


| Basic Information | |
|---|---|
| Family ID | F046330 |
| Family Type | Metagenome |
| Number of Sequences | 151 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAKGGKTNEQMKKLGRNLAKIANQKSGKKPPKDMGKVNKNG |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 151 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 90.73 % |
| % of genes near scaffold ends (potentially truncated) | 15.89 % |
| % of genes from short scaffolds (< 2000 bps) | 62.25 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.954 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (13.907 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.695 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.629 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 151 Family Scaffolds |
|---|---|---|
| PF00961 | LAGLIDADG_1 | 3.97 |
| PF03237 | Terminase_6N | 2.65 |
| PF02945 | Endonuclease_7 | 1.99 |
| PF10124 | Mu-like_gpT | 1.99 |
| PF01510 | Amidase_2 | 1.99 |
| PF08291 | Peptidase_M15_3 | 1.32 |
| PF13641 | Glyco_tranf_2_3 | 1.32 |
| PF00271 | Helicase_C | 1.32 |
| PF01870 | Hjc | 0.66 |
| PF16778 | Phage_tail_APC | 0.66 |
| PF13539 | Peptidase_M15_4 | 0.66 |
| PF00959 | Phage_lysozyme | 0.66 |
| PF13385 | Laminin_G_3 | 0.66 |
| PF00166 | Cpn10 | 0.66 |
| PF01844 | HNH | 0.66 |
| PF01464 | SLT | 0.66 |
| PF06048 | DUF927 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 151 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.66 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.95 % |
| All Organisms | root | All Organisms | 43.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0746093 | All Organisms → Viruses | 27072 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1000026 | Not Available | 52095 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1007769 | Not Available | 2380 | Open in IMG/M |
| 3300001580|Draft_10469973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300001752|JGI2173J19968_10022479 | All Organisms → Viruses | 2195 | Open in IMG/M |
| 3300001842|RCM30_1125900 | Not Available | 567 | Open in IMG/M |
| 3300001851|RCM31_10235719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300002835|B570J40625_100428745 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300002835|B570J40625_100610944 | Not Available | 996 | Open in IMG/M |
| 3300002856|draft_11314105 | Not Available | 649 | Open in IMG/M |
| 3300003806|Ga0007864_1000821 | All Organisms → cellular organisms → Bacteria | 3788 | Open in IMG/M |
| 3300004242|Ga0066601_10000347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19255 | Open in IMG/M |
| 3300004481|Ga0069718_15869898 | Not Available | 636 | Open in IMG/M |
| 3300004481|Ga0069718_15874760 | Not Available | 633 | Open in IMG/M |
| 3300004481|Ga0069718_15909426 | Not Available | 724 | Open in IMG/M |
| 3300004805|Ga0007792_10055681 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300005525|Ga0068877_10055771 | All Organisms → Viruses → Predicted Viral | 2587 | Open in IMG/M |
| 3300005525|Ga0068877_10199873 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
| 3300005527|Ga0068876_10379302 | Not Available | 791 | Open in IMG/M |
| 3300005581|Ga0049081_10000933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11099 | Open in IMG/M |
| 3300005581|Ga0049081_10080002 | Not Available | 1226 | Open in IMG/M |
| 3300005583|Ga0049085_10224844 | Not Available | 619 | Open in IMG/M |
| 3300005758|Ga0078117_1071996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3041 | Open in IMG/M |
| 3300006030|Ga0075470_10000116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28315 | Open in IMG/M |
| 3300006030|Ga0075470_10034431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1565 | Open in IMG/M |
| 3300006030|Ga0075470_10041578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
| 3300006030|Ga0075470_10061972 | Not Available | 1140 | Open in IMG/M |
| 3300006639|Ga0079301_1139136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300006641|Ga0075471_10667897 | Not Available | 506 | Open in IMG/M |
| 3300006802|Ga0070749_10416141 | Not Available | 740 | Open in IMG/M |
| 3300006805|Ga0075464_10038018 | All Organisms → Viruses → Predicted Viral | 2605 | Open in IMG/M |
| 3300006875|Ga0075473_10233844 | Not Available | 743 | Open in IMG/M |
| 3300006917|Ga0075472_10439104 | Not Available | 647 | Open in IMG/M |
| 3300007540|Ga0099847_1028669 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
| 3300007544|Ga0102861_1088124 | Not Available | 823 | Open in IMG/M |
| 3300007708|Ga0102859_1021284 | Not Available | 1693 | Open in IMG/M |
| 3300007708|Ga0102859_1219831 | Not Available | 567 | Open in IMG/M |
| 3300007972|Ga0105745_1222051 | Not Available | 600 | Open in IMG/M |
| 3300007973|Ga0105746_1363015 | Not Available | 506 | Open in IMG/M |
| 3300008107|Ga0114340_1020405 | All Organisms → Viruses → Predicted Viral | 3127 | Open in IMG/M |
| 3300008113|Ga0114346_1018862 | Not Available | 5815 | Open in IMG/M |
| 3300008114|Ga0114347_1223896 | Not Available | 603 | Open in IMG/M |
| 3300008266|Ga0114363_1003813 | Not Available | 8393 | Open in IMG/M |
| 3300008267|Ga0114364_1089032 | Not Available | 990 | Open in IMG/M |
| 3300008448|Ga0114876_1036985 | All Organisms → Viruses → Predicted Viral | 2325 | Open in IMG/M |
| 3300008448|Ga0114876_1265942 | Not Available | 518 | Open in IMG/M |
| 3300008450|Ga0114880_1009961 | All Organisms → Viruses → Predicted Viral | 4718 | Open in IMG/M |
| 3300009009|Ga0105105_10881921 | Not Available | 547 | Open in IMG/M |
| 3300009068|Ga0114973_10287846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300009085|Ga0105103_10712178 | Not Available | 578 | Open in IMG/M |
| 3300009151|Ga0114962_10015068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5566 | Open in IMG/M |
| 3300009151|Ga0114962_10275161 | Not Available | 950 | Open in IMG/M |
| 3300009154|Ga0114963_10131318 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
| 3300009154|Ga0114963_10293722 | Not Available | 907 | Open in IMG/M |
| 3300009159|Ga0114978_10036800 | Not Available | 3456 | Open in IMG/M |
| 3300009170|Ga0105096_10385116 | Not Available | 722 | Open in IMG/M |
| 3300009183|Ga0114974_10367449 | Not Available | 831 | Open in IMG/M |
| 3300009183|Ga0114974_10509043 | Not Available | 674 | Open in IMG/M |
| 3300009183|Ga0114974_10657358 | Not Available | 573 | Open in IMG/M |
| 3300009184|Ga0114976_10564489 | Not Available | 581 | Open in IMG/M |
| 3300009502|Ga0114951_10023065 | All Organisms → Viruses → Predicted Viral | 4147 | Open in IMG/M |
| 3300009506|Ga0118657_10510076 | All Organisms → Viruses → Predicted Viral | 1555 | Open in IMG/M |
| 3300010354|Ga0129333_10029903 | Not Available | 5147 | Open in IMG/M |
| 3300010354|Ga0129333_10177856 | All Organisms → Viruses → Predicted Viral | 1943 | Open in IMG/M |
| 3300010354|Ga0129333_11196649 | Not Available | 631 | Open in IMG/M |
| 3300010370|Ga0129336_10329324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300010885|Ga0133913_10001108 | Not Available | 61624 | Open in IMG/M |
| 3300010885|Ga0133913_11109381 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
| 3300010885|Ga0133913_11338314 | Not Available | 1826 | Open in IMG/M |
| 3300010885|Ga0133913_11627538 | All Organisms → Viruses → Predicted Viral | 1628 | Open in IMG/M |
| 3300011115|Ga0151514_10025 | All Organisms → Viruses | 64461 | Open in IMG/M |
| 3300011268|Ga0151620_1067319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans | 1158 | Open in IMG/M |
| 3300011334|Ga0153697_1172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22289 | Open in IMG/M |
| 3300011335|Ga0153698_1056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45005 | Open in IMG/M |
| 3300011921|Ga0120089_102216 | Not Available | 2409 | Open in IMG/M |
| 3300012346|Ga0157141_1000153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30513 | Open in IMG/M |
| 3300014962|Ga0134315_1035159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300015050|Ga0181338_1000366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9081 | Open in IMG/M |
| 3300015050|Ga0181338_1022171 | Not Available | 990 | Open in IMG/M |
| 3300015050|Ga0181338_1046007 | Not Available | 643 | Open in IMG/M |
| 3300017716|Ga0181350_1004910 | All Organisms → Viruses → Predicted Viral | 3880 | Open in IMG/M |
| 3300017747|Ga0181352_1067633 | Not Available | 1014 | Open in IMG/M |
| 3300017747|Ga0181352_1080114 | Not Available | 914 | Open in IMG/M |
| 3300017747|Ga0181352_1117496 | Not Available | 719 | Open in IMG/M |
| 3300017754|Ga0181344_1198462 | Not Available | 563 | Open in IMG/M |
| 3300017777|Ga0181357_1009737 | All Organisms → Viruses → Predicted Viral | 3829 | Open in IMG/M |
| 3300017780|Ga0181346_1000014 | Not Available | 66496 | Open in IMG/M |
| 3300019781|Ga0181360_120121 | Not Available | 541 | Open in IMG/M |
| 3300019784|Ga0181359_1000003 | Not Available | 59045 | Open in IMG/M |
| 3300019784|Ga0181359_1003654 | All Organisms → Viruses → Predicted Viral | 4756 | Open in IMG/M |
| 3300019784|Ga0181359_1063205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1414 | Open in IMG/M |
| 3300019784|Ga0181359_1129798 | Not Available | 890 | Open in IMG/M |
| 3300020159|Ga0211734_10320791 | Not Available | 890 | Open in IMG/M |
| 3300020159|Ga0211734_10742814 | Not Available | 1151 | Open in IMG/M |
| 3300020172|Ga0211729_10201793 | Not Available | 529 | Open in IMG/M |
| 3300020498|Ga0208050_1011074 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300021131|Ga0214206_1001638 | All Organisms → Viruses | 5093 | Open in IMG/M |
| 3300021519|Ga0194048_10007410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5140 | Open in IMG/M |
| 3300021519|Ga0194048_10069389 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300021956|Ga0213922_1005060 | Not Available | 4050 | Open in IMG/M |
| 3300021959|Ga0222716_10744069 | Not Available | 515 | Open in IMG/M |
| 3300022179|Ga0181353_1017033 | All Organisms → Viruses → Predicted Viral | 1891 | Open in IMG/M |
| 3300022179|Ga0181353_1110017 | Not Available | 669 | Open in IMG/M |
| 3300022555|Ga0212088_10208783 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300023301|Ga0209414_1000102 | Not Available | 36233 | Open in IMG/M |
| 3300023301|Ga0209414_1017586 | Not Available | 2435 | Open in IMG/M |
| 3300024354|Ga0255171_1046565 | Not Available | 821 | Open in IMG/M |
| 3300024358|Ga0255173_1009742 | All Organisms → Viruses → Predicted Viral | 1752 | Open in IMG/M |
| 3300025396|Ga0208874_1000015 | Not Available | 63456 | Open in IMG/M |
| 3300025585|Ga0208546_1000186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28252 | Open in IMG/M |
| 3300025585|Ga0208546_1056163 | Not Available | 928 | Open in IMG/M |
| 3300025732|Ga0208784_1131441 | Not Available | 743 | Open in IMG/M |
| 3300025896|Ga0208916_10034972 | All Organisms → Viruses → Predicted Viral | 2030 | Open in IMG/M |
| 3300027124|Ga0255116_1020474 | Not Available | 959 | Open in IMG/M |
| 3300027143|Ga0255105_1022494 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300027608|Ga0208974_1010954 | Not Available | 2945 | Open in IMG/M |
| 3300027627|Ga0208942_1158191 | Not Available | 606 | Open in IMG/M |
| 3300027734|Ga0209087_1000094 | Not Available | 53672 | Open in IMG/M |
| 3300027734|Ga0209087_1056536 | Not Available | 1774 | Open in IMG/M |
| 3300027739|Ga0209575_10000907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14204 | Open in IMG/M |
| 3300027741|Ga0209085_1155320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300027749|Ga0209084_1000594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33878 | Open in IMG/M |
| 3300027749|Ga0209084_1017268 | All Organisms → Viruses → Predicted Viral | 4021 | Open in IMG/M |
| 3300027764|Ga0209134_10278302 | Not Available | 571 | Open in IMG/M |
| 3300027836|Ga0209230_10575482 | Not Available | 633 | Open in IMG/M |
| 3300027888|Ga0209635_10087548 | Not Available | 2551 | Open in IMG/M |
| 3300027896|Ga0209777_10081569 | All Organisms → Viruses → Predicted Viral | 2805 | Open in IMG/M |
| 3300027900|Ga0209253_10773822 | Not Available | 685 | Open in IMG/M |
| 3300027917|Ga0209536_101888245 | Not Available | 718 | Open in IMG/M |
| 3300031539|Ga0307380_10156218 | All Organisms → Viruses → Predicted Viral | 2258 | Open in IMG/M |
| 3300031787|Ga0315900_10029244 | Not Available | 6169 | Open in IMG/M |
| 3300031787|Ga0315900_10273757 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
| 3300031787|Ga0315900_10408138 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300031787|Ga0315900_10495361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300031787|Ga0315900_11113665 | Not Available | 507 | Open in IMG/M |
| 3300031857|Ga0315909_10751385 | Not Available | 625 | Open in IMG/M |
| 3300031857|Ga0315909_10996858 | Not Available | 506 | Open in IMG/M |
| 3300031951|Ga0315904_10002346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29391 | Open in IMG/M |
| 3300031951|Ga0315904_10060380 | Not Available | 4172 | Open in IMG/M |
| 3300031951|Ga0315904_10388617 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300031951|Ga0315904_10507465 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300032092|Ga0315905_10924241 | Not Available | 743 | Open in IMG/M |
| 3300032252|Ga0316196_10242623 | Not Available | 793 | Open in IMG/M |
| 3300033816|Ga0334980_0025323 | All Organisms → Viruses → Predicted Viral | 2538 | Open in IMG/M |
| 3300033993|Ga0334994_0047725 | Not Available | 2689 | Open in IMG/M |
| 3300034061|Ga0334987_0689277 | Not Available | 587 | Open in IMG/M |
| 3300034062|Ga0334995_0093109 | Not Available | 2307 | Open in IMG/M |
| 3300034095|Ga0335022_0066392 | Not Available | 2350 | Open in IMG/M |
| 3300034104|Ga0335031_0021604 | All Organisms → Viruses → Predicted Viral | 4716 | Open in IMG/M |
| 3300034117|Ga0335033_0261082 | Not Available | 905 | Open in IMG/M |
| 3300034119|Ga0335054_0412140 | Not Available | 770 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.91% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.58% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.30% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.31% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.65% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.65% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 2.65% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.99% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.99% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.99% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.32% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.32% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.32% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.32% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.66% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.66% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.66% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.66% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.66% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.66% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.66% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.66% |
| Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 0.66% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.66% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.66% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300002856 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface | Engineered | Open in IMG/M |
| 3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
| 3300004242 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011921 | Mine pit pond microbial communities from Vermont, USA - 2M | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027124 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_074609327 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTKGGKTNEQMKKLGRNLAKVANQKKAVRKMPANPVKVNKNG* |
| LV_Brine_h2_0102DRAFT_10000266 | 3300000405 | Hypersaline | MAKGGKTNEQMLELGRNLAKVANQKKSVHKVPTNEVKVVKNG* |
| LV_Brine_h2_0102DRAFT_10077693 | 3300000405 | Hypersaline | MAKGGKTNGQMMQMGRNLAKIANQKSGSKPSKGKGNKNG* |
| Draft_104699732 | 3300001580 | Hydrocarbon Resource Environments | MAKGGKTNEQMKRLGRNLAKIANQKSGKKPTKDMGKVNKNG* |
| JGI2173J19968_100224792 | 3300001752 | Marine Sediment | MAKGGKTNEQMKRLGRNLAKVANQKSGKSIPKDMGKVVKNG* |
| RCM30_11259002 | 3300001842 | Marine Plankton | MAKGGKTNDQMLRLGRNLAKVANQKSGKAMQKENGKVVRNG* |
| RCM31_102357192 | 3300001851 | Marine Plankton | RRIDMAKGGKTNEQMKKLGRNLAKIANQKSGKKPIKDNGKVVKNG* |
| B570J40625_1004287453 | 3300002835 | Freshwater | MAKGGKTNKQMLSMGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| B570J40625_1006109442 | 3300002835 | Freshwater | MAKGGKTNEQMLKLGRNLAKIANQKSSVRSVRTNEVKVVKNG* |
| draft_113141053 | 3300002856 | Hydrocarbon Resource Environments | MSKGGKTNEQMKRLGRNLAKIANQKSGKKPTKDMGKVNKNG* |
| Ga0007864_10008215 | 3300003806 | Freshwater | MAKGGKTNEQLRKLGRNLAKIANQKSEVKKVKVNETKVNKNG* |
| Ga0066601_100003478 | 3300004242 | Freshwater | MAKGGKTNAQMKKLGRNLAKVANQKSGKKPVKDMGKVVKNG* |
| Ga0069718_158698982 | 3300004481 | Sediment | MAKGGKTNEQMMKLGRNLAKVANQKSGKKPIKDMGKVVKNG* |
| Ga0069718_158747602 | 3300004481 | Sediment | MAKGGKTNKQMLNMGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| Ga0069718_159094262 | 3300004481 | Sediment | MAKGGKTNKQMLKMGRNLAKIANQNKEVRKVKKDMGKVNKNG* |
| Ga0007792_100556813 | 3300004805 | Freshwater | MAKGGKTNAQMKSLGRGLAKVANQKKSFRDVKQDMGKVNKNG* |
| Ga0068877_100557713 | 3300005525 | Freshwater Lake | MAKGGKTSKQMLKLGRNLAKIANQKSGKKPTKDMGKVNKNG* |
| Ga0068877_101998733 | 3300005525 | Freshwater Lake | MAKGGKTNKQMLNMGRNLAKIANQKSGSKPKKDMGKVNKN |
| Ga0068876_103793022 | 3300005527 | Freshwater Lake | MAKGGVTNKQLLKMGRGLAKVANQKRAVRKVRKDMGKVVKNG* |
| Ga0049081_100009338 | 3300005581 | Freshwater Lentic | MAKGGKTNEQMLKLGRNLAKIANQKKSVRKVPTNEVKVNHNG* |
| Ga0049081_100800024 | 3300005581 | Freshwater Lentic | MAKGGKTNAQMLAMGRNLAKLANQKSGKKPVKDMGKVNKNG* |
| Ga0049085_102248442 | 3300005583 | Freshwater Lentic | MAKGGKTNEQMRKLGRNLAKVANQKSSVRKVPTNEVKVVKNG* |
| Ga0078117_10719963 | 3300005758 | Lake Water | MAKGGKTNEQMLKLGRNLAKVANQKREVRKVQKDMGKVVKNG* |
| Ga0075470_1000011626 | 3300006030 | Aqueous | MAKGGKTNEQMLKLGRNLAKVANQKREVRKVQKDMGKVNKNG* |
| Ga0075470_100344312 | 3300006030 | Aqueous | MAKGGKTNEQMLKLGRNLAKVANQQREVRKVQKDMGKVNKNG* |
| Ga0075470_100415782 | 3300006030 | Aqueous | MAKGGKTNEQMLKLGRNLAKVANQNKEVRKVQKDMGKVVKNG* |
| Ga0075470_100619723 | 3300006030 | Aqueous | MAKGGKTNDQMMKLGRNLAKIANQKREVRKVQKDMGKVN |
| Ga0079301_11391361 | 3300006639 | Deep Subsurface | MAKGGKTNDQMLKLGRNLAKVANQKSGKKPIKDMGKVDKNG* |
| Ga0075471_106678972 | 3300006641 | Aqueous | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPIKDMGKVNKNG* |
| Ga0070749_104161413 | 3300006802 | Aqueous | MAKGGKTNEQMKKLGRNLAKIANQNKEVRKVQKDMGKVNKNG* |
| Ga0075464_100380185 | 3300006805 | Aqueous | MAKGGKTNEQMLKLGRNLAKIANQKKSVRSVSSNEVKVVKNG* |
| Ga0075473_102338442 | 3300006875 | Aqueous | MAKGGKTNDQMMKLGRNLAKIANQKREVRKVQKDMGKVNKNG* |
| Ga0075472_104391042 | 3300006917 | Aqueous | MAKGGKTNEQMKRLGRNLAKIANQKSGKKPVKDMGKVNKNG* |
| Ga0099847_10286694 | 3300007540 | Aqueous | MAKGGKTNAQMKQLGRNLAKLANQKSGKKPTKDMGKVVKNG* |
| Ga0102861_10881241 | 3300007544 | Estuarine | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPVKDMGKVVKN |
| Ga0102859_10212844 | 3300007708 | Estuarine | MAKGGKTSEQMLKLGRDLAKVANQKKSVRSVSSNEVKVVKNG* |
| Ga0102859_12198312 | 3300007708 | Estuarine | MAKGGKTNAQMKQLGRNLAKIANQKSGKKPTKDMGKVVKNG* |
| Ga0105745_12220512 | 3300007972 | Estuary Water | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPVKDMGKVVKNG* |
| Ga0105746_13630152 | 3300007973 | Estuary Water | MAKGGKTNQQMLKLGRNLAKVANQKKEVRKVPVHEVKVVKNG* |
| Ga0114340_10204056 | 3300008107 | Freshwater, Plankton | MAKGGKTNKQMLSMGRNLAKIANQKSGSKPKKDMGKGNKNG* |
| Ga0114346_10188625 | 3300008113 | Freshwater, Plankton | MAKGGKTNEQMLKLGRNLAKVANQNKEVRKVQKDMGKVNKNG* |
| Ga0114347_12238963 | 3300008114 | Freshwater, Plankton | GGKTNKQMLNMGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| Ga0114363_10038133 | 3300008266 | Freshwater, Plankton | MAKGGKTNEQMLKLGRNLAKIANQKKAVRAVSSNEVKVVKNG* |
| Ga0114364_10890322 | 3300008267 | Freshwater, Plankton | MAKGGKTNTQMLKMGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| Ga0114876_10369853 | 3300008448 | Freshwater Lake | MAKGGKTNAQMKKMGRNLAKIANQKSGKKPMKDMGKVNKNG* |
| Ga0114876_12659422 | 3300008448 | Freshwater Lake | MAKGGKTNDQMMKLGRNLAKVANQKREVRKVQKDMGKVNKNG* |
| Ga0114880_10099619 | 3300008450 | Freshwater Lake | MAKGGKTNKQMLSMGRNLAKIANQKSGSKPKKDMVKVNKNG* |
| Ga0105105_108819212 | 3300009009 | Freshwater Sediment | MAKGGKTNKQMLSMGRNLAKIANQKSGSKPKKDMG |
| Ga0114973_102878463 | 3300009068 | Freshwater Lake | MAKGGKTNAQMKALGRGLAKVANQKKSFRDVKQNMGKVNKNG* |
| Ga0105103_107121782 | 3300009085 | Freshwater Sediment | MAKGGKTNEQMLKLGRNLAKVANQKSGKKPIKDMGKVVKNG* |
| Ga0114962_100150684 | 3300009151 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKVANQKNSVRKVPTNEVKVNPNG* |
| Ga0114962_102751613 | 3300009151 | Freshwater Lake | MAKGGKTNKQMLDLGRNLAKVANQKSGKKVNSNPVKVVQNG* |
| Ga0114963_101313181 | 3300009154 | Freshwater Lake | KTNAQMKSLGRGLAKVANQKKSFRDVKQDMGKVNKNG* |
| Ga0114963_102937222 | 3300009154 | Freshwater Lake | MAKGGVTNEQRKKLGRNLAKIANQKKSVRTVPTNEVKVNKNG* |
| Ga0114978_100368002 | 3300009159 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKIANQNKEVSKVKKDMGKVNKDG* |
| Ga0105096_103851161 | 3300009170 | Freshwater Sediment | LAKGGKTNAQMLAMGRGLAKVANQKKSVRKVPKDMGKVDKNG* |
| Ga0114974_103674491 | 3300009183 | Freshwater Lake | KGGKTNEQMLKLGRNLAKVANQKKPVRTVPTNEVKVVKNG* |
| Ga0114974_105090433 | 3300009183 | Freshwater Lake | MAKGGKTNSQMKKMGRNLAKIANQKSGKKPTKDMGKVNKNG* |
| Ga0114974_106573582 | 3300009183 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKIANQNKEVSKVKKDMGKVNK |
| Ga0114976_105644892 | 3300009184 | Freshwater Lake | MAKGGKTNEQMLKMGRNLAKIANQNKEVSKVKKDMGKVNKDG* |
| Ga0114951_100230653 | 3300009502 | Freshwater | MAKGGKTNDQMLKLGRNRAKIANQQKPVSKVKASETKVNKNG* |
| Ga0118657_105100763 | 3300009506 | Mangrove Sediment | MAKGGKTNEQMKKLGRNLAKIANQKSGKKPPKDMGKVNKNG* |
| Ga0129333_1002990311 | 3300010354 | Freshwater To Marine Saline Gradient | MAKGGKTNEQMKKLGRNLAKIANQKSGKKPVKDMGKVVKNG* |
| Ga0129333_101778562 | 3300010354 | Freshwater To Marine Saline Gradient | MAKGGKTNKQMLEMGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| Ga0129333_111966492 | 3300010354 | Freshwater To Marine Saline Gradient | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPIKDMGKVVKNG* |
| Ga0129336_103293241 | 3300010370 | Freshwater To Marine Saline Gradient | MAKGGKTNEQMKKLGRNLAKIANQKSGKKPVKDMGKVMG |
| Ga0133913_1000110817 | 3300010885 | Freshwater Lake | MAKGGKTNSQMKKMGRNLAKIANQKSGKKPSKDMGKVNKNG* |
| Ga0133913_111093816 | 3300010885 | Freshwater Lake | MAKGGKTNAQMKSLGRGLAKVANQKKSFRDVKKNMGKVNKNG* |
| Ga0133913_113383142 | 3300010885 | Freshwater Lake | MAKGGVTNEQRKKLGRNLAKIANQKKSVRTVPTNEVKVVKNG* |
| Ga0133913_116275382 | 3300010885 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKVANQKKPVRTVPTNEVKVVKNG* |
| Ga0151514_1002515 | 3300011115 | Freshwater | MAKGGKTNEQMLKLGRNLAKVANQKRPVRSVPKNEVKVVKNG* |
| Ga0151620_10673193 | 3300011268 | Freshwater | MAKGGKTNDQMKKMGRNLAKIANQKSGKKPVKDMGKVNKNG* |
| Ga0153697_11728 | 3300011334 | Freshwater | MAKGGKTNEQMLKLGRNLAKVANQKKSVRSVSSNEVKVVKNG* |
| Ga0153698_105623 | 3300011335 | Freshwater | MAKGGKTNKQMLNLGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| Ga0120089_1022163 | 3300011921 | Mine Pit Pond | MAKGGKTNDQMLKLGRNLAKVANQKSGKKPIKDMGKVNKNG* |
| Ga0157141_100015323 | 3300012346 | Freshwater | MAKGGKTNKQMLAMGRNLAKIANQKSGSKPKKDMGKVNKNG* |
| Ga0134315_10351591 | 3300014962 | Surface Water | MAKGGKTNEQMLKLGRNLAKVANQKREVRKVQKDMGKVVQNG* |
| Ga0181338_10003667 | 3300015050 | Freshwater Lake | MAKGGKTNEQMLKMGRNLAKVANQKRSVRSVPKHEVKVVKNG* |
| Ga0181338_10221712 | 3300015050 | Freshwater Lake | MAKGGKTNEQMKKLGRNLAKIANQKKSVRTVPTNEVKASKNG* |
| Ga0181338_10460071 | 3300015050 | Freshwater Lake | MAKGGKTNDQMMKLGRNLAKVANQKSGKKPIKDMGKVDKNG* |
| Ga0181350_10049105 | 3300017716 | Freshwater Lake | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPIKNNNDGSK |
| Ga0181352_10676333 | 3300017747 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKIANQNKEVSKVKKDMGKVNKNG |
| Ga0181352_10801143 | 3300017747 | Freshwater Lake | MAKCGKTNAQMLAMGRNLAKIANQKSGKKPTKDMGKVNKNG |
| Ga0181352_11174963 | 3300017747 | Freshwater Lake | MAKGGKTNEQMKKLGRNLAKVANQKKEVRKVPVHEVKVVKNG |
| Ga0181344_11984623 | 3300017754 | Freshwater Lake | AKGGKTNKQMLEMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0181357_10097377 | 3300017777 | Freshwater Lake | MAKGSKTNAQMLAMGRNLAKLANQKSGKKPVKDMGKVNKNG |
| Ga0181346_100001427 | 3300017780 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKIANQKSAVRSVPKNEVKVVKNG |
| Ga0181360_1201212 | 3300019781 | Freshwater Lake | MAKGGKTNEQMLKMGRNLAKVANQKRSVRSVPKHEVKVVKNG |
| Ga0181359_100000347 | 3300019784 | Freshwater Lake | MAKGGKTNAQMLAMGRNLAKLANQKSGKKPVKDMGKVNKNG |
| Ga0181359_10036546 | 3300019784 | Freshwater Lake | MAKGGKTNKQMLSMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0181359_10632053 | 3300019784 | Freshwater Lake | MAKGGKTNDQMMKLGRNLAKVANQKSGKKPIKDMGKVDKNG |
| Ga0181359_11297982 | 3300019784 | Freshwater Lake | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPVKDMGKVVKNG |
| Ga0211734_103207912 | 3300020159 | Freshwater | MAKGGKTNKQMLKMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0211734_107428142 | 3300020159 | Freshwater | MSKGGKTNEQMLKMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0211729_102017931 | 3300020172 | Freshwater | MAKGGKTNEQMKKLGRNLAKVANQKSGKKPIQNNNDGSK |
| Ga0208050_10110743 | 3300020498 | Freshwater | MAKGGKTNDQMLKLGRNLAKVANQKSGKKPIKDMGKVDKNG |
| Ga0214206_100163811 | 3300021131 | Freshwater | MAKGGKTNEQMRKLGRNRAKIANQKSEVRKVKVNETKVNKNG |
| Ga0194048_100074101 | 3300021519 | Anoxic Zone Freshwater | MAKGGKTNEQMRKLGRNLAKIANQKSGKSIKQNPVKVVKNG |
| Ga0194048_100693894 | 3300021519 | Anoxic Zone Freshwater | MAKGGKTNEQMKKLGRNLAKIANQKSSVRKVPTNEVKVVKNG |
| Ga0213922_10050603 | 3300021956 | Freshwater | MAKGGKTNEQMLKLGRNLAKIANQKSGSKPTKDMGKVNKNG |
| Ga0222716_107440691 | 3300021959 | Estuarine Water | MAKGGKTNDQMKKMGRNLAKIANQKSGKKPVKDMGKVNKNG |
| Ga0181353_10170331 | 3300022179 | Freshwater Lake | MAKGGKTNEQMKKLGRNLAKIANQKSGKKPVKDMGKVNKNG |
| Ga0181353_11100173 | 3300022179 | Freshwater Lake | MAKCGKTNAQMLAMGRNLAKIANQKSGKKPTKDMGK |
| Ga0212088_102087833 | 3300022555 | Freshwater Lake Hypolimnion | MAKGGKTNDQMLKLGRNRAKIANQQKPVSKVKASETKVNKNG |
| Ga0209414_10001026 | 3300023301 | Hypersaline | MAKGGKTNEQMLELGRNLAKVANQKKSVHKVPTNEVKVVKNG |
| Ga0209414_10175863 | 3300023301 | Hypersaline | MAKGGKTNGQMMQMGRNLAKIANQKSGSKPSKGKGNKNG |
| Ga0255171_10465653 | 3300024354 | Freshwater | MAKGGKTNEQMKKLGRNLAKIANQNKEVRKVQKDMGKVNKNG |
| Ga0255173_10097423 | 3300024358 | Freshwater | MAKGGKTNEQMKKLGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0208874_100001566 | 3300025396 | Freshwater | MAKGGKTNEQLRKLGRNLAKIANQKSEVKKVKVNETKVNKNG |
| Ga0208546_100018626 | 3300025585 | Aqueous | MAKGGKTNEQMLKLGRNLAKVANQKREVRKVQKDMGKVNKNG |
| Ga0208546_10561633 | 3300025585 | Aqueous | MAKGGKTNDQMMKLGRNLAKIANQKREVRKVQKDMGKVNKN |
| Ga0208784_11314412 | 3300025732 | Aqueous | MAKGGKTNDQMMKLGRNLAKIANQKREVRKVQKDMGKVNKNG |
| Ga0208916_100349723 | 3300025896 | Aqueous | MAKGGKTNEQMLKLGRNLAKIANQKKSVRSVSSNEVKVVKNG |
| Ga0255116_10204743 | 3300027124 | Freshwater | MAKGGKTNDQMMKLGRNLAKVANQKSGKKPIKDMG |
| Ga0255105_10224941 | 3300027143 | Freshwater | MAKGGKTNDQMMKLGRNLAKVANQKSGKKPIKDMGKVE |
| Ga0208974_10109546 | 3300027608 | Freshwater Lentic | MAKGGKTNEQMLKLGRNLAKIANQKKSVRKVPTNEVKVNHNG |
| Ga0208942_11581912 | 3300027627 | Freshwater Lentic | MAKGGKTNEQMRKLGRNLAKVANQKSSVRKVPTNEVKVVKNG |
| Ga0209087_100009439 | 3300027734 | Freshwater Lake | MAKGGKTNSQMKKMGRNLAKIANQKSGKKPSKDMGKVNKNG |
| Ga0209087_10565363 | 3300027734 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKIANQNKEVSKVKKDMGKVNKDG |
| Ga0209575_1000090716 | 3300027739 | Freshwater | MAKGGKTNAQMKKLGRNLAKVANQKSGKKPVKDMGKVVKNG |
| Ga0209085_11553201 | 3300027741 | Freshwater Lake | KTNAQMKSLGRGLAKVANQKKSFRDVKQDMGKVNKNG |
| Ga0209084_100059426 | 3300027749 | Freshwater Lake | MAKGGKTNAQMKSLGRGLAKVANQKKSFRDVKQDMGKVNKNG |
| Ga0209084_10172684 | 3300027749 | Freshwater Lake | MAKGGKTNEQMLKLGRNLAKVANQKNSVRKVPTNEVKVNPNG |
| Ga0209134_102783022 | 3300027764 | Freshwater Lake | MAKGGKTNEQMKRLGRNLAKLANQKSGKKPIKDMGKVNKNG |
| Ga0209230_105754822 | 3300027836 | Freshwater And Sediment | MAKGGKTNAQMLKLGRNLAKIANQKKSVRSVSSNEVKVVKNG |
| Ga0209635_100875484 | 3300027888 | Marine Sediment | MAKGGKTNEQMKRLGRNLAKVANQKSGKSIPKDMGKVVKNG |
| Ga0209777_100815693 | 3300027896 | Freshwater Lake Sediment | MAKGGKTNEQMRKLGRNLAKVANQKSEVRKVKVNETKVNKNG |
| Ga0209253_107738221 | 3300027900 | Freshwater Lake Sediment | MAKGGKTNMQMLKMGRNLAKIANQKSGKKPIKDMGKVVKNGL |
| Ga0209536_1018882452 | 3300027917 | Marine Sediment | MAKGGKTNEQMKRLGRNLAKIANQKSGKKPQKDMGKVNKNG |
| Ga0307380_101562181 | 3300031539 | Soil | MAKGGKTNEQMIKLGRNLAKIANQKKSVRSVSSNEVKVVKNG |
| Ga0315900_100292449 | 3300031787 | Freshwater | MAKGGKTNAQMKSLGRNLAKIANQKKAVHTVTKGMGKVNKNG |
| Ga0315900_102737573 | 3300031787 | Freshwater | MAKGGVTNKQLLKMGRGLAKVANQKRAVRKVLKDMGKVVKNG |
| Ga0315900_104081383 | 3300031787 | Freshwater | MAKGGKTNEQMKKLGRNLAKVANQKKEVRKVQKDMGKVVKNG |
| Ga0315900_104953611 | 3300031787 | Freshwater | KGGKTNEQMLKLGRNLAKVANQNKEVRKVQKDMGKVNKNG |
| Ga0315900_111136653 | 3300031787 | Freshwater | MAKGGKTNAQMKKLGRNLAKIANQKSGKKPVKDMGKVNKNG |
| Ga0315909_107513852 | 3300031857 | Freshwater | MAKGGKTNDQMMKLGRNLAKVANQKREVRKVQKDMGKVNKNG |
| Ga0315909_109968581 | 3300031857 | Freshwater | KTNAQMKKLGRNLAKIANQKSGKKPTKDMGKVNKNG |
| Ga0315904_1000234624 | 3300031951 | Freshwater | MAKGGKTNAQMKKLGRNLAKIANQKSGKKPTKDMGKVNKNG |
| Ga0315904_100603807 | 3300031951 | Freshwater | MAKGGVTNKQLLKMGRGLAKVANQKRAVRKVRKDMGKVVKNG |
| Ga0315904_103886173 | 3300031951 | Freshwater | MAKGGKTNEQMKKLGRNLAKIANQNREVRKVQKDMGKVNKNG |
| Ga0315904_105074653 | 3300031951 | Freshwater | MAKGGKTNEQMLKLGRNLAKVANQNKEVRKVQKDMGKVNKNG |
| Ga0315905_109242413 | 3300032092 | Freshwater | KTNKQMLEMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0316196_102426233 | 3300032252 | Sediment | NQQMKKLGRNLAKIANQNKEVRKVQKDMGKVNKNG |
| Ga0334980_0025323_816_941 | 3300033816 | Freshwater | MAKGGKTNKQMLDMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0334994_0047725_1423_1548 | 3300033993 | Freshwater | MAKCGKTNAQMLAMGRNLAKIANQKSGKKPVKDMGKVNKNG |
| Ga0334987_0689277_314_439 | 3300034061 | Freshwater | MAKGGKTNEQMLKLGRNLAKVANQKSGKKPIKDMGKVVKNG |
| Ga0334995_0093109_1840_1965 | 3300034062 | Freshwater | MAKCGKTNAQMLAMGRNLAKLANQKSGKKPVKDMGKVNKNG |
| Ga0335022_0066392_959_1084 | 3300034095 | Freshwater | MAKGGKTNEQMRKLGRNLAKIANQKSGKSVKQNPVKVVKNG |
| Ga0335031_0021604_261_386 | 3300034104 | Freshwater | MAKGGKTNTQMLKMGRNLAKIANQKSGSKPKKDMGKVNKNG |
| Ga0335033_0261082_369_488 | 3300034117 | Freshwater | MAKGGKTNEQMKKLGSNLAKVANQKSGKKPIKNNNDGSK |
| Ga0335054_0412140_8_133 | 3300034119 | Freshwater | MAKGGKTNAQMLKMGRNLAKIANQKSGKKPKKDMGKVVKNG |
| ⦗Top⦘ |