soil | RPLRMFYEPARWKGQEVRRFTRITDPGVIAQLQVIKARMYPDP |
| Ga0307477_106987121 | 3300031753 | Hardwood Forest Soil | PAEWKEKEVPRFTRIVDPDVIAQLEAIKSRMYPNP |
| Ga0307475_114162791 | 3300031754 | Hardwood Forest Soil | LFDLRPLHMFFEPAEWKGEKVPRFTKIVDEAVIAQLAPIKARMYPNP |
| Ga0318554_103059733 | 3300031765 | Soil | DLRPLPMFFQPAEWKGKEVPRFTRIVDPDVIAQLQTIKSRMYPNP |
| Ga0318552_100203564 | 3300031782 | Soil | PAEWKGKMVPRFTRILDPEVIAQLAAIKARMYSDR |
| Ga0318552_103688972 | 3300031782 | Soil | FKPAEWKGKKVPRFTRIAAPDVIAKLEAIKARMYPNP |
| Ga0318550_103411652 | 3300031797 | Soil | PLHMFFKPAEWEGKTVPRFTRIVDAEVIAQLKAIKARMYPDP |
| Ga0318497_103000592 | 3300031805 | Soil | LHMFFKPAEWHGKSVPRFTRILDPEVIAQLEAIKARMYPDL |
| Ga0310917_108674242 | 3300031833 | Soil | PLHMFFKPAEWHGKSVPRFTRILDPEVIAQLEAIKARMYPDL |
| Ga0318517_101148202 | 3300031835 | Soil | LHMFFKPAEWEGKTVPRFTRIVDAEVIAQLKAIKARMYPDP |
| Ga0306919_111920782 | 3300031879 | Soil | LHMFFKPAEWHGKSVPRFTRILDPGVIAQLEAIKARMYLDL |
| Ga0306925_103988751 | 3300031890 | Soil | LFDLRPLHMFFERAEWKGKEVSRFTRIVDPDVIVQLEAIKARMYPNREHG |
| Ga0318536_107099491 | 3300031893 | Soil | PLRMFYEPARWKGQEVRRFTRITDPGVIAQLQAIKARMYPDP |
| Ga0318520_100857573 | 3300031897 | Soil | FDLRPLHLFFEPAEWNGKLVPRFTRIVDPIVIAQLEAIKARMYPGP |
| Ga0306921_100889201 | 3300031912 | Soil | GGLFDLRPLHMFFEPAEWKGRKVPRFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0306921_118198331 | 3300031912 | Soil | LRPLHMFYKPAEWQGKVVPRFTRIVDPDVIAELEAIRTRMYPGP |
| Ga0306921_119000441 | 3300031912 | Soil | RNGGLFDLRPLHMFFESAEWKGQQVARFTRIVDPNVIAQLEAIKARMYPEP |
| Ga0310910_100792663 | 3300031946 | Soil | RNGGLFDLRPLHMFFEPAEWKGRKVPRFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0310909_105041423 | 3300031947 | Soil | WKGKEVSRFTRIVDPDVIAQLEAIKARMYPNREHG |
| Ga0306926_120253511 | 3300031954 | Soil | PLHMFFKPARWKGEEVQRFTKIADSDVISRLAAIKARMYPDP |
| Ga0318562_103071352 | 3300032008 | Soil | LRPLHMFFKPAERNGKTVPRFTRIVDPAVIAQLEAIKARMYPDP |
| Ga0318507_100897431 | 3300032025 | Soil | LFDLRPLQMFFKPAEWKGKKVPRFTRIAAPDVIAKLEAIKARMYPNP |
| Ga0310911_100975873 | 3300032035 | Soil | LFDLRPLHMFFEPAEWKGRKVPRFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0310911_104838042 | 3300032035 | Soil | LRPLHMFFKPAEWNGKTVPRFTRIVDPDVIAQLEAIKARMYPDP |
| Ga0318532_101052621 | 3300032051 | Soil | HMFFEPAEWKGRKVPRFTRIVDPDVIAQLEAIKARMYPNP |
| Ga0318570_100505481 | 3300032054 | Soil | PLHLFFEPAEWNGKLVPRFTRIVDPIVIAQLEAIKARMYPGP |
| Ga0318570_101620491 | 3300032054 | Soil | GLFDLRPLQMFFKPAEWKGKKVPRFTRIAAPDVIAKLEAIKARMYPNP |
| Ga0318575_104789182 | 3300032055 | Soil | DLRPLHMFFEPARWKGKEVQRFTRIVDPDVIAQLEGIKARMYPTL |
| Ga0318510_102281682 | 3300032064 | Soil | HMFYKPAEWQGKVVPRFTRIVDPDVIVELEAIRTRMYPGP |
| Ga0318510_104587632 | 3300032064 | Soil | YAYRNGGLFDLRPLHMFFKPAEWKGRVVPRFTRIVDPDVITQLEAIRARMYPNP |
| Ga0307472_1019182421 | 3300032205 | Hardwood Forest Soil | FFEQAEWRGKKVPRFTKIVDPDVIAQLEAIKARMYPNP |
| Ga0306920_1004241883 | 3300032261 | Soil | AYAYRNGGLFDLRPLHMFFERAEWKGKEVSRFTRIVDPDVIVQLEAIKARMYPNREHG |
| Ga0306920_1030275651 | 3300032261 | Soil | LRPLHMFFKPAEWHGKSVPRFTRILDPEVIAQLEAIKARMYPDL |
| Ga0334722_111148572 | 3300033233 | Sediment | GMFDLRPLHMFYEPAKWKGKEVQRFTKITAPAVIAQLQAIRARMYPNT |
| Ga0310914_118516841 | 3300033289 | Soil | LFDLRPLHMFFEPAEWQGKRVPRFTRIVDLDLIAQLQAIKAQMYPNL |
| ⦗Top⦘ |