


| Basic Information | |
|---|---|
| Family ID | F045980 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.63 % |
| % of genes near scaffold ends (potentially truncated) | 90.79 % |
| % of genes from short scaffolds (< 2000 bps) | 80.26 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (49.342 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.816 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (76.974 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF13088 | BNR_2 | 6.58 |
| PF01145 | Band_7 | 3.29 |
| PF05943 | VipB | 0.66 |
| PF13470 | PIN_3 | 0.66 |
| PF04471 | Mrr_cat | 0.66 |
| PF04984 | Phage_sheath_1 | 0.66 |
| PF00873 | ACR_tran | 0.66 |
| PF14464 | Prok-JAB | 0.66 |
| PF00962 | A_deaminase | 0.66 |
| PF09278 | MerR-DNA-bind | 0.66 |
| PF02472 | ExbD | 0.66 |
| PF02348 | CTP_transf_3 | 0.66 |
| PF07681 | DoxX | 0.66 |
| PF02441 | Flavoprotein | 0.66 |
| PF05137 | PilN | 0.66 |
| PF03544 | TonB_C | 0.66 |
| PF07075 | DUF1343 | 0.66 |
| PF07978 | NIPSNAP | 0.66 |
| PF04686 | SsgA | 0.66 |
| PF13288 | DXPR_C | 0.66 |
| PF00749 | tRNA-synt_1c | 0.66 |
| PF00144 | Beta-lactamase | 0.66 |
| PF03965 | Penicillinase_R | 0.66 |
| PF01258 | zf-dskA_traR | 0.66 |
| PF02417 | Chromate_transp | 0.66 |
| PF00296 | Bac_luciferase | 0.66 |
| PF07676 | PD40 | 0.66 |
| PF00166 | Cpn10 | 0.66 |
| PF08352 | oligo_HPY | 0.66 |
| PF02082 | Rrf2 | 0.66 |
| PF05345 | He_PIG | 0.66 |
| PF00291 | PALP | 0.66 |
| PF07690 | MFS_1 | 0.66 |
| PF00083 | Sugar_tr | 0.66 |
| PF04185 | Phosphoesterase | 0.66 |
| PF03466 | LysR_substrate | 0.66 |
| PF01039 | Carboxyl_trans | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG3166 | Type IV pilus assembly protein PilN | Cell motility [N] | 1.32 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.66 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.66 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.66 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.66 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.66 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.66 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.66 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.66 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.66 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.66 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.66 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.66 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.66 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.66 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.66 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.66 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.66 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.66 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.66 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.66 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.66 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG3517 | Predicted component TssB of the type VI protein secretion system, VipA/VipB/TssB family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.66 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.66 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.66 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.66 % |
| Unclassified | root | N/A | 49.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001082|JGI12664J13189_1000529 | All Organisms → cellular organisms → Bacteria | 5391 | Open in IMG/M |
| 3300001154|JGI12636J13339_1000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7123 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100412397 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101497434 | Not Available | 570 | Open in IMG/M |
| 3300004092|Ga0062389_102708825 | Not Available | 661 | Open in IMG/M |
| 3300004476|Ga0068966_1095001 | Not Available | 604 | Open in IMG/M |
| 3300005454|Ga0066687_10883829 | Not Available | 532 | Open in IMG/M |
| 3300005529|Ga0070741_10107007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2943 | Open in IMG/M |
| 3300005534|Ga0070735_10038950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 3231 | Open in IMG/M |
| 3300005542|Ga0070732_10025006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3380 | Open in IMG/M |
| 3300005554|Ga0066661_10784801 | Not Available | 557 | Open in IMG/M |
| 3300005560|Ga0066670_10213488 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005712|Ga0070764_10000156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 23569 | Open in IMG/M |
| 3300005764|Ga0066903_100009650 | All Organisms → cellular organisms → Bacteria | 9106 | Open in IMG/M |
| 3300005764|Ga0066903_102475555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300005921|Ga0070766_10245289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1134 | Open in IMG/M |
| 3300006050|Ga0075028_100032482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2402 | Open in IMG/M |
| 3300006050|Ga0075028_100834843 | Not Available | 563 | Open in IMG/M |
| 3300006172|Ga0075018_10349837 | Not Available | 740 | Open in IMG/M |
| 3300006173|Ga0070716_100930816 | Not Available | 683 | Open in IMG/M |
| 3300006176|Ga0070765_100008003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 7195 | Open in IMG/M |
| 3300006176|Ga0070765_101572476 | Not Available | 618 | Open in IMG/M |
| 3300006852|Ga0075433_10002035 | All Organisms → cellular organisms → Bacteria | 15272 | Open in IMG/M |
| 3300006903|Ga0075426_10074928 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
| 3300007982|Ga0102924_1162974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300009038|Ga0099829_10835183 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009090|Ga0099827_10536887 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300009523|Ga0116221_1220190 | Not Available | 821 | Open in IMG/M |
| 3300009524|Ga0116225_1031012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2655 | Open in IMG/M |
| 3300009698|Ga0116216_10026768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3601 | Open in IMG/M |
| 3300009824|Ga0116219_10000268 | All Organisms → cellular organisms → Bacteria | 55195 | Open in IMG/M |
| 3300009824|Ga0116219_10109641 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300009824|Ga0116219_10559614 | Not Available | 630 | Open in IMG/M |
| 3300009839|Ga0116223_10029452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3744 | Open in IMG/M |
| 3300010076|Ga0127430_134909 | Not Available | 608 | Open in IMG/M |
| 3300010126|Ga0127482_1110897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300010326|Ga0134065_10513401 | Not Available | 501 | Open in IMG/M |
| 3300010379|Ga0136449_100050917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9314 | Open in IMG/M |
| 3300010379|Ga0136449_100123626 | All Organisms → cellular organisms → Bacteria | 5187 | Open in IMG/M |
| 3300010379|Ga0136449_100148042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4617 | Open in IMG/M |
| 3300010379|Ga0136449_101582691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 997 | Open in IMG/M |
| 3300010379|Ga0136449_103082636 | Not Available | 648 | Open in IMG/M |
| 3300012198|Ga0137364_11420962 | Not Available | 513 | Open in IMG/M |
| 3300012200|Ga0137382_10735545 | Not Available | 708 | Open in IMG/M |
| 3300012209|Ga0137379_10119777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2531 | Open in IMG/M |
| 3300012212|Ga0150985_122418599 | Not Available | 660 | Open in IMG/M |
| 3300012375|Ga0134034_1209536 | Not Available | 512 | Open in IMG/M |
| 3300012410|Ga0134060_1359962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 926 | Open in IMG/M |
| 3300012923|Ga0137359_10918041 | Not Available | 754 | Open in IMG/M |
| 3300014657|Ga0181522_10059465 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
| 3300014657|Ga0181522_10529433 | Not Available | 711 | Open in IMG/M |
| 3300016705|Ga0181507_1386043 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 712 | Open in IMG/M |
| 3300017927|Ga0187824_10346650 | Not Available | 535 | Open in IMG/M |
| 3300017948|Ga0187847_10542530 | Not Available | 647 | Open in IMG/M |
| 3300017955|Ga0187817_10197360 | Not Available | 1283 | Open in IMG/M |
| 3300017959|Ga0187779_11152447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 543 | Open in IMG/M |
| 3300017966|Ga0187776_10973592 | Not Available | 621 | Open in IMG/M |
| 3300017995|Ga0187816_10074917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
| 3300018007|Ga0187805_10277420 | Not Available | 770 | Open in IMG/M |
| 3300018009|Ga0187884_10251679 | Not Available | 719 | Open in IMG/M |
| 3300018085|Ga0187772_10746375 | Not Available | 704 | Open in IMG/M |
| 3300018088|Ga0187771_10108503 | Not Available | 2246 | Open in IMG/M |
| 3300019161|Ga0184602_117509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 631 | Open in IMG/M |
| 3300019163|Ga0184581_106221 | Not Available | 1259 | Open in IMG/M |
| 3300019268|Ga0181514_1509434 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida | 1156 | Open in IMG/M |
| 3300019786|Ga0182025_1357765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300020580|Ga0210403_10741773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300020580|Ga0210403_10892916 | Not Available | 701 | Open in IMG/M |
| 3300020581|Ga0210399_10029427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4383 | Open in IMG/M |
| 3300020582|Ga0210395_11186006 | Not Available | 561 | Open in IMG/M |
| 3300021088|Ga0210404_10183489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300021170|Ga0210400_10446129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300021170|Ga0210400_11236890 | Not Available | 600 | Open in IMG/M |
| 3300021180|Ga0210396_10083078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2906 | Open in IMG/M |
| 3300021405|Ga0210387_10892797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 782 | Open in IMG/M |
| 3300021405|Ga0210387_11705980 | Not Available | 533 | Open in IMG/M |
| 3300021407|Ga0210383_10306466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
| 3300021479|Ga0210410_10010275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces acidiscabies | 8076 | Open in IMG/M |
| 3300021559|Ga0210409_10293531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1466 | Open in IMG/M |
| 3300021559|Ga0210409_10499928 | Not Available | 1079 | Open in IMG/M |
| 3300022502|Ga0242646_1039866 | Not Available | 507 | Open in IMG/M |
| 3300022503|Ga0242650_1016128 | Not Available | 592 | Open in IMG/M |
| 3300022503|Ga0242650_1026144 | Not Available | 509 | Open in IMG/M |
| 3300022504|Ga0242642_1019065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300022504|Ga0242642_1054736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300022504|Ga0242642_1062588 | Not Available | 599 | Open in IMG/M |
| 3300022505|Ga0242647_1012415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 781 | Open in IMG/M |
| 3300022508|Ga0222728_1101214 | Not Available | 546 | Open in IMG/M |
| 3300022509|Ga0242649_1021938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300022510|Ga0242652_1017534 | Not Available | 744 | Open in IMG/M |
| 3300022513|Ga0242667_1059030 | Not Available | 504 | Open in IMG/M |
| 3300022522|Ga0242659_1073145 | Not Available | 641 | Open in IMG/M |
| 3300022523|Ga0242663_1048353 | Not Available | 742 | Open in IMG/M |
| 3300022523|Ga0242663_1073311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300022525|Ga0242656_1061253 | All Organisms → cellular organisms → Eukaryota | 672 | Open in IMG/M |
| 3300022525|Ga0242656_1090619 | Not Available | 586 | Open in IMG/M |
| 3300022527|Ga0242664_1010306 | Not Available | 1301 | Open in IMG/M |
| 3300022527|Ga0242664_1052650 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300022527|Ga0242664_1055616 | Not Available | 733 | Open in IMG/M |
| 3300022528|Ga0242669_1066872 | Not Available | 644 | Open in IMG/M |
| 3300022528|Ga0242669_1122328 | Not Available | 524 | Open in IMG/M |
| 3300022529|Ga0242668_1095766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 596 | Open in IMG/M |
| 3300022530|Ga0242658_1174453 | Not Available | 570 | Open in IMG/M |
| 3300022530|Ga0242658_1212464 | Not Available | 531 | Open in IMG/M |
| 3300022531|Ga0242660_1192472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300022532|Ga0242655_10153213 | Not Available | 677 | Open in IMG/M |
| 3300022532|Ga0242655_10304046 | Not Available | 520 | Open in IMG/M |
| 3300022533|Ga0242662_10151790 | Not Available | 701 | Open in IMG/M |
| 3300022715|Ga0242678_1003784 | Not Available | 1358 | Open in IMG/M |
| 3300022715|Ga0242678_1028357 | Not Available | 724 | Open in IMG/M |
| 3300022716|Ga0242673_1000557 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
| 3300022716|Ga0242673_1024039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
| 3300022717|Ga0242661_1022894 | Not Available | 1022 | Open in IMG/M |
| 3300022717|Ga0242661_1056384 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300022717|Ga0242661_1070880 | Not Available | 686 | Open in IMG/M |
| 3300022717|Ga0242661_1152872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300022717|Ga0242661_1169444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 500 | Open in IMG/M |
| 3300022722|Ga0242657_1005590 | Not Available | 1907 | Open in IMG/M |
| 3300022722|Ga0242657_1169199 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300022722|Ga0242657_1203060 | Not Available | 549 | Open in IMG/M |
| 3300022724|Ga0242665_10050052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1108 | Open in IMG/M |
| 3300022726|Ga0242654_10018219 | Not Available | 1680 | Open in IMG/M |
| 3300023660|Ga0247550_102483 | Not Available | 631 | Open in IMG/M |
| 3300023672|Ga0247553_101953 | Not Available | 921 | Open in IMG/M |
| 3300026330|Ga0209473_1114818 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300027094|Ga0208094_104567 | Not Available | 662 | Open in IMG/M |
| 3300027548|Ga0209523_1034292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1023 | Open in IMG/M |
| 3300027879|Ga0209169_10038516 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300028906|Ga0308309_10099053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2250 | Open in IMG/M |
| 3300029636|Ga0222749_10006436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4791 | Open in IMG/M |
| 3300029701|Ga0222748_1119904 | Not Available | 530 | Open in IMG/M |
| 3300030659|Ga0316363_10063563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1715 | Open in IMG/M |
| 3300030707|Ga0310038_10004535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9854 | Open in IMG/M |
| 3300030813|Ga0265750_1056889 | Not Available | 605 | Open in IMG/M |
| 3300030836|Ga0265767_113316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 576 | Open in IMG/M |
| 3300030873|Ga0265751_104669 | Not Available | 774 | Open in IMG/M |
| 3300030888|Ga0265769_101333 | Not Available | 1163 | Open in IMG/M |
| 3300030888|Ga0265769_118367 | Not Available | 541 | Open in IMG/M |
| 3300030942|Ga0247549_103778 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 573 | Open in IMG/M |
| 3300031017|Ga0265744_113500 | Not Available | 533 | Open in IMG/M |
| 3300031817|Ga0316046_104824 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300031817|Ga0316046_107635 | Not Available | 620 | Open in IMG/M |
| 3300032051|Ga0318532_10319376 | Not Available | 551 | Open in IMG/M |
| 3300032072|Ga0326631_111333 | Not Available | 596 | Open in IMG/M |
| 3300032120|Ga0316053_114312 | Not Available | 583 | Open in IMG/M |
| 3300032160|Ga0311301_10249041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2934 | Open in IMG/M |
| 3300032160|Ga0311301_10688017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1442 | Open in IMG/M |
| 3300032205|Ga0307472_100337101 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300032515|Ga0348332_12782862 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Marasmius → Marasmius oreades | 1122 | Open in IMG/M |
| 3300032515|Ga0348332_13081431 | Not Available | 932 | Open in IMG/M |
| 3300032892|Ga0335081_10437006 | Not Available | 1669 | Open in IMG/M |
| 3300032892|Ga0335081_10719505 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.32% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010076 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019163 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022503 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027094 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF022 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030873 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031817 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12664J13189_10005297 | 3300001082 | Forest Soil | LRTAITDPRLGSGLTANRKNLLNASGLYPAFDMMFLFTSTSALL* |
| JGI12636J13339_10004073 | 3300001154 | Forest Soil | LGSGLTANRINQFNASELYPAFGMMFLFASTSALL* |
| JGIcombinedJ26739_1004123971 | 3300002245 | Forest Soil | AACDLRSGSGLTANRKNLPNASELYPAFDIFLFSSTSALL* |
| JGIcombinedJ26739_1014974342 | 3300002245 | Forest Soil | LRTAITDPRLGSGLTANRINLVNASGLYPAFDMMFGFASTSALL* |
| Ga0062389_1027088251 | 3300004092 | Bog Forest Soil | LRMATRDLCSGSGLTANRINLFNASGLYLAFDIVFSFASTSTLL* |
| Ga0068966_10950011 | 3300004476 | Peatlands Soil | SLAGATSDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL* |
| Ga0066687_108838292 | 3300005454 | Soil | TRDPCSGSGLTANRINLLNASGLYPAFDMMFLFASTSTWL* |
| Ga0070741_101070071 | 3300005529 | Surface Soil | TRDQGSGSGLTANRTNQRNASGLYLAFDGPFLFSSTSALL* |
| Ga0070735_100389504 | 3300005534 | Surface Soil | LRTAVTDPCLGSGLTANRINLLNASGLYPAFDMVFLFASTSALL* |
| Ga0070732_100250061 | 3300005542 | Surface Soil | LRTAVTDPCLGSGLTANRINLLNASGLYPAFDMMFWFASTSALL* |
| Ga0066661_107848012 | 3300005554 | Soil | DLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0066670_102134881 | 3300005560 | Soil | TSPLSLAGATSDLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0070764_1000015613 | 3300005712 | Soil | MRCCDCCSGSGLTANRINQFNASGLYLAFDVMFLFASTSTWL* |
| Ga0066903_1000096502 | 3300005764 | Tropical Forest Soil | LGSGLTANRKNLFNASGPYLAFDIVLLFASTSTLL* |
| Ga0066903_1024755553 | 3300005764 | Tropical Forest Soil | LGSGLTANRINQFNASGLYLALDVSPLFSSASALL* |
| Ga0070766_102452893 | 3300005921 | Soil | MVAILADATTDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL* |
| Ga0075028_1000324822 | 3300006050 | Watersheds | LAASLAGATSDPCLGSGLTANRINQFNASGLYPAFGMMFLFASTSALL* |
| Ga0075028_1008348431 | 3300006050 | Watersheds | SLAGATSDPCLGSGLTANRINQFNASGLYLAFDMMFMFASTSALL* |
| Ga0075018_103498372 | 3300006172 | Watersheds | DLAASLAGATSDPCLGSGLTANRINQFNASGLYLAFDMMFLFASTSALL* |
| Ga0070716_1009308161 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GSGLTANRINQSNASGLYLAFDRSLLFSSASALL* |
| Ga0070765_1000080031 | 3300006176 | Soil | RTATTDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTGALL* |
| Ga0070765_1015724761 | 3300006176 | Soil | ASLAGATSDPCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL* |
| Ga0075433_100020355 | 3300006852 | Populus Rhizosphere | MLPYGCATRDLCLGSGLTANRKNSFNASGLYLAFDMMFLFASTSALL* |
| Ga0075426_100749281 | 3300006903 | Populus Rhizosphere | FRSGSGLTANRVNLCNASGLIAFQQVFLFASTSALL* |
| Ga0102924_11629742 | 3300007982 | Iron-Sulfur Acid Spring | SLRTAITDPCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL* |
| Ga0099829_108351832 | 3300009038 | Vadose Zone Soil | CLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0099827_105368871 | 3300009090 | Vadose Zone Soil | GSGLTANRINQLNASGLYPAFDGFFLFASTSILL* |
| Ga0116221_12201902 | 3300009523 | Peatlands Soil | AGATSDLCLGSGLTANRINLLNASGLYPAFDMMFLFASTSALL* |
| Ga0116225_10310121 | 3300009524 | Peatlands Soil | CLGSGLTANRINQFNASGLYPAFDVMFLFASTSALL* |
| Ga0116216_100267683 | 3300009698 | Peatlands Soil | CLGSGLTANRINQFNASGLYPAFDMMFSFASTSALL* |
| Ga0116219_1000026841 | 3300009824 | Peatlands Soil | ATSDPCLGSGLTANRINQFNASGLYPAFDVMFLFASTSALL* |
| Ga0116219_101096413 | 3300009824 | Peatlands Soil | MLRCCDCCSGSGLTANRINQFNASGLYLAFDVMFLFASTSA |
| Ga0116219_105596142 | 3300009824 | Peatlands Soil | CLGSGLTANRINLLNASGLYPAFDMMFLFASTSALL* |
| Ga0116223_100294523 | 3300009839 | Peatlands Soil | MLRCCDCCSGSGLTANRINQFNASGLYLAFDMMFLFASTSAWL* |
| Ga0127430_1349091 | 3300010076 | Grasslands Soil | ATSDLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0127482_11108971 | 3300010126 | Grasslands Soil | TSDLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSALL* |
| Ga0134065_105134011 | 3300010326 | Grasslands Soil | TRDLCLGSGLTANRKNSVNASGLYLAFDMMFLFASTSA* |
| Ga0136449_1000509171 | 3300010379 | Peatlands Soil | MLRCCDCCSGSGLTANRINQFNASGLYLAFDVMFLFASTSAWL |
| Ga0136449_1001236261 | 3300010379 | Peatlands Soil | MLRCCDFCSGSGLTANRINQFNASGLYLAFDMMFLFASTSAWL* |
| Ga0136449_1001480424 | 3300010379 | Peatlands Soil | LGSGLTANRKNLLNASGLYPAFDMMFWFASTSALL* |
| Ga0136449_1015826913 | 3300010379 | Peatlands Soil | RCCDCCSGSGLTANRINQFNASGLYLAFDVMFLFASTSAWL* |
| Ga0136449_1030826361 | 3300010379 | Peatlands Soil | RDRGSGSGLTANRINQLNASGLYLAFNSSPLFISTSALL* |
| Ga0137364_114209621 | 3300012198 | Vadose Zone Soil | GATSDLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0137382_107355451 | 3300012200 | Vadose Zone Soil | TLADLTSPLSLAGATSDLCLGSGLTANRINQFNASGLYPASDIVFLFASTSAWL* |
| Ga0137379_101197771 | 3300012209 | Vadose Zone Soil | LRVAARDPCSGSGLTANRINQFNASGLYPAFDIVFLF |
| Ga0150985_1224185992 | 3300012212 | Avena Fatua Rhizosphere | MPVTANWKNQSNASGLYLAFDMMFSFASTSALLFR |
| Ga0134034_12095362 | 3300012375 | Grasslands Soil | NSTRDLCLGSGLTANRKNSVNASGLYLAFDMMFLFASTSA* |
| Ga0134060_13599621 | 3300012410 | Grasslands Soil | MTVWSNSGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0137359_109180412 | 3300012923 | Vadose Zone Soil | PLSLAGATSDLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL* |
| Ga0181522_100594653 | 3300014657 | Bog | RLGSGLTANRKNQFDASGLYPAFDLVFWFTSTSALL* |
| Ga0181522_105294331 | 3300014657 | Bog | SLRTAITDPCLGSGLTANRKNLLNASGLYPAFDMMFLFASTSALL* |
| Ga0181507_13860432 | 3300016705 | Peatland | PCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL |
| Ga0187824_103466501 | 3300017927 | Freshwater Sediment | SGSGLTANRTNQCNASGLYLAFDGPFLFSSTSAWL |
| Ga0187847_105425302 | 3300017948 | Peatland | LGSGLTANRKNLLNASGLYPAFDMMFLFASTSALL |
| Ga0187817_101973602 | 3300017955 | Freshwater Sediment | RTAITDPCLGSGLTANRINQFNASGLYPDFDMMFLFASTSALL |
| Ga0187779_111524471 | 3300017959 | Tropical Peatland | LCPCEAALRDLCLGSGLTANRINLPHASELYLAFNRSSLFSSTSALL |
| Ga0187776_109735922 | 3300017966 | Tropical Peatland | DLCSGSGLTANRINQFNASGLYPAFDMMFLFASTSTLL |
| Ga0187816_100749173 | 3300017995 | Freshwater Sediment | DLCLGSGLTANRINQLNASGLYPAFDMMFLFASTSALL |
| Ga0187805_102774202 | 3300018007 | Freshwater Sediment | LLSLRTAITDPCLGSGLTANRINQFNASGLYPAFDMMFWFASTSALL |
| Ga0187884_102516791 | 3300018009 | Peatland | DPCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL |
| Ga0187772_107463752 | 3300018085 | Tropical Peatland | DCHSGSGLTANRINQFNASGLYLAFDMVFLFASTSAWL |
| Ga0187771_101085032 | 3300018088 | Tropical Peatland | IVCSGSGLTANRINQFNASGLYPAFDMMFLFASTSAWL |
| Ga0184602_1175091 | 3300019161 | Soil | DPCLGSGLTANRINLLNASGLYPAFDMMFLFASTSALL |
| Ga0184581_1062212 | 3300019163 | Soil | AITDPCLGSGLTANRINQFNASGLYPAFGMVFLFASTSALL |
| Ga0181514_15094341 | 3300019268 | Peatland | MAATEVTTESCDLRLGSGLTANRKNQFDASGLYPAFDLVFWFTSTSALL |
| Ga0182025_13577653 | 3300019786 | Permafrost | LLSLRTAITDPRLGSGLTANRINQFNASGLYPAFDMMFGFASTSALL |
| Ga0210403_107417731 | 3300020580 | Soil | TDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0210403_108929161 | 3300020580 | Soil | DLAASLAGATSDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0210399_100294271 | 3300020581 | Soil | SLAGATSDPCLGSGLTANRINQFNASGLYPAFDMVFLFASTSALL |
| Ga0210395_111860061 | 3300020582 | Soil | ITDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0210404_101834892 | 3300021088 | Soil | ARSRLGSGLTANRINQSNASGLYLAFDRSFLFSSTSALL |
| Ga0210400_104461291 | 3300021170 | Soil | DLCLGSGLTANRKNLFNASGLYLAFDMMFVFASTSALL |
| Ga0210400_112368902 | 3300021170 | Soil | ITDPRLGSGLTANRINLVNASGLYPAFDMMFGFASTSALL |
| Ga0210396_100830784 | 3300021180 | Soil | LRTAITDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0210387_108927971 | 3300021405 | Soil | CGVRRCDCCSGSGLTANRINQFNASGLYLAFDRMFTFASTSTWL |
| Ga0210387_117059802 | 3300021405 | Soil | LGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0210383_103064661 | 3300021407 | Soil | SLRTAITDPCLGSGLTANRKNLLNASGLYPAFDMMFLFASTSALL |
| Ga0210410_100102751 | 3300021479 | Soil | GATSDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0210409_102935312 | 3300021559 | Soil | GRWSDLCLGSGLTANRKNLFNASGLYLAFDMMFVFASTSALL |
| Ga0210409_104999282 | 3300021559 | Soil | LGSGLTANRKNLFNASGLYLAFDMMFVFASTSALL |
| Ga0242646_10398661 | 3300022502 | Soil | PCLGSGLTANRINQFNASGLYPAFDVMFLFASTSALL |
| Ga0242650_10161282 | 3300022503 | Soil | GSGSGLTANRINQFNASGLYLAFVRSFLFSSTSALL |
| Ga0242650_10261441 | 3300022503 | Soil | CLGSGLTANRINQFNASGLYPAFDMMFLFASTSTLL |
| Ga0242642_10190651 | 3300022504 | Soil | LRSGSGLTANRINQFNASGLYLAFVRSFLFSSTSALL |
| Ga0242642_10547361 | 3300022504 | Soil | APGDRHSGSGLTANRINQFNASGLYLALDMVFLFASTSAQL |
| Ga0242642_10625881 | 3300022504 | Soil | CLGSGLTANRKNLFNASGLYLAFDMMFVFASTSALL |
| Ga0242647_10124151 | 3300022505 | Soil | MFSLNTRRDLCLGSGLTANRINLPYASELYPAFNISSSFSSTSAL |
| Ga0222728_11012142 | 3300022508 | Soil | LGSGLTANRINQFNASGLYPAFDVMFLFASTSALL |
| Ga0242649_10219383 | 3300022509 | Soil | RTAITDPCLGSGLTANRINLLNASGLYPAFGMMFSFASTSALL |
| Ga0242652_10175341 | 3300022510 | Soil | RHSGSGLTANRKNLFNASGLYLASDMVFMFASTSA |
| Ga0242667_10590301 | 3300022513 | Soil | GRSCSGSGLTANRINQSNASGLYLAFDMMFLFASTSAQL |
| Ga0242659_10731451 | 3300022522 | Soil | LAASLAGATSDPCLGSGLTANRKNLLNASGLYPAFDMMFLFASTSALL |
| Ga0242663_10483532 | 3300022523 | Soil | AGRWSDLCLGYGLTANRKNLFNASGLYLAFDMMFVFASTSALL |
| Ga0242663_10733111 | 3300022523 | Soil | CLGSGLTANRINLLNASGLYPAFDMVFLFASTSALL |
| Ga0242656_10612531 | 3300022525 | Soil | DPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSTLL |
| Ga0242656_10906192 | 3300022525 | Soil | SDLCLGSGLTANRKNLFNAPGLYLASDMMFVFASTSALL |
| Ga0242664_10103061 | 3300022527 | Soil | GPCLGSGLTANRINQFNASGLYPAFDMMFLFASPSALL |
| Ga0242664_10526502 | 3300022527 | Soil | ATTDPCLGSGLTANRINQFNASGLYPAFDIIFSFASTSTLL |
| Ga0242664_10556161 | 3300022527 | Soil | DLAASLAGATSDPCLGSGLTANRINQFNASGLYPAFDMVFLFASTSALL |
| Ga0242669_10668721 | 3300022528 | Soil | LRIAFSHPYARLGSGLTANRKNLLNASGLYPAFDMMFLFASTSA |
| Ga0242669_11223281 | 3300022528 | Soil | LLSLRTAITDPCLGSGLTANRINQFNASGLYPAFDVMFWFASTSALL |
| Ga0242668_10957661 | 3300022529 | Soil | CRPDLAASLAGRWSDLCLGSGLTANRKNLFNASGLYLAFDRMFVFASTSALL |
| Ga0242658_11744531 | 3300022530 | Soil | LSLRTAITDPCLGSGLTANRINQFNASGLYPAFDMVFLFASTSALL |
| Ga0242658_12124642 | 3300022530 | Soil | LRVATRDLDLGSGLTANRINQFNASGLYLAFVRSFLFFSTSA |
| Ga0242660_11924721 | 3300022531 | Soil | AGCNARSGLGSGLTANRINQSNASGLYLAFDRSLLFSSASALL |
| Ga0242655_101532132 | 3300022532 | Soil | TDPCLGSGLTANRINQFNASGLYPAFDMVFLFASTSTLL |
| Ga0242655_103040461 | 3300022532 | Soil | MLLVAACLGSGLTANRINQFNASGLYPAFDMVFLFASTS |
| Ga0242662_101517902 | 3300022533 | Soil | DLDLGSGLTANRINQFNASGLYLAFVRSFLFSSTSA |
| Ga0242678_10037841 | 3300022715 | Soil | CLGSGLTANRINQFNASLLYPAFDWMFLFASTSTLL |
| Ga0242678_10283572 | 3300022715 | Soil | CLGSGLTANRKNQFNASGLYPAFDIMFLFASTSALL |
| Ga0242673_10005571 | 3300022716 | Soil | RSCSGSGLTANRINQSNASGLYLAFDMMFLFASTSAQL |
| Ga0242673_10240392 | 3300022716 | Soil | LGSGLTANRKNQFNASGLYPAFDIMFLFASTSALL |
| Ga0242661_10228942 | 3300022717 | Soil | LGSGLTANRINLVNASGLYPAFDMMFGFASTSALL |
| Ga0242661_10563843 | 3300022717 | Soil | WSDLCLGSGLTANRKNLFNASGLYPAFDMMFGFASTSALL |
| Ga0242661_10708802 | 3300022717 | Soil | SLRTAITDPCLGSGLTANRINQFNASGLYPAFDMVFLFASPSALL |
| Ga0242661_11528721 | 3300022717 | Soil | RSRLGSGLTANRINQFNASGLYLAFVRSFLFSSTSTLL |
| Ga0242661_11694442 | 3300022717 | Soil | SRLGSGLTANRINQFNASGLYLAFVRSFLFSSTSTLL |
| Ga0242657_10055901 | 3300022722 | Soil | LAGCWSDLCLGSGLTANRINLFNASGLYLASDVMFWFASTSALL |
| Ga0242657_11691991 | 3300022722 | Soil | LGSGLTANRINQFNASGLYPAFDMMFGFASTSALL |
| Ga0242657_12030601 | 3300022722 | Soil | MLQRAITDPCLGSGLTANRINQFNASGLYPAFDMMFGFASTS |
| Ga0242665_100500523 | 3300022724 | Soil | RLTSRDRGSGSGLTANRINQLNASGLYLAFNISSLFISTSALL |
| Ga0242654_100182193 | 3300022726 | Soil | SDPCLGSELTANRINQPNASGLYPAFDMMFLFASTSALL |
| Ga0247550_1024831 | 3300023660 | Soil | AITDPCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL |
| Ga0247553_1019531 | 3300023672 | Soil | GPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0209473_11148181 | 3300026330 | Soil | DLTSPLSLAGATSDLCLGSGLTANRINQFNASGLYPAFDIVFLFASTSAWL |
| Ga0208094_1045672 | 3300027094 | Forest Soil | PCLGSGLTANRINLFNASGLYPAFDMMFLFASTSALL |
| Ga0209523_10342923 | 3300027548 | Forest Soil | LGSGLTANRINQSNASGLYLAFDRSFLFSSTSALL |
| Ga0209169_100385163 | 3300027879 | Soil | RCCDCCSGSGLTANRINQFNASGLYLAFDVMFLFASTSTWL |
| Ga0308309_100990533 | 3300028906 | Soil | SDPCLGSGLTANRKNLLNASGLYPAFDMMFLFASTSALL |
| Ga0222749_100064365 | 3300029636 | Soil | PCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0222748_11199041 | 3300029701 | Soil | RSCSGSGLTANRINQFNASGLYLAFDMMFLFASTSAQL |
| Ga0316363_100635631 | 3300030659 | Peatlands Soil | DPCLGSGLTANRINQFNASGLYPAFDVMFLFASTSALL |
| Ga0310038_100045358 | 3300030707 | Peatlands Soil | RVSCDCRSGSGLTANRINQFNASGLYPAFDVMFLFASTSA |
| Ga0265750_10568891 | 3300030813 | Soil | GPRLGSGLTANRKNLFNASGLYPAFDMMFGFASTSALL |
| Ga0265767_1133162 | 3300030836 | Soil | LLSLRTAITDPCLGSGLTANRKNLLNASGLYPAFDMMFLFASTSALL |
| Ga0265751_1046692 | 3300030873 | Soil | DRHSGSGLTANRKNLFNASGLYLASDMVFLFASTSALL |
| Ga0265769_1013331 | 3300030888 | Soil | SGSALTANRINHFNASGLYLAIDVMFTFASTSAWL |
| Ga0265769_1183671 | 3300030888 | Soil | LRTAITDPCLGSGLTANRINQFNASGLYPAFDVMFLFASTSTLL |
| Ga0247549_1037781 | 3300030942 | Soil | SLGSGLTANRKNQINASGIYPAFDVKFLFSSTSALL |
| Ga0265744_1135002 | 3300031017 | Soil | LRTAITDPCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSTLL |
| Ga0316046_1048241 | 3300031817 | Soil | TDPCLGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL |
| Ga0316046_1076351 | 3300031817 | Soil | ADPCLGSGLTANRKNLLNASGLYPASDVMFLFASTSALL |
| Ga0318532_103193761 | 3300032051 | Soil | LRVATRDLGLGSGLTANRINQFNASGLYLAFVRSFLFSSTS |
| Ga0326631_1113331 | 3300032072 | Soil | CLGSGLTANRINQFNASGLYPAFDMMFEFASTSALL |
| Ga0316053_1143121 | 3300032120 | Soil | TDPCLGSGLTANRINQFNASGLYPAFDMVFLFASTSALL |
| Ga0311301_102490411 | 3300032160 | Peatlands Soil | LAGATSDPCLGSGLTANRINQFNASGLYPAFDMMFLFASTSALL |
| Ga0311301_106880171 | 3300032160 | Peatlands Soil | SFALRRAMLRCCDCCSGSGLTANRINQFNASGLYLAFDVMFLFASTSAWL |
| Ga0307472_1003371011 | 3300032205 | Hardwood Forest Soil | SLPLRGGTSDLCLGSGLTANRINLFNASGLYPAFDMMFLFASTSA |
| Ga0348332_127828622 | 3300032515 | Plant Litter | LGSGLTANRKNLLNASGLYPAFDVMFLFASTSALL |
| Ga0348332_130814311 | 3300032515 | Plant Litter | DPCLGSGLTANRINQFNASGLYPAFDMVFLFASTSALL |
| Ga0335081_104370061 | 3300032892 | Soil | DQCLGSGLTANRINQFNASGLYLAFDMMFLFASTSA |
| Ga0335081_107195051 | 3300032892 | Soil | RVSCDCHSGSGLTANRINQFNASGLYPAFDMMLSFASTSAWL |
| ⦗Top⦘ |