


| Basic Information | |
|---|---|
| Family ID | F046476 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 151 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.32 % |
| % of genes near scaffold ends (potentially truncated) | 97.35 % |
| % of genes from short scaffolds (< 2000 bps) | 92.05 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.185 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.556 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.854 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.411 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 35.76 |
| PF00815 | Histidinol_dh | 7.28 |
| PF04392 | ABC_sub_bind | 3.97 |
| PF13924 | Lipocalin_5 | 3.97 |
| PF00106 | adh_short | 2.65 |
| PF00890 | FAD_binding_2 | 2.65 |
| PF03976 | PPK2 | 1.99 |
| PF00378 | ECH_1 | 1.99 |
| PF13193 | AMP-binding_C | 1.99 |
| PF04199 | Cyclase | 0.66 |
| PF03060 | NMO | 0.66 |
| PF09084 | NMT1 | 0.66 |
| PF13545 | HTH_Crp_2 | 0.66 |
| PF12706 | Lactamase_B_2 | 0.66 |
| PF08031 | BBE | 0.66 |
| PF14534 | DUF4440 | 0.66 |
| PF00484 | Pro_CA | 0.66 |
| PF02518 | HATPase_c | 0.66 |
| PF03972 | MmgE_PrpD | 0.66 |
| PF12697 | Abhydrolase_6 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 7.28 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.97 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.99 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.66 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.66 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.66 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.66 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.66 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.66 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.66 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.19 % |
| Unclassified | root | N/A | 27.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01B3QAH | Not Available | 518 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10067967 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300000720|JGI12456J11933_104476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10135138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300001989|JGI24739J22299_10226219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 548 | Open in IMG/M |
| 3300004058|Ga0055498_10010350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1209 | Open in IMG/M |
| 3300005330|Ga0070690_100366209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1050 | Open in IMG/M |
| 3300005332|Ga0066388_100613797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1708 | Open in IMG/M |
| 3300005332|Ga0066388_105278193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300005356|Ga0070674_100241096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1415 | Open in IMG/M |
| 3300005363|Ga0008090_15074949 | Not Available | 534 | Open in IMG/M |
| 3300005524|Ga0070737_10059734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1986 | Open in IMG/M |
| 3300005548|Ga0070665_100504815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1221 | Open in IMG/M |
| 3300005563|Ga0068855_101513823 | Not Available | 689 | Open in IMG/M |
| 3300005577|Ga0068857_102424177 | Not Available | 515 | Open in IMG/M |
| 3300005616|Ga0068852_102417253 | Not Available | 546 | Open in IMG/M |
| 3300005713|Ga0066905_101285658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300005713|Ga0066905_101774475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300005713|Ga0066905_102108510 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005764|Ga0066903_100615288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1887 | Open in IMG/M |
| 3300005764|Ga0066903_104932664 | Not Available | 708 | Open in IMG/M |
| 3300005764|Ga0066903_108689643 | Not Available | 516 | Open in IMG/M |
| 3300005938|Ga0066795_10140061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005995|Ga0066790_10173714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300006178|Ga0075367_10294156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1022 | Open in IMG/M |
| 3300006904|Ga0075424_100184648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2213 | Open in IMG/M |
| 3300009089|Ga0099828_10435431 | Not Available | 1182 | Open in IMG/M |
| 3300009089|Ga0099828_12003051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300009098|Ga0105245_10188854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1972 | Open in IMG/M |
| 3300009167|Ga0113563_13995181 | Not Available | 500 | Open in IMG/M |
| 3300009551|Ga0105238_11555832 | Not Available | 691 | Open in IMG/M |
| 3300009764|Ga0116134_1304809 | Not Available | 547 | Open in IMG/M |
| 3300009826|Ga0123355_10764089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300010043|Ga0126380_10164869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1439 | Open in IMG/M |
| 3300010043|Ga0126380_11237842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300010046|Ga0126384_11942862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 562 | Open in IMG/M |
| 3300010049|Ga0123356_11719357 | Not Available | 779 | Open in IMG/M |
| 3300010360|Ga0126372_11313183 | Not Available | 753 | Open in IMG/M |
| 3300010360|Ga0126372_11809282 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300010361|Ga0126378_12800392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300010362|Ga0126377_11741881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300010366|Ga0126379_12373898 | Not Available | 630 | Open in IMG/M |
| 3300010371|Ga0134125_11914989 | Not Available | 645 | Open in IMG/M |
| 3300010397|Ga0134124_10010936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7319 | Open in IMG/M |
| 3300010403|Ga0134123_10654237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300012189|Ga0137388_10567691 | Not Available | 1055 | Open in IMG/M |
| 3300012203|Ga0137399_11125044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300012208|Ga0137376_11053540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300012351|Ga0137386_10985866 | Not Available | 600 | Open in IMG/M |
| 3300012357|Ga0137384_10440334 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300012474|Ga0157356_1018200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 555 | Open in IMG/M |
| 3300012507|Ga0157342_1047307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 595 | Open in IMG/M |
| 3300012925|Ga0137419_11059016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300012958|Ga0164299_10030170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2347 | Open in IMG/M |
| 3300012960|Ga0164301_10627578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300012984|Ga0164309_10309826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300012984|Ga0164309_11707892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300012986|Ga0164304_10041871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2434 | Open in IMG/M |
| 3300013308|Ga0157375_12268768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 647 | Open in IMG/M |
| 3300013766|Ga0120181_1130480 | Not Available | 548 | Open in IMG/M |
| 3300014267|Ga0075313_1111302 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300014326|Ga0157380_10334181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1410 | Open in IMG/M |
| 3300014838|Ga0182030_10718975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300014969|Ga0157376_11628611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300015200|Ga0173480_10971670 | Not Available | 557 | Open in IMG/M |
| 3300015371|Ga0132258_13103308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1148 | Open in IMG/M |
| 3300015373|Ga0132257_100347542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1792 | Open in IMG/M |
| 3300016270|Ga0182036_10284176 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300016319|Ga0182033_10166034 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| 3300016341|Ga0182035_10782180 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300016357|Ga0182032_10443914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
| 3300017936|Ga0187821_10285871 | Not Available | 652 | Open in IMG/M |
| 3300017972|Ga0187781_11434199 | Not Available | 511 | Open in IMG/M |
| 3300017974|Ga0187777_11175022 | Not Available | 560 | Open in IMG/M |
| 3300018060|Ga0187765_10778003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300018086|Ga0187769_10556955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 866 | Open in IMG/M |
| 3300018086|Ga0187769_10798406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300019356|Ga0173481_10335558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300021090|Ga0210377_10370530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 858 | Open in IMG/M |
| 3300021439|Ga0213879_10147024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300025271|Ga0207666_1031545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 813 | Open in IMG/M |
| 3300025312|Ga0209321_10471209 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 573 | Open in IMG/M |
| 3300025580|Ga0210138_1012114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1712 | Open in IMG/M |
| 3300025615|Ga0210086_1195114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300025650|Ga0209385_1157720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300025813|Ga0210064_1009480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2914 | Open in IMG/M |
| 3300025914|Ga0207671_10573071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300025916|Ga0207663_11138122 | Not Available | 628 | Open in IMG/M |
| 3300025918|Ga0207662_11062779 | Not Available | 575 | Open in IMG/M |
| 3300025931|Ga0207644_10229856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1473 | Open in IMG/M |
| 3300025936|Ga0207670_10136058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1806 | Open in IMG/M |
| 3300025936|Ga0207670_11347876 | Not Available | 605 | Open in IMG/M |
| 3300026095|Ga0207676_11158450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
| 3300026492|Ga0256802_1005348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1296 | Open in IMG/M |
| 3300026806|Ga0207546_100410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1068 | Open in IMG/M |
| 3300026865|Ga0207746_1013776 | Not Available | 692 | Open in IMG/M |
| 3300026879|Ga0207763_1001830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2626 | Open in IMG/M |
| 3300027014|Ga0207815_1000641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5371 | Open in IMG/M |
| 3300027330|Ga0207777_1037757 | Not Available | 874 | Open in IMG/M |
| 3300027643|Ga0209076_1038055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300027665|Ga0209983_1008861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2055 | Open in IMG/M |
| 3300027765|Ga0209073_10246299 | Not Available | 693 | Open in IMG/M |
| 3300027903|Ga0209488_10242896 | Not Available | 1351 | Open in IMG/M |
| 3300028802|Ga0307503_10599307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300029917|Ga0311326_10240696 | Not Available | 935 | Open in IMG/M |
| 3300029987|Ga0311334_11566750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300031226|Ga0307497_10115196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1069 | Open in IMG/M |
| 3300031549|Ga0318571_10104529 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300031595|Ga0265313_10035629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2504 | Open in IMG/M |
| 3300031668|Ga0318542_10405446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300031679|Ga0318561_10517126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300031711|Ga0265314_10549743 | Not Available | 601 | Open in IMG/M |
| 3300031716|Ga0310813_11562575 | Not Available | 615 | Open in IMG/M |
| 3300031720|Ga0307469_10896542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300031724|Ga0318500_10103010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1301 | Open in IMG/M |
| 3300031740|Ga0307468_100413514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1035 | Open in IMG/M |
| 3300031747|Ga0318502_10475220 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031763|Ga0318537_10026675 | Not Available | 2038 | Open in IMG/M |
| 3300031768|Ga0318509_10036839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2427 | Open in IMG/M |
| 3300031768|Ga0318509_10684735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300031770|Ga0318521_10396035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 822 | Open in IMG/M |
| 3300031770|Ga0318521_10673053 | Not Available | 628 | Open in IMG/M |
| 3300031777|Ga0318543_10281186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 743 | Open in IMG/M |
| 3300031778|Ga0318498_10368301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300031781|Ga0318547_10419814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300031782|Ga0318552_10714254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031796|Ga0318576_10473824 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031797|Ga0318550_10533649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031819|Ga0318568_10263770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1067 | Open in IMG/M |
| 3300031821|Ga0318567_10068926 | Not Available | 1865 | Open in IMG/M |
| 3300031908|Ga0310900_11327612 | Not Available | 602 | Open in IMG/M |
| 3300031912|Ga0306921_12615173 | Not Available | 521 | Open in IMG/M |
| 3300031913|Ga0310891_10114394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300032001|Ga0306922_11913102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300032035|Ga0310911_10057975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2035 | Open in IMG/M |
| 3300032039|Ga0318559_10517555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300032041|Ga0318549_10393657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300032043|Ga0318556_10676981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300032052|Ga0318506_10079634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1373 | Open in IMG/M |
| 3300032055|Ga0318575_10371772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium brasilense | 725 | Open in IMG/M |
| 3300032061|Ga0315540_10405190 | Not Available | 546 | Open in IMG/M |
| 3300032205|Ga0307472_101419458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300032261|Ga0306920_102439243 | Not Available | 721 | Open in IMG/M |
| 3300032261|Ga0306920_104337673 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300032421|Ga0310812_10507761 | Not Available | 542 | Open in IMG/M |
| 3300032770|Ga0335085_10691951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1135 | Open in IMG/M |
| 3300032895|Ga0335074_11631257 | Not Available | 502 | Open in IMG/M |
| 3300033134|Ga0335073_10911043 | Not Available | 924 | Open in IMG/M |
| 3300033290|Ga0318519_10216582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1097 | Open in IMG/M |
| 3300033433|Ga0326726_10964698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
| 3300033513|Ga0316628_101857157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Craurococcus → environmental samples → uncultured Craurococcus sp. | 801 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.30% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.31% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.32% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.32% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.32% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.66% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.66% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.66% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.66% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.66% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.66% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000720 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025615 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025813 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026492 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5 | Environmental | Open in IMG/M |
| 3300026806 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_03165490 | 2170459024 | Grass Soil | AEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVHQEYFADLPPLK |
| AF_2010_repII_A1DRAFT_100679673 | 3300000597 | Forest Soil | LINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK* |
| JGI12456J11933_1044761 | 3300000720 | Tropical Forest Soil | VNTLPGAARLNVPKLFRPEFMEAVMKEHPEYFADLPKL* |
| AF_2010_repII_A001DRAFT_101351381 | 3300000793 | Forest Soil | AFESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK* |
| JGI24739J22299_102262192 | 3300001989 | Corn Rhizosphere | MNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK* |
| Ga0055498_100103503 | 3300004058 | Natural And Restored Wetlands | EDEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFVDLPALK* |
| Ga0070690_1003662093 | 3300005330 | Switchgrass Rhizosphere | FENAEDEVLTNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL* |
| Ga0066388_1006137971 | 3300005332 | Tropical Forest Soil | EVLINTLKGAPRLNVPDQFSPAFMAEVEKVHPEYFADLPPVK* |
| Ga0066388_1052781931 | 3300005332 | Tropical Forest Soil | FEAAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVHREYFADLPPLK* |
| Ga0070674_1002410961 | 3300005356 | Miscanthus Rhizosphere | ENAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK* |
| Ga0008090_150749492 | 3300005363 | Tropical Rainforest Soil | VLANTLKGAPRLDVPSLFRPEFMAAVEKEHPEYFADLPKL* |
| Ga0070737_100597341 | 3300005524 | Surface Soil | NAEDEVLMNTLKGAARLDVPSLFRPQFMQEVEREHPEYFADLPKL* |
| Ga0070665_1005048151 | 3300005548 | Switchgrass Rhizosphere | TLKGASRLNVPSLFRPEFMQRVEKEHSEYFADLPKLK* |
| Ga0068855_1015138231 | 3300005563 | Corn Rhizosphere | EVLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL* |
| Ga0068857_1024241772 | 3300005577 | Corn Rhizosphere | KGASRLNVPSLFRPEFMQRVEKEHPEYFADLPKLK* |
| Ga0068852_1024172531 | 3300005616 | Corn Rhizosphere | NAEDEVLTNTLKGASRLNVPSLFRPEFMQRVEKEHSEYFADLPKLK* |
| Ga0066905_1012856582 | 3300005713 | Tropical Forest Soil | LANTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL* |
| Ga0066905_1017744751 | 3300005713 | Tropical Forest Soil | VAEDEVLINTLKGAPRLDVPDQFRPAFMAEVEKAHPEYFADLPPLK* |
| Ga0066905_1021085102 | 3300005713 | Tropical Forest Soil | GAPRLNVPDQFSPAFMAEVEKLYPEYFADLPPLK* |
| Ga0066903_1006152883 | 3300005764 | Tropical Forest Soil | LINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFGDLPPLK* |
| Ga0066903_1049326641 | 3300005764 | Tropical Forest Soil | MRAFEAAEDEVLINTLKGAPRLNVPDQFSPAKVYPEYFADLPPLK* |
| Ga0066903_1086896432 | 3300005764 | Tropical Forest Soil | GASRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK* |
| Ga0066795_101400611 | 3300005938 | Soil | GAARLDVPSLFRPKFMAEVEKEHPEYFADLPKLK* |
| Ga0066790_101737142 | 3300005995 | Soil | VLMNTLKGAARLDVPSLFRPKFMAEVEKEHPEYFADLPKLT* |
| Ga0075367_102941563 | 3300006178 | Populus Endosphere | NAEDEVLTNTLKGASRLNVPSLFRPEFMQRVEKEHPEYFADLPKLK* |
| Ga0075424_1001846481 | 3300006904 | Populus Rhizosphere | MNTLKGAPRLDVPSLFRPQFMAEVQQEHPEYFADLPQLK* |
| Ga0099828_104354312 | 3300009089 | Vadose Zone Soil | PRLDVPDQFRPSFMAEVEKAHPEYFADLPPLNLPPLK* |
| Ga0099828_120030512 | 3300009089 | Vadose Zone Soil | EVLINTLKGATRLDVPDQFHPSFMAEVEKAHPEYFADLPPLT* |
| Ga0105245_101888543 | 3300009098 | Miscanthus Rhizosphere | LMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLT* |
| Ga0113563_139951812 | 3300009167 | Freshwater Wetlands | DEVLMNTLKGAPRLDVPSLFRPKFMAEVEKEHPEYFADLPPLK* |
| Ga0105238_115558321 | 3300009551 | Corn Rhizosphere | TLKGAPRLDVPKLFRPEFMQQVEKEYPDYFADLPKL* |
| Ga0116134_13048092 | 3300009764 | Peatland | VLMNTLKGAPRLDVPSLFRPQFMAEVEKEHPEYFADLPKLT* |
| Ga0123355_107640891 | 3300009826 | Termite Gut | TLKGAARLDVPSLFQRKFMAAVEQEHPEYFSDLPPLPSS* |
| Ga0126380_101648692 | 3300010043 | Tropical Forest Soil | FESAEDEVLINTLKGAPRLDVPDQFRPSFMAEMEKAHPEYFADLPPLK* |
| Ga0126380_112378421 | 3300010043 | Tropical Forest Soil | AFEAAEDEVLINTLKGAPRLDVPDQFRPSFMTEVEKAHPEYFADLPPLK* |
| Ga0126384_119428621 | 3300010046 | Tropical Forest Soil | AAEDEVLLNTLRGAPRLDVPDQFRPSFMTEVEKTHPEYFADLPPLTS* |
| Ga0123356_117193572 | 3300010049 | Termite Gut | NTLKGAARLDVPSLFRPQFMAEVEKEHPEYFADLPPL* |
| Ga0126372_113131831 | 3300010360 | Tropical Forest Soil | EAAEDEVLINTLKGAPRLDVPDQFRPSFMTEVEKAHPEYFADLPPLK* |
| Ga0126372_118092821 | 3300010360 | Tropical Forest Soil | TLKGAPRLNVPDQFSPAFMAEVEKVHPEYFADLPPLK* |
| Ga0126378_128003922 | 3300010361 | Tropical Forest Soil | LINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK* |
| Ga0126377_117418811 | 3300010362 | Tropical Forest Soil | TLKGAPRLDVPDQFCPTFMAEVEQAHPEYFADLLRLK* |
| Ga0126379_123738982 | 3300010366 | Tropical Forest Soil | EAAEDEVLMNTLKGAPRLDVPDQFRPSFMTEIAKAHPEYFADLPPLK* |
| Ga0134125_119149891 | 3300010371 | Terrestrial Soil | NTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL* |
| Ga0134124_100109367 | 3300010397 | Terrestrial Soil | VLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK* |
| Ga0134123_106542371 | 3300010403 | Terrestrial Soil | KGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK* |
| Ga0137388_105676912 | 3300012189 | Vadose Zone Soil | EVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLNLPPLK* |
| Ga0137399_111250442 | 3300012203 | Vadose Zone Soil | INTLKGAPRLDVPDQFRPAFIAEVEKAHPEYFADLPPLT* |
| Ga0137376_110535402 | 3300012208 | Vadose Zone Soil | LTNTLKGAPRLDVPSLFRPQFMAEVEKEHSEYFADLPKL* |
| Ga0137386_109858661 | 3300012351 | Vadose Zone Soil | FEAAEDEVLINTLKGAPRLDVPGQFRPSFMAEVEKAHPEYFADLPALT* |
| Ga0137384_104403341 | 3300012357 | Vadose Zone Soil | AFEAAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPALT* |
| Ga0157356_10182001 | 3300012474 | Unplanted Soil | NTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK* |
| Ga0157342_10473071 | 3300012507 | Arabidopsis Rhizosphere | EILMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK* |
| Ga0137419_110590162 | 3300012925 | Vadose Zone Soil | LINTLKGAPRLDVPDQFRPAFIAEVEKAHPEYFADLPPLT* |
| Ga0164299_100301701 | 3300012958 | Soil | AEDEVLANTLKGAPRLDVPSLFRPQFMAAVEKEHPESFADLPKL* |
| Ga0164301_106275781 | 3300012960 | Soil | NAEDEVLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL* |
| Ga0164309_103098261 | 3300012984 | Soil | NTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLT* |
| Ga0164309_117078921 | 3300012984 | Soil | EVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFSDLPALK* |
| Ga0164304_100418711 | 3300012986 | Soil | LKGAPRLNVPSLFRPEFMQQVEKEHPEYFADLPKLA* |
| Ga0157375_122687682 | 3300013308 | Miscanthus Rhizosphere | TNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFSDLPKL* |
| Ga0120181_11304802 | 3300013766 | Permafrost | VQPISAAGAPRLDVPNLFRPEFMQQVEKEHPEYFADLPKL* |
| Ga0075313_11113022 | 3300014267 | Natural And Restored Wetlands | VLMNTLPGAARLDIPNLFRPTFMAEVEKEHPEYFADLPPLK* |
| Ga0157380_103341813 | 3300014326 | Switchgrass Rhizosphere | ENAEDEILVNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK* |
| Ga0182030_107189752 | 3300014838 | Bog | FENAEDEVLMNTLKGAPRLDVPSLFRPEFMQQVEKEHPEYFADLPKL* |
| Ga0157376_116286112 | 3300014969 | Miscanthus Rhizosphere | EDEVLNNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFSDLPKL* |
| Ga0173480_109716702 | 3300015200 | Soil | AEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK* |
| Ga0132258_131033083 | 3300015371 | Arabidopsis Rhizosphere | ENAEDEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK* |
| Ga0132257_1003475421 | 3300015373 | Arabidopsis Rhizosphere | TLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK* |
| Ga0182036_102841762 | 3300016270 | Soil | LINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK |
| Ga0182033_101660341 | 3300016319 | Soil | ESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAYPEYFADLPLLK |
| Ga0182035_107821801 | 3300016341 | Soil | EDEVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK |
| Ga0182032_104439141 | 3300016357 | Soil | EDEVLINTLKGAPRLAVPDQFRPSFMAEVEKAHPEYFADLPPLK |
| Ga0187821_102858712 | 3300017936 | Freshwater Sediment | LPGAPRLNVPKLFRPEFMQQVEKENPEYFADLPKLS |
| Ga0187781_114341991 | 3300017972 | Tropical Peatland | KGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPPLK |
| Ga0187777_111750222 | 3300017974 | Tropical Peatland | LKGAPRLDVPSLFRPKFMAEVEKEHPEYFADLPKL |
| Ga0187765_107780031 | 3300018060 | Tropical Peatland | VLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK |
| Ga0187769_105569551 | 3300018086 | Tropical Peatland | TLKGAARLDVPDQFRPSFMAEVEKAHPEYFADLPPLP |
| Ga0187769_107984061 | 3300018086 | Tropical Peatland | LKGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPPLK |
| Ga0173481_103355582 | 3300019356 | Soil | AEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK |
| Ga0210377_103705302 | 3300021090 | Groundwater Sediment | MNTLKGAPRLDVPSLFRPQFMTEVQKEHPEYFADLPKL |
| Ga0213879_101470241 | 3300021439 | Bulk Soil | VLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK |
| Ga0207666_10315452 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | AEDEILVNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK |
| Ga0209321_104712091 | 3300025312 | Soil | EAAEDELLINTLPGAPRLVVPDLFAPGFMAEVEKAHPEYFRDLPPLK |
| Ga0210138_10121143 | 3300025580 | Natural And Restored Wetlands | VLVNTLPGAARLNVPKLFRPDFMEAVMKEHPEYFADLPRLK |
| Ga0210086_11951141 | 3300025615 | Natural And Restored Wetlands | VLINTLPGAPRLDVPSLFRPQFMAEVEQEHPEYFADLPKLP |
| Ga0209385_11577202 | 3300025650 | Arctic Peat Soil | MNTLKGAARLDVPSLFRPKFMAEVEKEHPEYFADLPKLT |
| Ga0210064_10094801 | 3300025813 | Natural And Restored Wetlands | ANTLKGAPRLDVPSLFRPEFMTEVQKEHPDYFADLPPLKQ |
| Ga0207671_105730711 | 3300025914 | Corn Rhizosphere | EDEVLTNTLKGAPRLNVPSLFRPDFMQQVEKEHPEYFADLPRLK |
| Ga0207663_111381222 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL |
| Ga0207662_110627791 | 3300025918 | Switchgrass Rhizosphere | ENAEDEVLTNTLKGASRLNVPSLFRPEFMQRVEKEHPEYFADLPKLK |
| Ga0207644_102298563 | 3300025931 | Switchgrass Rhizosphere | AARLRERGDEVLMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLT |
| Ga0207670_101360583 | 3300025936 | Switchgrass Rhizosphere | ENAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK |
| Ga0207670_113478761 | 3300025936 | Switchgrass Rhizosphere | EDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK |
| Ga0207676_111584501 | 3300026095 | Switchgrass Rhizosphere | TLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL |
| Ga0256802_10053483 | 3300026492 | Sediment | ENAEDEVLMNTLKGALRLDVPSLFRPQFMAEVQKEHPEYFVDLPALK |
| Ga0207546_1004103 | 3300026806 | Soil | KGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK |
| Ga0207746_10137761 | 3300026865 | Tropical Forest Soil | LPGAPRLDVPNLFRPQFMTDVQKEHPEYFADLPSLK |
| Ga0207763_10018301 | 3300026879 | Tropical Forest Soil | FENAEDEVLVNTLPGAARLNVPKLFRPEFMEAVMKEHPEYFADLPKL |
| Ga0207815_10006416 | 3300027014 | Tropical Forest Soil | LINTLPGAPRLDVPNLFRPQFMTDVQKEHPEYFADLPSLK |
| Ga0207777_10377571 | 3300027330 | Tropical Forest Soil | PGAPRLDVPNLFRPQFMTDVQKEHPEYFADLPSLK |
| Ga0209076_10380551 | 3300027643 | Vadose Zone Soil | EVLINTLKGAPRLDVPDQFRPAFIAEVEKAHPEYFADLPPLT |
| Ga0209983_10088611 | 3300027665 | Arabidopsis Thaliana Rhizosphere | KGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK |
| Ga0209073_102462991 | 3300027765 | Agricultural Soil | EDEVLTNTLKGAPRLNVPSLFRPEFMQQVEKQHPEYFADLPALK |
| Ga0209488_102428962 | 3300027903 | Vadose Zone Soil | APRLDVPDQFRPSFMAEVEKAHPEYFADLPPLNLPPLK |
| Ga0307503_105993071 | 3300028802 | Soil | MNTLKGAPRLDVPSLFRPEFMAEVQKEHPEYFADLPKL |
| Ga0311326_102406961 | 3300029917 | Bog | EVLMNTLKGAARLDVPSLFRPQFMTEVQIEHPEYFADLPKLA |
| Ga0311334_115667501 | 3300029987 | Fen | LKGAPRLDVPSLFRPKFMAEVEKGHPEYFADLPKL |
| Ga0307497_101151961 | 3300031226 | Soil | MNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLV |
| Ga0318571_101045291 | 3300031549 | Soil | LKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK |
| Ga0265313_100356293 | 3300031595 | Rhizosphere | VNTLPGAPRLNVPKLFRPEFMQQVEKEHPEYFADLPKLT |
| Ga0318542_104054463 | 3300031668 | Soil | NTLKGAPRLAVPDQFRPSFMAEVEKAHPEYFADLPPLK |
| Ga0318561_105171262 | 3300031679 | Soil | DEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK |
| Ga0265314_105497432 | 3300031711 | Rhizosphere | EVLINTLKGAPRLNVPSLFRPEFMQQVEKEHPEYFADLPKL |
| Ga0310813_115625751 | 3300031716 | Soil | INTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL |
| Ga0307469_108965421 | 3300031720 | Hardwood Forest Soil | LTNTLKGAPRLNVPSLFRPEFMQQVEKQHPEYFADLPKLK |
| Ga0318500_101030103 | 3300031724 | Soil | EVLTNTLKGSPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL |
| Ga0307468_1004135141 | 3300031740 | Hardwood Forest Soil | TLKGAPRLDVQSLFRPQFMAEVQKEHPEYFADLPALK |
| Ga0318502_104752201 | 3300031747 | Soil | LKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK |
| Ga0318537_100266753 | 3300031763 | Soil | FEAAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN |
| Ga0318509_100368391 | 3300031768 | Soil | AFASAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPPLK |
| Ga0318509_106847353 | 3300031768 | Soil | NTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK |
| Ga0318521_103960351 | 3300031770 | Soil | KGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK |
| Ga0318521_106730532 | 3300031770 | Soil | TLKGAPRLNVPDQFSPAFMAEVGKVYPEYFADLPPLK |
| Ga0318543_102811861 | 3300031777 | Soil | ESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK |
| Ga0318498_103683011 | 3300031778 | Soil | AEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKTHPEYFADLPPLK |
| Ga0318547_104198142 | 3300031781 | Soil | EVLINTLKGAPRLAVPDQFRPSFMAEVEKAHPEYFADLPPLK |
| Ga0318552_107142541 | 3300031782 | Soil | FESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK |
| Ga0318576_104738241 | 3300031796 | Soil | EAAEDEVLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN |
| Ga0318550_105336491 | 3300031797 | Soil | EDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK |
| Ga0318568_102637704 | 3300031819 | Soil | EAAEDEVLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK |
| Ga0318567_100689261 | 3300031821 | Soil | LINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPLK |
| Ga0310900_113276122 | 3300031908 | Soil | EDEVLTNTLKGAPRLDVPSLFRPQFMAAVEKEHPEYFADLPKL |
| Ga0306921_126151731 | 3300031912 | Soil | LKGAPRLNVPDQFSPAFMAEVGKVYPEYFADLPPLK |
| Ga0310891_101143942 | 3300031913 | Soil | NAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK |
| Ga0306922_119131021 | 3300032001 | Soil | VLINTLKGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN |
| Ga0310911_100579754 | 3300032035 | Soil | AFESAEDEVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK |
| Ga0318559_105175552 | 3300032039 | Soil | NTLKGAPRLDVPDQFRPSFMAEVEKTHPEYFADLPPLK |
| Ga0318549_103936571 | 3300032041 | Soil | VLINTLKGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK |
| Ga0318556_106769811 | 3300032043 | Soil | MNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK |
| Ga0318506_100796341 | 3300032052 | Soil | EVLINTLKGAPRLDVPDQFRPSFMAEVEKAHPEYFADLPLLK |
| Ga0318575_103717721 | 3300032055 | Soil | KGAPRLNVPDQFSPAFMAEVEKVYPEYFADLPPLN |
| Ga0315540_104051901 | 3300032061 | Salt Marsh Sediment | VLMNTLKGAARLDVPSLFRPQFMAEVEKEHPEYFADLPKLK |
| Ga0307472_1014194582 | 3300032205 | Hardwood Forest Soil | NTLKGAPRLDVPKRFRPEFMQQVEKEHPEYFADLPKL |
| Ga0306920_1024392431 | 3300032261 | Soil | KGAPRLDVPDQFRPSFMAEVEKVHPEYFADLPPLK |
| Ga0306920_1043376731 | 3300032261 | Soil | INTLKGAPRLNVPDQFSPAFMAEVEEVHQEYFADLPPLK |
| Ga0310812_105077612 | 3300032421 | Soil | DEVLMNTLKGAPRLDVPKLFRPEFMQQVEKEHPDYFADLPKL |
| Ga0335085_106919511 | 3300032770 | Soil | PGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPKLK |
| Ga0335074_116312571 | 3300032895 | Soil | DEVLMNTLKGAPRLDVPSLFRPQFMAEVEKQHPEYFADLPPLG |
| Ga0335073_109110432 | 3300033134 | Soil | ENAEDEVLMNTLKGAPRLNVPSLFKPQFMAEVEKEHPEYFADLPPLK |
| Ga0318519_102165824 | 3300033290 | Soil | VLINTLKGAPRLDVPDQFRPSFMAEVGKAHPEYFADLPPFK |
| Ga0326726_109646982 | 3300033433 | Peat Soil | KGAPRLDVPSLFRPQVMTEVQKEHPEYFADLPTLK |
| Ga0316628_1018571571 | 3300033513 | Soil | NAEDEVLVNTLPGAPRLNVPSLFRPEFMQQVEKEHPEYFADLPKLG |
| ⦗Top⦘ |