


| Basic Information | |
|---|---|
| Family ID | F046057 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 40 residues |
| Representative Sequence | SQSFGPSAIVSGSAYLLLRLSALECLTSLADGLTYYALC |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.89 % |
| % of genes near scaffold ends (potentially truncated) | 92.76 % |
| % of genes from short scaffolds (< 2000 bps) | 88.82 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.605 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.421 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.079 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.447 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF13495 | Phage_int_SAM_4 | 17.11 |
| PF00078 | RVT_1 | 4.61 |
| PF14319 | Zn_Tnp_IS91 | 4.61 |
| PF00665 | rve | 1.32 |
| PF08388 | GIIM | 1.32 |
| PF00589 | Phage_integrase | 1.32 |
| PF03938 | OmpH | 1.32 |
| PF03401 | TctC | 0.66 |
| PF10861 | DUF2784 | 0.66 |
| PF14526 | Cass2 | 0.66 |
| PF13561 | adh_short_C2 | 0.66 |
| PF01520 | Amidase_3 | 0.66 |
| PF00293 | NUDIX | 0.66 |
| PF13610 | DDE_Tnp_IS240 | 0.66 |
| PF00440 | TetR_N | 0.66 |
| PF03050 | DDE_Tnp_IS66 | 0.66 |
| PF13180 | PDZ_2 | 0.66 |
| PF00872 | Transposase_mut | 0.66 |
| PF13546 | DDE_5 | 0.66 |
| PF00037 | Fer4 | 0.66 |
| PF13683 | rve_3 | 0.66 |
| PF01872 | RibD_C | 0.66 |
| PF10431 | ClpB_D2-small | 0.66 |
| PF07394 | DUF1501 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.32 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 1.32 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.32 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.32 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.32 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.66 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.66 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.66 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.66 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.61 % |
| Unclassified | root | N/A | 20.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B01D41WK | Not Available | 501 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1071337 | Not Available | 527 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1074192 | Not Available | 516 | Open in IMG/M |
| 3300001179|JGI12660J13575_100016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → Magnetococcaceae → Magnetococcus → Magnetococcus marinus | 3247 | Open in IMG/M |
| 3300002907|JGI25613J43889_10012649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2346 | Open in IMG/M |
| 3300002908|JGI25382J43887_10279764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300002914|JGI25617J43924_10112288 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300003352|JGI26345J50200_1002972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1590 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10054824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1523 | Open in IMG/M |
| 3300005186|Ga0066676_10389266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 938 | Open in IMG/M |
| 3300005332|Ga0066388_102484528 | Not Available | 941 | Open in IMG/M |
| 3300005454|Ga0066687_10229227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1027 | Open in IMG/M |
| 3300005466|Ga0070685_11177568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 582 | Open in IMG/M |
| 3300005468|Ga0070707_101328085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 685 | Open in IMG/M |
| 3300005557|Ga0066704_10748300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 611 | Open in IMG/M |
| 3300005564|Ga0070664_101691394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300005575|Ga0066702_10991888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300005578|Ga0068854_100165277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1717 | Open in IMG/M |
| 3300005719|Ga0068861_102402581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
| 3300005764|Ga0066903_107128989 | Not Available | 579 | Open in IMG/M |
| 3300005832|Ga0074469_11228626 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
| 3300005843|Ga0068860_101177654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300006017|Ga0058708_1000211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 596 | Open in IMG/M |
| 3300006028|Ga0070717_10555772 | Not Available | 1039 | Open in IMG/M |
| 3300006041|Ga0075023_100342350 | Not Available | 630 | Open in IMG/M |
| 3300006050|Ga0075028_100760673 | Not Available | 587 | Open in IMG/M |
| 3300006163|Ga0070715_10024216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2388 | Open in IMG/M |
| 3300006797|Ga0066659_11368900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 591 | Open in IMG/M |
| 3300006804|Ga0079221_10094600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. OGB3 | 1453 | Open in IMG/M |
| 3300006804|Ga0079221_10491833 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300006846|Ga0075430_100017654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6076 | Open in IMG/M |
| 3300006854|Ga0075425_102142733 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006893|Ga0073928_10141994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium retamae | 1948 | Open in IMG/M |
| 3300006903|Ga0075426_10508381 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300006914|Ga0075436_100244003 | Not Available | 1278 | Open in IMG/M |
| 3300006914|Ga0075436_101386624 | Not Available | 533 | Open in IMG/M |
| 3300007521|Ga0105044_10889481 | Not Available | 694 | Open in IMG/M |
| 3300007788|Ga0099795_10020971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 2136 | Open in IMG/M |
| 3300009038|Ga0099829_10481359 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300009090|Ga0099827_10718350 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009092|Ga0105250_10333741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 661 | Open in IMG/M |
| 3300009101|Ga0105247_10139118 | Not Available | 1589 | Open in IMG/M |
| 3300009143|Ga0099792_10309499 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300009627|Ga0116109_1105951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300009641|Ga0116120_1014981 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300009644|Ga0116121_1023799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Desulfallaceae → Desulfoscipio → Desulfoscipio geothermicus | 1955 | Open in IMG/M |
| 3300010046|Ga0126384_11653924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604 | Open in IMG/M |
| 3300010048|Ga0126373_12521718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300010154|Ga0127503_10600676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300010322|Ga0134084_10396749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300010361|Ga0126378_10444125 | Not Available | 1411 | Open in IMG/M |
| 3300010361|Ga0126378_11320960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 816 | Open in IMG/M |
| 3300010362|Ga0126377_11536570 | Not Available | 740 | Open in IMG/M |
| 3300010373|Ga0134128_10826912 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300010399|Ga0134127_12808614 | Not Available | 566 | Open in IMG/M |
| 3300010401|Ga0134121_12485633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 560 | Open in IMG/M |
| 3300010408|Ga0137020_100288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
| 3300011075|Ga0138555_1062794 | Not Available | 503 | Open in IMG/M |
| 3300011430|Ga0137423_1261365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300012189|Ga0137388_12018434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300012203|Ga0137399_11589980 | Not Available | 542 | Open in IMG/M |
| 3300012205|Ga0137362_11265209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 623 | Open in IMG/M |
| 3300012205|Ga0137362_11771671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 504 | Open in IMG/M |
| 3300012357|Ga0137384_11192819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012359|Ga0137385_10650798 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012507|Ga0157342_1072857 | Not Available | 526 | Open in IMG/M |
| 3300012582|Ga0137358_10812775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 620 | Open in IMG/M |
| 3300012917|Ga0137395_11112656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300012923|Ga0137359_11665571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300013307|Ga0157372_11898790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300014325|Ga0163163_11138379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 843 | Open in IMG/M |
| 3300015356|Ga0134073_10253520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300015374|Ga0132255_106332076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300016270|Ga0182036_10065321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2350 | Open in IMG/M |
| 3300016404|Ga0182037_11482368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300017933|Ga0187801_10062022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
| 3300018006|Ga0187804_10274124 | Not Available | 731 | Open in IMG/M |
| 3300018031|Ga0184634_10026993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2238 | Open in IMG/M |
| 3300020150|Ga0187768_1150613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 537 | Open in IMG/M |
| 3300020579|Ga0210407_10060375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2838 | Open in IMG/M |
| 3300021073|Ga0210378_10078024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
| 3300021171|Ga0210405_11166109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300021286|Ga0179583_1059809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium tianshanense | 546 | Open in IMG/M |
| 3300021307|Ga0179585_1074506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 630 | Open in IMG/M |
| 3300021401|Ga0210393_10982873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 684 | Open in IMG/M |
| 3300021432|Ga0210384_11611654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
| 3300021474|Ga0210390_10063236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3051 | Open in IMG/M |
| 3300022506|Ga0242648_1022238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BL23I1N1 | 822 | Open in IMG/M |
| 3300022522|Ga0242659_1062985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 678 | Open in IMG/M |
| 3300022726|Ga0242654_10450342 | Not Available | 502 | Open in IMG/M |
| 3300024330|Ga0137417_1499553 | Not Available | 1769 | Open in IMG/M |
| 3300024516|Ga0209980_10023972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 3128 | Open in IMG/M |
| 3300025706|Ga0209507_1211946 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia | 507 | Open in IMG/M |
| 3300025895|Ga0209567_10622340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300025912|Ga0207707_10072372 | Not Available | 3005 | Open in IMG/M |
| 3300025915|Ga0207693_10259532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1363 | Open in IMG/M |
| 3300025928|Ga0207700_11645636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 567 | Open in IMG/M |
| 3300025929|Ga0207664_10343382 | Not Available | 1320 | Open in IMG/M |
| 3300026026|Ga0210129_1023735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300026354|Ga0257180_1002106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1835 | Open in IMG/M |
| 3300026833|Ga0207728_101865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 2411 | Open in IMG/M |
| 3300027063|Ga0207762_1008436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1929 | Open in IMG/M |
| 3300027096|Ga0208099_1001640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2538 | Open in IMG/M |
| 3300027266|Ga0209215_1007023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 1326 | Open in IMG/M |
| 3300027548|Ga0209523_1010610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1696 | Open in IMG/M |
| 3300027633|Ga0208988_1175437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 506 | Open in IMG/M |
| 3300027678|Ga0209011_1054467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300027765|Ga0209073_10500539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300027783|Ga0209448_10047537 | Not Available | 1444 | Open in IMG/M |
| (restricted) 3300027868|Ga0255053_10117221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1275 | Open in IMG/M |
| 3300027911|Ga0209698_11331403 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300028779|Ga0302266_10204203 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300028802|Ga0307503_10694514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300028906|Ga0308309_11577267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 559 | Open in IMG/M |
| 3300029908|Ga0311341_10672851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 579 | Open in IMG/M |
| 3300030947|Ga0075390_11218411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 606 | Open in IMG/M |
| 3300030969|Ga0075394_12104363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 547 | Open in IMG/M |
| 3300031233|Ga0302307_10638871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031446|Ga0170820_10500529 | Not Available | 669 | Open in IMG/M |
| 3300031543|Ga0318516_10163920 | Not Available | 1278 | Open in IMG/M |
| 3300031543|Ga0318516_10748229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300031561|Ga0318528_10224502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1006 | Open in IMG/M |
| 3300031561|Ga0318528_10306427 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031573|Ga0310915_10972628 | Not Available | 593 | Open in IMG/M |
| 3300031677|Ga0307480_1020682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
| 3300031720|Ga0307469_10073468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2279 | Open in IMG/M |
| 3300031753|Ga0307477_10500942 | Not Available | 825 | Open in IMG/M |
| 3300031753|Ga0307477_11048985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300031781|Ga0318547_10649287 | Not Available | 655 | Open in IMG/M |
| 3300031799|Ga0318565_10353779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300031832|Ga0318499_10326688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300031854|Ga0310904_10112396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1519 | Open in IMG/M |
| 3300031879|Ga0306919_11196056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300031896|Ga0318551_10924073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 510 | Open in IMG/M |
| 3300031910|Ga0306923_10062976 | All Organisms → cellular organisms → Bacteria | 4121 | Open in IMG/M |
| 3300031910|Ga0306923_11911548 | Not Available | 605 | Open in IMG/M |
| 3300031910|Ga0306923_11936413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 600 | Open in IMG/M |
| 3300031946|Ga0310910_11258590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 573 | Open in IMG/M |
| 3300032009|Ga0318563_10531701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300032055|Ga0318575_10058964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1780 | Open in IMG/M |
| 3300032055|Ga0318575_10687452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300032059|Ga0318533_10352685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
| 3300032063|Ga0318504_10177279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 989 | Open in IMG/M |
| 3300032063|Ga0318504_10276051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300032076|Ga0306924_11680602 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032076|Ga0306924_12412897 | Not Available | 530 | Open in IMG/M |
| 3300032156|Ga0315295_10753417 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 980 | Open in IMG/M |
| 3300032261|Ga0306920_100426824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1970 | Open in IMG/M |
| 3300032261|Ga0306920_100736876 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300032955|Ga0335076_11660934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 527 | Open in IMG/M |
| 3300033290|Ga0318519_10119807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1439 | Open in IMG/M |
| 3300034114|Ga0364938_000861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3182 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.29% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.97% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.32% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.66% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.66% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.66% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.66% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.66% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.66% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.66% |
| Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.66% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.66% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.66% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.66% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300001179 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006017 | Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010408 | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - End of the channel, sample P5-2012 | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024516 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026026 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030947 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_03864440 | 2170459023 | Grass Soil | SYSPLLSFGSSITVPGSTYLLLHLSVLECLTSFADDVIYYTLC |
| AF_2010_repII_A01DRAFT_10713371 | 3300000580 | Forest Soil | PLLSFGPSITVPGSAYLLLHLSVLECLTSFADDVIHYARC* |
| AF_2010_repII_A01DRAFT_10741921 | 3300000580 | Forest Soil | LPLLSFGPSITVPGSAYLLLHLSVLECLTSFADDVIHYARC* |
| JGI12660J13575_1000164 | 3300001179 | Forest Soil | MSRQSYLPSQSFGPSATAPGSAYLLLRLSALECLTSLADGLAYYALC* |
| JGI25613J43889_100126491 | 3300002907 | Grasslands Soil | PTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC* |
| JGI25382J43887_102797641 | 3300002908 | Grasslands Soil | MSYSPLLSFGSSITVPGSAYLLLHLSVLECLTSFADDVIYYTLC* |
| JGI25617J43924_101122882 | 3300002914 | Grasslands Soil | TCHSQSFGPSAIVPGSAYLLLRLSALECLTSFADVMDYYAVC* |
| JGI26345J50200_10029724 | 3300003352 | Bog Forest Soil | MSCQSYLPSQSFGPSAIVPGSAYXLLRLSALECLTSLADGLAYYAVC* |
| JGIcombinedJ51221_100548241 | 3300003505 | Forest Soil | VASPNRHSQSFGPSALVPGSAYLFLRLSALECLTSLADCLA* |
| Ga0066676_103892661 | 3300005186 | Soil | TCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0066388_1024845281 | 3300005332 | Tropical Forest Soil | MSYSLSFSFGPSTTVPGSAYPFLRLSALECLTSLADDMAHYALC* |
| Ga0066687_102292271 | 3300005454 | Soil | TCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC* |
| Ga0070685_111775682 | 3300005466 | Switchgrass Rhizosphere | LRLMAYWPPFSFGPSATVPGLAYPLLRLSDFGCLTSLADVMT* |
| Ga0070707_1013280851 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VASPTCHSQSFGPSAIVSGLAYLLLRLSALECLTSLADGLAYYALC* |
| Ga0066704_107483001 | 3300005557 | Soil | VASPTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0070664_1016913942 | 3300005564 | Corn Rhizosphere | ASPTCRSRSFGPSVPVSGSAYLLLRLSALECLTSLADSRAYYALC* |
| Ga0066702_109918882 | 3300005575 | Soil | GPSIIVPGLAYPLLRLSALECLTSLADCMTYFARC* |
| Ga0068854_1001652773 | 3300005578 | Corn Rhizosphere | VASPSCHFQSFGPSVIVSGLAYPGLRLSALECLTSLADGVTYYAVC* |
| Ga0068861_1024025811 | 3300005719 | Switchgrass Rhizosphere | QSFGPSAIVPGSAYPLLRLSALECLTSLADSMTYYAVC* |
| Ga0066903_1071289892 | 3300005764 | Tropical Forest Soil | MSYWPPFSFGPSATVSGSTYLLLHLSVPECLTSLTDVMTYYAVC* |
| Ga0074469_112286261 | 3300005832 | Sediment (Intertidal) | AFDGGDAGLAYLLLRLSALECLTSLADGMAYFALC* |
| Ga0068860_1011776542 | 3300005843 | Switchgrass Rhizosphere | PSVIVSGLAYPGLRLSALECLTSLADGVTYYAVC* |
| Ga0058708_10002111 | 3300006017 | Rhizosphere | SQSFGPSAIVPGSAYLLLRLSALECLTSLADGVAYYALC* |
| Ga0070717_105557722 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SQSFGPSAIVPGSAYLLLRLSALECLTSFADVMTYYAVC* |
| Ga0075023_1003423502 | 3300006041 | Watersheds | MSYSPLLSFGSSITVPGSTYLLLHLSVLECLTSFADDVIYYTLC* |
| Ga0075028_1007606731 | 3300006050 | Watersheds | MSYLPLLSFGPSAPVSGSAYPLLRLSALECLISLADVMAYYALC* |
| Ga0070715_100242163 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SQSFGPSAIVPGSAYPLLRLSALECLTSLADGLAYYAVC* |
| Ga0066659_113689001 | 3300006797 | Soil | PTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0079221_100946001 | 3300006804 | Agricultural Soil | PSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0079221_104918333 | 3300006804 | Agricultural Soil | LPLSIVGPSVLVSGSAYLLLRLSALECLTSLADGRTYYALC* |
| Ga0075430_1000176541 | 3300006846 | Populus Rhizosphere | DPLMDDSPTCRSPSFGPSAIVSGSAYLLLRLGLECLTSLADSMTYYALC* |
| Ga0075425_1021427331 | 3300006854 | Populus Rhizosphere | LRVPFGPSIIVPGLAYLLLRLSALECLNSLADCMTY |
| Ga0073928_101419942 | 3300006893 | Iron-Sulfur Acid Spring | MSSQSYLPSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC* |
| Ga0075426_105083811 | 3300006903 | Populus Rhizosphere | GPSIIVPGLAYLLLRLSALECLNSLADCMTYYALC* |
| Ga0075436_1002440031 | 3300006914 | Populus Rhizosphere | MSTRLSFSFGPSTTVPGSAYLLLHLSVLECLTSLADDMAYYALC* |
| Ga0075436_1013866241 | 3300006914 | Populus Rhizosphere | VPFGPSIIVPGLAYRLLRLSVLECLTSLADCMTYFALC* |
| Ga0105044_108894811 | 3300007521 | Freshwater | TQFRPSSAVPGSAYLELRLSALECLTSLADDTDYYGVC* |
| Ga0099795_100209711 | 3300007788 | Vadose Zone Soil | SPTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC* |
| Ga0099829_104813591 | 3300009038 | Vadose Zone Soil | MSYSPLLSFGSSITVPGSTYLLLHLSVLECLTSFADDVI |
| Ga0099827_107183501 | 3300009090 | Vadose Zone Soil | LYSPCGVPFGPSITVPGSAYLLLRLSALECLNSFADCMTYFALC* |
| Ga0105250_103337411 | 3300009092 | Switchgrass Rhizosphere | HSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC* |
| Ga0105247_101391182 | 3300009101 | Switchgrass Rhizosphere | PSVIVSGLAYPGLRLSALECLTSRADGVTYYAVC* |
| Ga0099792_103094991 | 3300009143 | Vadose Zone Soil | SQSFGPSAIVSGSAYLLLRLSALECLTSLADGLTYYALC* |
| Ga0116109_11059511 | 3300009627 | Peatland | PTCRSQSFGPSAIVSGLAYLLLRLSAWSASISLADSMTHYALC* |
| Ga0116120_10149813 | 3300009641 | Peatland | GVPFGPSIIVPSLAYLLLRLSALECLNSLADGMTYFALC* |
| Ga0116121_10237991 | 3300009644 | Peatland | NVQLSFSFSPSFTVPGSAYLFLHLSALECLNSITDDMTYYGLC* |
| Ga0126384_116539241 | 3300010046 | Tropical Forest Soil | ICHSHSFGPSAIVSGSAYLLLRLSTLECLTSFADGLAYYALC* |
| Ga0126373_125217181 | 3300010048 | Tropical Forest Soil | SFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0127503_106006761 | 3300010154 | Soil | FGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0134084_103967491 | 3300010322 | Grasslands Soil | FGPSVIPGLAYLLLRLSALECLTSFADVMTYSALC* |
| Ga0126378_104441251 | 3300010361 | Tropical Forest Soil | VASPTCHSHSFGPSAIVSGLAYLLLRLSTVECLTSLADGLAYYALC* |
| Ga0126378_113209601 | 3300010361 | Tropical Forest Soil | SRSFGPSVIVSGSAYLLLRLSVLECLTSLADSLTYYALC* |
| Ga0126377_115365701 | 3300010362 | Tropical Forest Soil | PTCHSHSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC* |
| Ga0134128_108269122 | 3300010373 | Terrestrial Soil | PSAIVPGSAYLLLRLSALECLTSFADVMAYYAVC* |
| Ga0134127_128086141 | 3300010399 | Terrestrial Soil | RPFGPSVLVSGSAYLLLRLSALECLTSLADGLTYYALC* |
| Ga0134121_124856331 | 3300010401 | Terrestrial Soil | PTCHSQSFGPSAIVSGLAYPGLRLSALECLTSRADGVTYYAVC* |
| Ga0137020_1002883 | 3300010408 | Soil | APPRPSTIVPGSAYPLLRLSALECLTSLADGVAYYAVC* |
| Ga0138555_10627941 | 3300011075 | Peatlands Soil | SLGPSVTVPGSAYLFLHLSVSECLTNLADDMTYYALC* |
| Ga0137423_12613651 | 3300011430 | Soil | GPSYLVSGSAYPLLRLSALECLTSLTDVRSYYALC* |
| Ga0137388_120184341 | 3300012189 | Vadose Zone Soil | SMSYSPLLSFGSSITVPGSTYLLLHLSVLECLTSFADDVIYYTLC* |
| Ga0137399_115899802 | 3300012203 | Vadose Zone Soil | MSYSPLLSFGSSITVPGSAYLLLHLSVLECLASFADDVIYYTLC* |
| Ga0137362_112652091 | 3300012205 | Vadose Zone Soil | PSPTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLTYYALC* |
| Ga0137362_117716711 | 3300012205 | Vadose Zone Soil | VASPTCHSQSFGPSALVSGSAYLLLRLLALDCLTSLADGWTYYALF* |
| Ga0137384_111928191 | 3300012357 | Vadose Zone Soil | LLFGPSDTVPGSAYLLLHLSALECLTSFADDMTYYALC* |
| Ga0137385_106507982 | 3300012359 | Vadose Zone Soil | YSPCGVPFGPSIIVPGLAYLLLRLSALERLTSLADCITYFALC* |
| Ga0157342_10728572 | 3300012507 | Arabidopsis Rhizosphere | SRSFGPSVLVSGSAYLLLRLSALECLTSLADGRTYYALC* |
| Ga0137358_108127751 | 3300012582 | Vadose Zone Soil | ASPTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0137395_111126561 | 3300012917 | Vadose Zone Soil | VANPTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC* |
| Ga0137359_116655711 | 3300012923 | Vadose Zone Soil | PSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC* |
| Ga0157372_118987901 | 3300013307 | Corn Rhizosphere | CHFRSFGPSVIVSGSAYPGLRLSALECLTSRADGVTYYAVC* |
| Ga0163163_111383791 | 3300014325 | Switchgrass Rhizosphere | GPSVIVSGLAYPGLRLSALECLTSRADSLTYYAVC* |
| Ga0134073_102535201 | 3300015356 | Grasslands Soil | PFGPSVFIPGLAYLLLRLSALECLTSFADVMTYSALC* |
| Ga0132255_1063320761 | 3300015374 | Arabidopsis Rhizosphere | PICHFQSFGPSVIVPGSAYPLLRLSALECLTSLTDSITYYALC* |
| Ga0182036_100653213 | 3300016270 | Soil | SFGPSAIVSGSAYLLLRLSALECLTSLADGLTYYVCFGVED |
| Ga0182037_114823681 | 3300016404 | Soil | FGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0187801_100620222 | 3300017933 | Freshwater Sediment | FGPSIIVPSSAYLLLRLSALECLTSLADCMTYLALC |
| Ga0187804_102741241 | 3300018006 | Freshwater Sediment | MSYSPLLSFGSSITVPGSAYLLLHLSVLECLTSFADDVIYYTLC |
| Ga0184634_100269931 | 3300018031 | Groundwater Sediment | SPTCRSQSFGPSAIVSGSTYPLLRLSALECLNSLADSLTYYAVC |
| Ga0187768_11506131 | 3300020150 | Tropical Peatland | HSQSFRPSALVPGSAYLFLRLSALECLTSLADCLA |
| Ga0210407_100603755 | 3300020579 | Soil | SPTCRSQSFGPSVIVSGSAYLLLRLSALECLTSLADGLTYYTLC |
| Ga0210378_100780241 | 3300021073 | Groundwater Sediment | SQSLRRGTSHSSSFGPSVLVPGSAYLLLRLSALECLTSFADVRTYYALC |
| Ga0210405_111661091 | 3300021171 | Soil | RSMSYSPLLSFGSSITVPGSAYLLLHLSVLECLTSFADVMIYYTLC |
| Ga0179583_10598091 | 3300021286 | Vadose Zone Soil | SPTCHSQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0179585_10745061 | 3300021307 | Vadose Zone Soil | PACHSQSFGPSAIVSGLAYLLLRLSALECLTSLADGLT |
| Ga0210393_109828731 | 3300021401 | Soil | RSRSFGPSVLVSGSAYLLLRLSALECLTSLADDRAYYALC |
| Ga0210384_116116541 | 3300021432 | Soil | SFGPSAIVPGSAYLLLRLSALECLTSFADVMAYYAVC |
| Ga0210390_100632363 | 3300021474 | Soil | HSQSFGPSAIVPGSAYPLLRLSALECLTSLADGVAYYAVC |
| Ga0242648_10222381 | 3300022506 | Soil | SFGPSAIVPGSAYPLLRLSALECLTSLADGLAYYAVC |
| Ga0242659_10629851 | 3300022522 | Soil | LLSFGSSITVPGSTYLLLHLSVLECLTSFADDVIYYTLC |
| Ga0242654_104503421 | 3300022726 | Soil | LPLLSFGPSTIVSGSAYLLLRLSTLECLTSLADDMA |
| Ga0137417_14995531 | 3300024330 | Vadose Zone Soil | MSYSPLLSFGSSITVPGSAYLLLHLSVLECLASFADDVIYYTLC |
| Ga0209980_100239721 | 3300024516 | Deep Subsurface | CHSRSFGPSAIVPGSAYPLLRLSALECLTSLADGMTYYALC |
| Ga0209507_12119461 | 3300025706 | Anaerobic Digestor Sludge | RRFGPSIIVTGSAYLFPRLSALRCLISLTDDMIYYGLG |
| Ga0209567_106223401 | 3300025895 | Pelagic Marine | SPTCHSQSFGPSSIVTGSAYLLLRLSASECLNSLADSMGYYALC |
| Ga0207707_100723724 | 3300025912 | Corn Rhizosphere | GPSITVPGLAYLLTPSFDVECLTSLADCVTYYALC |
| Ga0207693_102595321 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SPTCHSQSFGPSAIVPGSAYLLLRLSALECLTSFADVMAYYAVC |
| Ga0207700_116456361 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GPSALVPGSAYLLLRLSALECLTSLADVLAYYAVC |
| Ga0207664_103433822 | 3300025929 | Agricultural Soil | SQSFGPSALVPGSAYLLLRLSALECLTSLADVLAYYAVC |
| Ga0210129_10237351 | 3300026026 | Natural And Restored Wetlands | SNAFSLLVSGSAYLLLCLSALECLTCLACHKTYYAFC |
| Ga0257180_10021061 | 3300026354 | Soil | SFGPSALVPGSAYLLLRLSALECLTSLADVLAYYAVC |
| Ga0207728_1018653 | 3300026833 | Tropical Forest Soil | SFGPLAIVPGSAYLLLRLSALECLTSLADDLAYYALC |
| Ga0207762_10084361 | 3300027063 | Tropical Forest Soil | CRSHSFGPLAIVPGSAYLLLRLSALECLTSLADDLAYYALC |
| Ga0208099_10016401 | 3300027096 | Forest Soil | FGPSIIVPGVAYLFLRLSALECLNSPADCMTYLALC |
| Ga0209215_10070233 | 3300027266 | Forest Soil | FGPSALVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0209523_10106103 | 3300027548 | Forest Soil | CHSQSFGPSALVPGSAYPLLHLSALECLTSLADGLAYYAVC |
| Ga0208988_11754371 | 3300027633 | Forest Soil | PICHSQSFGPSVIVPGSAYLLLRLSALECLTSLADGLAYYAVC |
| Ga0209011_10544672 | 3300027678 | Forest Soil | FGPWAIVSGSAYLLLHLSALECLTSLADSLTYYAFC |
| Ga0209073_105005391 | 3300027765 | Agricultural Soil | LYSPCGVPFGPSITVPGSAYLFLRLSALECLNSFADCLTYFALC |
| Ga0209448_100475372 | 3300027783 | Bog Forest Soil | GPSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC |
| (restricted) Ga0255053_101172211 | 3300027868 | Seawater | GPSTLVPGLAYLLLRLSALECLTSLTDGMAYYALC |
| Ga0209698_113314032 | 3300027911 | Watersheds | YSPCGVPFGPSITVPGLAYRLLRLSALECLNILADGMTYFALC |
| Ga0302266_102042033 | 3300028779 | Bog | LPFGPSSTVPGSAYLLLRLSALECLNSLADDMNYFARC |
| Ga0307503_106945142 | 3300028802 | Soil | FSLEPSVLVSGPAYPLLRLSAVECLTSLADFRTYYALC |
| Ga0308309_115772671 | 3300028906 | Soil | SPTCRSQSFGPSATVPGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0311341_106728511 | 3300029908 | Bog | SQSFGPSALVPGSAYLFLRLSALECLNSLADCLAYYALC |
| Ga0075390_112184111 | 3300030947 | Soil | PTCHSQSFGPSAIVPGSAYPLLRLSALECLTSLADGLAYYAVC |
| Ga0075394_121043632 | 3300030969 | Soil | PTCHSQSFGPSAIVSGLAYLLLRFSALECLTSLADGLT |
| Ga0302307_106388711 | 3300031233 | Palsa | PFGPSIIVPGLAYLFLHLSALECLIILGDCMTYFALC |
| Ga0170820_105005291 | 3300031446 | Forest Soil | YSPLLSFGSSITVPGSTYLLLHLSVLECLTSFADDVIYYTLC |
| Ga0318516_101639202 | 3300031543 | Soil | GPLAIVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0318516_107482291 | 3300031543 | Soil | GPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0318528_102245021 | 3300031561 | Soil | SHSQSFGPSAIVSGSAYLLLRLSAVECLTSLADSLT |
| Ga0318528_103064271 | 3300031561 | Soil | SPFGVPFGPSIPVPGSAYPLLHLSVLECLTNLADVRIYFALC |
| Ga0310915_109726282 | 3300031573 | Soil | MSYSPLLSFGSSITVPGSTYLLLHLSVLECLTSFADDVIY |
| Ga0307480_10206821 | 3300031677 | Hardwood Forest Soil | SQSFGPSAIVSGSAYLVLRLSAVECLTSLADATAYYAVC |
| Ga0307469_100734681 | 3300031720 | Hardwood Forest Soil | QSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAFC |
| Ga0307477_105009422 | 3300031753 | Hardwood Forest Soil | SFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALS |
| Ga0307477_110489851 | 3300031753 | Hardwood Forest Soil | RSRSFGPSVLVSGLTYLLLRLSALECLNSLADGWT |
| Ga0318547_106492872 | 3300031781 | Soil | SQSFGPSAIVSGSAYPLLRLSALECLTSLADGLAYYAVC |
| Ga0318565_103537791 | 3300031799 | Soil | CHSPSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC |
| Ga0318499_103266881 | 3300031832 | Soil | YWPPFSFGPSATVSGSTYLLLHLSVPECLTSLTDVMTYYAVC |
| Ga0310904_101123962 | 3300031854 | Soil | CHFQSFGPSVIVSGLAYPGLRLSALECLTSRADGLTYYAVC |
| Ga0306919_111960561 | 3300031879 | Soil | HSQSFGPSAIVSGLAYLLLRLSALECLTSLADGLAYYAVC |
| Ga0318551_109240732 | 3300031896 | Soil | NPTCLSQSFGPSAIVSSSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0306923_1006297610 | 3300031910 | Soil | TCHSQSFGPSAIVSGLAYLLLRPSALECLTSLADGLAYYAVC |
| Ga0306923_119115481 | 3300031910 | Soil | MSYWPLLSFGPSATVPARPIRCPRLSALECLTSLADDMTYY |
| Ga0306923_119364131 | 3300031910 | Soil | ASPTCHSHSFGPSALVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0310910_112585901 | 3300031946 | Soil | SPTCHSQSFGPSAIVSGLAYLLLRLSALECLTSLADGLAYYAVC |
| Ga0318563_105317012 | 3300032009 | Soil | SHSFGPSAIVSGSAYLLLRLSALECLTSLADGLTYYVCFGVED |
| Ga0318575_100589641 | 3300032055 | Soil | SHSFGPSAIVSDLAYPLLRLSALECLTSFADSMTYYALC |
| Ga0318575_106874521 | 3300032055 | Soil | QSFGPSVLVSGSTYLLLRLSALECLTSLADGLTYYALC |
| Ga0318533_103526851 | 3300032059 | Soil | PTHLSFSFGPSATVPGSAYPFLRLSALECLTSFADGVTYYALC |
| Ga0318504_101772791 | 3300032063 | Soil | ASPTCHSPSFGPSAIVSSSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0318504_102760512 | 3300032063 | Soil | LCLSHSFGPSAIVSDLAYPLLRLSALECLTSFADSMTYYALC |
| Ga0306924_116806021 | 3300032076 | Soil | GPSIPVTGSAYLFLRLSALECLTSLTDDMAYYALC |
| Ga0306924_124128971 | 3300032076 | Soil | HSQSFGPSTLVPGSAYLFLRLSALECLISLADCLA |
| Ga0315295_107534171 | 3300032156 | Sediment | HSQSFGPSSVAGGVAYPLLRLSALQCLTSFADDTDYYALC |
| Ga0306920_1004268241 | 3300032261 | Soil | ANPTCLFQSFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0306920_1007368761 | 3300032261 | Soil | FGPSAIVSGSAYLLLRLSALECLTSLADGLAYYAVC |
| Ga0335076_116609341 | 3300032955 | Soil | SRSFGPSVLVSGSTYLLLRLSALECLTSLADGMTYYALC |
| Ga0318519_101198073 | 3300033290 | Soil | SFGPSAIVSGSAYLLLRLSALECLTSLADGLAYYALC |
| Ga0364938_000861_1_114 | 3300034114 | Sediment | SFGPSAIVTGSAYLLLRLSASECLTSFADDMTYYALC |
| ⦗Top⦘ |