


| Basic Information | |
|---|---|
| Family ID | F045948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARI |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.92 % |
| % of genes near scaffold ends (potentially truncated) | 96.71 % |
| % of genes from short scaffolds (< 2000 bps) | 90.79 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.816 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.053 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.658 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00300 | His_Phos_1 | 9.21 |
| PF12536 | DUF3734 | 7.89 |
| PF13618 | Gluconate_2-dh3 | 5.92 |
| PF03401 | TctC | 3.95 |
| PF05708 | Peptidase_C92 | 1.32 |
| PF07784 | DUF1622 | 1.32 |
| PF00375 | SDF | 1.32 |
| PF05199 | GMC_oxred_C | 1.32 |
| PF00725 | 3HCDH | 1.32 |
| PF00248 | Aldo_ket_red | 1.32 |
| PF10518 | TAT_signal | 1.32 |
| PF13490 | zf-HC2 | 1.32 |
| PF01794 | Ferric_reduct | 0.66 |
| PF00534 | Glycos_transf_1 | 0.66 |
| PF02737 | 3HCDH_N | 0.66 |
| PF04075 | F420H2_quin_red | 0.66 |
| PF00732 | GMC_oxred_N | 0.66 |
| PF01710 | HTH_Tnp_IS630 | 0.66 |
| PF13545 | HTH_Crp_2 | 0.66 |
| PF01494 | FAD_binding_3 | 0.66 |
| PF02371 | Transposase_20 | 0.66 |
| PF05711 | TylF | 0.66 |
| PF13407 | Peripla_BP_4 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.95 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.97 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.97 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.32 |
| COG4828 | Uncharacterized membrane protein | Function unknown [S] | 1.32 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.66 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.66 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.66 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.66 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.66 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.66 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.66 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.66 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.82 % |
| Unclassified | root | N/A | 36.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0718520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300001686|C688J18823_10096932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia xenovorans | 2048 | Open in IMG/M |
| 3300002910|JGI25615J43890_1080461 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005160|Ga0066820_1001437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. Latsch14-2 | 1048 | Open in IMG/M |
| 3300005163|Ga0066823_10066254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
| 3300005332|Ga0066388_102331185 | Not Available | 969 | Open in IMG/M |
| 3300005332|Ga0066388_102634682 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005332|Ga0066388_105440244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300005332|Ga0066388_105712680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300005332|Ga0066388_107924212 | Not Available | 531 | Open in IMG/M |
| 3300005345|Ga0070692_10027103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 2837 | Open in IMG/M |
| 3300005436|Ga0070713_100284655 | Not Available | 1517 | Open in IMG/M |
| 3300005467|Ga0070706_100423203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 1239 | Open in IMG/M |
| 3300005518|Ga0070699_100212655 | Not Available | 1722 | Open in IMG/M |
| 3300005547|Ga0070693_100222731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1237 | Open in IMG/M |
| 3300005713|Ga0066905_101150388 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005713|Ga0066905_101658002 | Not Available | 586 | Open in IMG/M |
| 3300005713|Ga0066905_102295338 | Not Available | 504 | Open in IMG/M |
| 3300005764|Ga0066903_104656394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300006173|Ga0070716_101087272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300006175|Ga0070712_100222623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella | 1495 | Open in IMG/M |
| 3300006575|Ga0074053_12012972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella hinzii | 1802 | Open in IMG/M |
| 3300006797|Ga0066659_11290931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300006847|Ga0075431_100058337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3983 | Open in IMG/M |
| 3300006853|Ga0075420_101461785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300006854|Ga0075425_101899954 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006871|Ga0075434_102077633 | Not Available | 573 | Open in IMG/M |
| 3300006904|Ga0075424_100082916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3368 | Open in IMG/M |
| 3300009100|Ga0075418_10402229 | Not Available | 1464 | Open in IMG/M |
| 3300009100|Ga0075418_10459965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 1364 | Open in IMG/M |
| 3300010043|Ga0126380_10081039 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
| 3300010047|Ga0126382_11206600 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010048|Ga0126373_12032415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300010360|Ga0126372_10572180 | Not Available | 1078 | Open in IMG/M |
| 3300010360|Ga0126372_10573120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1077 | Open in IMG/M |
| 3300010360|Ga0126372_11000840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300010360|Ga0126372_12250373 | Not Available | 595 | Open in IMG/M |
| 3300010366|Ga0126379_13808888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300010398|Ga0126383_10862785 | Not Available | 990 | Open in IMG/M |
| 3300010398|Ga0126383_11843516 | Not Available | 693 | Open in IMG/M |
| 3300010863|Ga0124850_1004954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4157 | Open in IMG/M |
| 3300010863|Ga0124850_1032046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1682 | Open in IMG/M |
| 3300012202|Ga0137363_10364975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1197 | Open in IMG/M |
| 3300012209|Ga0137379_11239682 | Not Available | 653 | Open in IMG/M |
| 3300012582|Ga0137358_10437064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300012923|Ga0137359_11560226 | Not Available | 548 | Open in IMG/M |
| 3300012948|Ga0126375_11229783 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012971|Ga0126369_13422497 | Not Available | 520 | Open in IMG/M |
| 3300012976|Ga0134076_10326930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300012984|Ga0164309_11642808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300014654|Ga0181525_10633544 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300016270|Ga0182036_10656977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300016319|Ga0182033_10381567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1186 | Open in IMG/M |
| 3300016341|Ga0182035_11374613 | Not Available | 633 | Open in IMG/M |
| 3300016357|Ga0182032_11556327 | Not Available | 575 | Open in IMG/M |
| 3300016371|Ga0182034_11319976 | Not Available | 629 | Open in IMG/M |
| 3300016371|Ga0182034_11823696 | Not Available | 536 | Open in IMG/M |
| 3300016387|Ga0182040_11514226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300016404|Ga0182037_10793860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300016422|Ga0182039_10281859 | Not Available | 1369 | Open in IMG/M |
| 3300016422|Ga0182039_10569062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 987 | Open in IMG/M |
| 3300016422|Ga0182039_10920433 | Not Available | 781 | Open in IMG/M |
| 3300018051|Ga0184620_10005577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2638 | Open in IMG/M |
| 3300018083|Ga0184628_10158508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1179 | Open in IMG/M |
| 3300019869|Ga0193705_1014042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1749 | Open in IMG/M |
| 3300021415|Ga0193694_1011334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1203 | Open in IMG/M |
| 3300021439|Ga0213879_10110921 | Not Available | 775 | Open in IMG/M |
| 3300021478|Ga0210402_11057248 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300021560|Ga0126371_10899307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300021560|Ga0126371_11052616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300021560|Ga0126371_11169375 | Not Available | 907 | Open in IMG/M |
| 3300021560|Ga0126371_13007409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300021560|Ga0126371_13712698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300021560|Ga0126371_13776612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300024288|Ga0179589_10288686 | Not Available | 736 | Open in IMG/M |
| 3300025910|Ga0207684_10696948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300026310|Ga0209239_1215305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300026331|Ga0209267_1316146 | Not Available | 518 | Open in IMG/M |
| 3300027669|Ga0208981_1007401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2761 | Open in IMG/M |
| 3300028708|Ga0307295_10029224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1378 | Open in IMG/M |
| 3300028708|Ga0307295_10168228 | Not Available | 613 | Open in IMG/M |
| 3300028712|Ga0307285_10004976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2682 | Open in IMG/M |
| 3300028718|Ga0307307_10135808 | Not Available | 763 | Open in IMG/M |
| 3300028768|Ga0307280_10288637 | Not Available | 596 | Open in IMG/M |
| 3300028796|Ga0307287_10375782 | Not Available | 535 | Open in IMG/M |
| 3300028885|Ga0307304_10176540 | Not Available | 903 | Open in IMG/M |
| 3300031170|Ga0307498_10101602 | Not Available | 886 | Open in IMG/M |
| 3300031231|Ga0170824_123118153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. Latsch14-2 | 692 | Open in IMG/M |
| 3300031544|Ga0318534_10137950 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1405 | Open in IMG/M |
| 3300031545|Ga0318541_10365655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 806 | Open in IMG/M |
| 3300031546|Ga0318538_10262356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300031549|Ga0318571_10178282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
| 3300031549|Ga0318571_10402527 | Not Available | 534 | Open in IMG/M |
| 3300031668|Ga0318542_10335964 | Not Available | 776 | Open in IMG/M |
| 3300031680|Ga0318574_10493081 | Not Available | 718 | Open in IMG/M |
| 3300031713|Ga0318496_10151609 | Not Available | 1265 | Open in IMG/M |
| 3300031724|Ga0318500_10291062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300031744|Ga0306918_10136686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1795 | Open in IMG/M |
| 3300031744|Ga0306918_11493953 | Not Available | 516 | Open in IMG/M |
| 3300031748|Ga0318492_10322823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300031763|Ga0318537_10036261 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300031765|Ga0318554_10262002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300031770|Ga0318521_10431581 | Not Available | 787 | Open in IMG/M |
| 3300031771|Ga0318546_10747073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300031777|Ga0318543_10002697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5418 | Open in IMG/M |
| 3300031779|Ga0318566_10478524 | Not Available | 610 | Open in IMG/M |
| 3300031792|Ga0318529_10281286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300031792|Ga0318529_10394489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300031794|Ga0318503_10064511 | Not Available | 1132 | Open in IMG/M |
| 3300031794|Ga0318503_10118534 | Not Available | 846 | Open in IMG/M |
| 3300031796|Ga0318576_10163731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300031798|Ga0318523_10376055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300031835|Ga0318517_10160375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1007 | Open in IMG/M |
| 3300031846|Ga0318512_10105775 | Not Available | 1326 | Open in IMG/M |
| 3300031846|Ga0318512_10388615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300031879|Ga0306919_10107133 | Not Available | 1977 | Open in IMG/M |
| 3300031880|Ga0318544_10328941 | Not Available | 594 | Open in IMG/M |
| 3300031890|Ga0306925_11151452 | Not Available | 780 | Open in IMG/M |
| 3300031890|Ga0306925_11505864 | Not Available | 658 | Open in IMG/M |
| 3300031910|Ga0306923_10133285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2827 | Open in IMG/M |
| 3300031910|Ga0306923_10235080 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300031910|Ga0306923_10270777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1942 | Open in IMG/M |
| 3300031910|Ga0306923_11724510 | Not Available | 646 | Open in IMG/M |
| 3300031912|Ga0306921_10704116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300031942|Ga0310916_10345616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
| 3300031945|Ga0310913_10141416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1657 | Open in IMG/M |
| 3300031945|Ga0310913_10759874 | Not Available | 684 | Open in IMG/M |
| 3300031947|Ga0310909_10074774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2671 | Open in IMG/M |
| 3300031947|Ga0310909_10326054 | Not Available | 1288 | Open in IMG/M |
| 3300031954|Ga0306926_11559461 | Not Available | 759 | Open in IMG/M |
| 3300031954|Ga0306926_12017419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 648 | Open in IMG/M |
| 3300031959|Ga0318530_10117039 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300032001|Ga0306922_10663432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1100 | Open in IMG/M |
| 3300032001|Ga0306922_11238857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300032039|Ga0318559_10287634 | Not Available | 762 | Open in IMG/M |
| 3300032043|Ga0318556_10038061 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300032043|Ga0318556_10123493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1325 | Open in IMG/M |
| 3300032051|Ga0318532_10083287 | Not Available | 1121 | Open in IMG/M |
| 3300032052|Ga0318506_10208902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300032059|Ga0318533_11314004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300032060|Ga0318505_10321631 | Not Available | 730 | Open in IMG/M |
| 3300032076|Ga0306924_10659680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
| 3300032091|Ga0318577_10033215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2241 | Open in IMG/M |
| 3300032094|Ga0318540_10367858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300032174|Ga0307470_10635738 | Not Available | 803 | Open in IMG/M |
| 3300032174|Ga0307470_11361141 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300032180|Ga0307471_100328004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1631 | Open in IMG/M |
| 3300032205|Ga0307472_100870651 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300032205|Ga0307472_102488298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300032261|Ga0306920_102350730 | Not Available | 737 | Open in IMG/M |
| 3300032261|Ga0306920_102495051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300033290|Ga0318519_10924952 | Not Available | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.32% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.66% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_07185203 | 3300000033 | Soil | MIMLLAVTLYATAGTVIAAAFLAFGVTRVLPVPAAV |
| C688J18823_100969323 | 3300001686 | Soil | MIVLIALGVYVAAGVAVAAAFVVFGVTRVLPEHLR* |
| JGI25615J43890_10804612 | 3300002910 | Grasslands Soil | MIVLLALVLYAAAGXAIAAAFLVFGVTRVLPEPAPVTLGARIVLFP |
| Ga0066820_10014371 | 3300005160 | Soil | MIVLIALGVYVAVGVAVAAAFVVFGVTRVLPEHLPVTVSA |
| Ga0066823_100662541 | 3300005163 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFPGA |
| Ga0066388_1023311852 | 3300005332 | Tropical Forest Soil | VTVLLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIVLFP |
| Ga0066388_1026346821 | 3300005332 | Tropical Forest Soil | VIVPLLALALYAATGFAVAIAFLAFGVTRVLPEPAPVTLGARIMLFPGTAALWPCVLIRWLRSSR* |
| Ga0066388_1054402441 | 3300005332 | Tropical Forest Soil | VIVPLLALALYAVVGFAVAVTFLAFGVTRVLPEPAPVTLGARIML |
| Ga0066388_1057126803 | 3300005332 | Tropical Forest Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIM |
| Ga0066388_1079242123 | 3300005332 | Tropical Forest Soil | VIVPRLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIM |
| Ga0070692_100271031 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLIALGVYVAAGVAVAAAFVAFGVTRVLPEYLPVTVGARILLF |
| Ga0070713_1002846553 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MIILLALALYAATGIAIAIAFLVFGVTRVLATPVPVTLGARIMLFP |
| Ga0070706_1004232031 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLLALVFYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFPGA |
| Ga0070699_1002126553 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLLALVLYAAAGIVIAAAFLVFGVTRVLPEPAPVTLGA |
| Ga0070693_1002227311 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLIALGVYVAAGVTVAAAFVAFGVTRVLPEHLPVTVGA |
| Ga0066905_1011503882 | 3300005713 | Tropical Forest Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFPGTAALW |
| Ga0066905_1016580022 | 3300005713 | Tropical Forest Soil | VIVLLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARI |
| Ga0066905_1022953381 | 3300005713 | Tropical Forest Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIML |
| Ga0066903_1046563941 | 3300005764 | Tropical Forest Soil | MIVLIALALYAAVGVAIAAGFLVFGVTRVLPEPVPMTLGARIMLFPG |
| Ga0070716_1010872722 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLPALAVYAAAGAIIAAAFLVFGVSRVLPAPAPVTLGARVLLFPGALAL |
| Ga0070712_1002226231 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLIALGVYVAVGVAVAAAFVVFGVTRVLPEYLPVTVSARILLFPGAAVL |
| Ga0074053_120129723 | 3300006575 | Soil | MIVLIALGVYVAAGVAVAAAFVAFGVTRVLPEYLP |
| Ga0066659_112909313 | 3300006797 | Soil | MIVLLALALYAATGVAIAAAFLVFGVTRVPPKPAP |
| Ga0075431_1000583376 | 3300006847 | Populus Rhizosphere | MIVLIGLALYVAAGIAVAAAFVAFGVTRVLPEPVPVSVGARILIFP |
| Ga0075420_1014617853 | 3300006853 | Populus Rhizosphere | MIVLLALVLYAAAGITIAAAFLVFGVTRVLPEPARVTLGARIVLFPGAAALW |
| Ga0075425_1018999542 | 3300006854 | Populus Rhizosphere | MTLLIGVAFYAAAGVAVGAAFVAFGITRVLPEPAP |
| Ga0075434_1020776331 | 3300006871 | Populus Rhizosphere | MIVLVALALYAAMGVAIAAAFLVFGVTRVLPEPVPVTLGARIMLF |
| Ga0075424_1000829161 | 3300006904 | Populus Rhizosphere | MIVVWGLALYGLAGAVIALAFVVHGVTRVLPEQVSM |
| Ga0075418_104022292 | 3300009100 | Populus Rhizosphere | MIVLLALALYAVTGIAIAAAFLVFGVTRVLPKPVPVTLGARIMLFPGA |
| Ga0075418_104599653 | 3300009100 | Populus Rhizosphere | MIVLIGLALYVAAGIAVAAAFVAFGVTRVLPEPVPVS |
| Ga0126380_100810396 | 3300010043 | Tropical Forest Soil | MIVLLAVAVYAAVGVVIAAAFLAFGVTRVLPEPTAVTLGARIMLF |
| Ga0126382_112066001 | 3300010047 | Tropical Forest Soil | MIVLIGLALYAAAGIAVAAAVVAFGVTLVLPEPVPVSVI |
| Ga0126373_120324152 | 3300010048 | Tropical Forest Soil | VTVPLLALALYAAAGFAVAIAFLAFGVPRVLPEPAPVTLGARILLFPGTAALWPCVLI |
| Ga0126372_105721802 | 3300010360 | Tropical Forest Soil | MIVLLAVALYAVAGIVIAAAFLAFGVTRVLPAPAAVTLGARIMLF |
| Ga0126372_105731201 | 3300010360 | Tropical Forest Soil | VTVLLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGA |
| Ga0126372_110008404 | 3300010360 | Tropical Forest Soil | VIGPLLALALYAAAGVAVAVAFLVFGVTRVLPEPAPVTLGARI |
| Ga0126372_122503733 | 3300010360 | Tropical Forest Soil | MIVLLTLVLYAAAGIAIAAAFLVFGVTRVLPEPAP |
| Ga0126379_138088882 | 3300010366 | Tropical Forest Soil | VTVPLLALALYAAAGFAVAVAFLAFGVTRVLPEPAPVTLGARIMLFPGTAA |
| Ga0126383_108627851 | 3300010398 | Tropical Forest Soil | VIVLLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFPGTA |
| Ga0126383_118435161 | 3300010398 | Tropical Forest Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPV |
| Ga0124850_10049548 | 3300010863 | Tropical Forest Soil | MIVLLAVALYTVAGIVIAAAFLAFGVTRVLPAPATVTLGAR |
| Ga0124850_10320461 | 3300010863 | Tropical Forest Soil | MIVLLALALYAAAGVAIAAAFVVFGVTRVLPEPAPVTLGARILLLFPGAAALWP |
| Ga0137363_103649751 | 3300012202 | Vadose Zone Soil | MIMLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFPGA |
| Ga0137379_112396822 | 3300012209 | Vadose Zone Soil | MIVLLAVTLYAAAGIVIAAAFLAFGVTRVLPAPAAVTLG |
| Ga0137358_104370642 | 3300012582 | Vadose Zone Soil | ALYAATGIAIATAFLVFGVTSVLPEPVPVTLGARIMLFPGAAAHWPYMLIRWLKSSQ* |
| Ga0137359_115602261 | 3300012923 | Vadose Zone Soil | MIVLLALALYAATGFAVAVAFLAFGVTRVLPEPAPVTLGARIMLFPGTAA |
| Ga0126375_112297831 | 3300012948 | Tropical Forest Soil | MIVLIGLALYAAAGIAVAAAFVAFGVTRVLPEPVPVSAGARI |
| Ga0126369_134224972 | 3300012971 | Tropical Forest Soil | VIVPLLALALYAAAGFAIAAAFLVFGVTRVLPEPAPVTLGARIMLFPG |
| Ga0134076_103269303 | 3300012976 | Grasslands Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFPGAVAL |
| Ga0164309_116428081 | 3300012984 | Soil | MIVLLAVVLYAAAGIAIAAAFLVFGVTRVLPEPAPLTLGARIVLF |
| Ga0181525_106335441 | 3300014654 | Bog | MILLDALALYAAAGLITAIAFASFGVTRVLPESASVTMGARIL |
| Ga0182036_106569772 | 3300016270 | Soil | MLLAVELYAVAGVVIAVAFLAFGVARVLPTPVPVTLGARIMLF |
| Ga0182033_103815671 | 3300016319 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFP |
| Ga0182035_113746133 | 3300016341 | Soil | MIVLLALALYAAAGIAVAAAFLVFGVTRVLPEPAPVTLGARIVLFPG |
| Ga0182032_115563272 | 3300016357 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGA |
| Ga0182034_113199761 | 3300016371 | Soil | VIVLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIM |
| Ga0182034_118236961 | 3300016371 | Soil | MIVLLAVTLYAAAGIVIAAAFVAFGVTRVLPAPATVTLGARIL |
| Ga0182040_115142261 | 3300016387 | Soil | MIVLLALVLYAAAGVAIAAAFLVFGVTRVLPEPAPVTLGARIVLFP |
| Ga0182037_107938601 | 3300016404 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVTLGARI |
| Ga0182039_102818595 | 3300016422 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFPG |
| Ga0182039_105690621 | 3300016422 | Soil | VIVSLLALALYAAAGFAVAVAFLALGVTRVLPEPAPVTLGA |
| Ga0182039_109204333 | 3300016422 | Soil | MIVLLALALYAAAGIAIAAAFLAFGVTRVLPEPAPVTLGARIVLFPGAAA |
| Ga0184620_100055771 | 3300018051 | Groundwater Sediment | MMIVLIGLALYAAAGVAIAAAFVVFGVTRVLPEPLP |
| Ga0184628_101585083 | 3300018083 | Groundwater Sediment | MIVLIALGVYVAAGVAVAAAFVAFGVTRVLPEYLPV |
| Ga0193705_10140423 | 3300019869 | Soil | MMIVLIGLALYAAAGVAIAAAFVVFGVTRVLPEPLPV |
| Ga0193694_10113343 | 3300021415 | Soil | MMIVLIGLALYAAAGVAIAAAFVVFGVTRVLPEPLPVTVGARI |
| Ga0213879_101109212 | 3300021439 | Bulk Soil | VIVPLLALALYAAAGFAVAVAFLALGVTRVLPEPAPV |
| Ga0210402_110572482 | 3300021478 | Soil | MIVLICLALYAATGVAIGVAFVLFGVTRVLPEPAP |
| Ga0126371_108993071 | 3300021560 | Tropical Forest Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGAR |
| Ga0126371_110526162 | 3300021560 | Tropical Forest Soil | MIVLLALVLYAVAGIATAAAFLVFGVTRVLPEPAPVTLGARIMLFPGA |
| Ga0126371_111693752 | 3300021560 | Tropical Forest Soil | MTVLLLALALYAAAGFAVAVAFLVFGVTRVLPEPA |
| Ga0126371_130074093 | 3300021560 | Tropical Forest Soil | VIVPLLALALYAAAGFAVAIAFLAFGVTRVLPEPAPVTLGARIMLFPGTAALW |
| Ga0126371_137126982 | 3300021560 | Tropical Forest Soil | VIVPLFALALYAATGFAVAIAFLAFGVTRVLPEPAPVTLGARIMLFPGTAALW |
| Ga0126371_137766121 | 3300021560 | Tropical Forest Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVT |
| Ga0179589_102886861 | 3300024288 | Vadose Zone Soil | MIVLLALALYAATGIAIAIAFLVFGVTRVLAKPVPVTLARG |
| Ga0207684_106969481 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFPGAVA |
| Ga0209239_12153051 | 3300026310 | Grasslands Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTL |
| Ga0209267_13161461 | 3300026331 | Soil | MIVLLALALYAATGVAIAAAFLVFGVTRVLPKPAPVTLGA |
| Ga0208981_10074013 | 3300027669 | Forest Soil | MIVLIGLALYVAAGVAVATAFVVFGVTRVLPEPLPVT |
| Ga0307295_100292241 | 3300028708 | Soil | MIVLIALGVYVAAGVAVAAAFVAFGVTRVLPEYLPVTVGARILLFLP |
| Ga0307295_101682281 | 3300028708 | Soil | MIVLLAIALYAAAGIAIAAAFLAFGVTRVLPEPVPV |
| Ga0307285_100049762 | 3300028712 | Soil | MIVLIALGVYVAAGVAVAAAFVVFGVTRVLPEHLR |
| Ga0307307_101358082 | 3300028718 | Soil | MIVLLAIALYAAAGIAIAAAFLAFGVTRVLPEPVPVTLGTRIVLFP |
| Ga0307280_102886371 | 3300028768 | Soil | MIVLLAIALYAAAGIAIAAAFLAFGVTRVLPEPVPVT |
| Ga0307287_103757822 | 3300028796 | Soil | MMIVLIGLALYAAAGVAIAAAFVVFGVTRVLPEPLR |
| Ga0307304_101765401 | 3300028885 | Soil | MIVLLAIALYAAAGIAIAAAFLAFGVTRVLPEPVPVTLGTRIVLFPGAVAL |
| Ga0307498_101016023 | 3300031170 | Soil | MIMLLAVTLYATAGTVIAAAFLAFGVTRVLPAPAAVTLGARIMLFP |
| Ga0170824_1231181531 | 3300031231 | Forest Soil | MMIVLIGLALYAAAGVAIAAAFVVFGVTRVLPDPLP |
| Ga0318534_101379503 | 3300031544 | Soil | MIMLLAVTLYATAGTVIAAAFLAFGVTRVLPAPAAVTL |
| Ga0318541_103656552 | 3300031545 | Soil | MIVLLAVTLYAAAGIVIAAAFVAFGVTRVLPAPATVTLGAR |
| Ga0318538_102623563 | 3300031546 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIMLFPGA |
| Ga0318571_101782823 | 3300031549 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVT |
| Ga0318571_104025271 | 3300031549 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIVLFPGTAALWP |
| Ga0318542_103359641 | 3300031668 | Soil | VIVPLLALALYAAAGFVVAVAFLVFGVTRVLPEPAPVTLGARIMLFPGTAALWP |
| Ga0318574_104930813 | 3300031680 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLF |
| Ga0318496_101516094 | 3300031713 | Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGA |
| Ga0318500_102910623 | 3300031724 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVTLG |
| Ga0306918_101366863 | 3300031744 | Soil | MIVLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLG |
| Ga0306918_114939531 | 3300031744 | Soil | MIVLLAVTLYATAGTVIAAAFLAFGVTRVLPAPAAVTL |
| Ga0318492_103228232 | 3300031748 | Soil | MIVVLAVVLYAATGAVIAAAFLAFGVTRVLATPVPV |
| Ga0318537_100362611 | 3300031763 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFPG |
| Ga0318554_102620024 | 3300031765 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIVLFP |
| Ga0318521_104315811 | 3300031770 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPA |
| Ga0318546_107470732 | 3300031771 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPV |
| Ga0318543_100026971 | 3300031777 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPV |
| Ga0318566_104785241 | 3300031779 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIVLFPGTAALW |
| Ga0318529_102812861 | 3300031792 | Soil | MIVLLALALYAAAGVVIAVAFLVFGVTRVLPEPAPV |
| Ga0318529_103944892 | 3300031792 | Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTRGA |
| Ga0318503_100645113 | 3300031794 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVTLGARIVLFPGAVA |
| Ga0318503_101185343 | 3300031794 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARIM |
| Ga0318576_101637311 | 3300031796 | Soil | VIVSLLALALYAAAGFAVAVAFLALGVTRVLPEPAPVTLGARIILFPGTAALWTYV |
| Ga0318523_103760551 | 3300031798 | Soil | MIVLQAIALYAVAGIAIAACFLAFGVTRVLPTRSTMT |
| Ga0318517_101603751 | 3300031835 | Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARI |
| Ga0318512_101057755 | 3300031846 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGA |
| Ga0318512_103886151 | 3300031846 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAP |
| Ga0306919_101071335 | 3300031879 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFPGTATL |
| Ga0318544_103289411 | 3300031880 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFPGTATLW |
| Ga0306925_111514523 | 3300031890 | Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARL |
| Ga0306925_115058641 | 3300031890 | Soil | MIMLLAVTLYATAGTVIAAAFLAFGVTRVLPAPAA |
| Ga0306923_101332855 | 3300031910 | Soil | VLLAVELYAVAGVMIAVAFLAFGVTRVLPAPAPVMLGARIMLFPGVIALWP |
| Ga0306923_102350801 | 3300031910 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAP |
| Ga0306923_102707771 | 3300031910 | Soil | MIVLLALVLYAAAGIAIAAAFLVFGVTRVLPEPAPVTLG |
| Ga0306923_117245101 | 3300031910 | Soil | MIVLLAVTLYATAGTVIAAAFLAFGVTRVLPAPAAVTLGARIMLFPGVVALW |
| Ga0306921_107041161 | 3300031912 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLG |
| Ga0310916_103456161 | 3300031942 | Soil | VIVSLLALALYAAAGFAVAVAFLALGVTRVLPEPAPVT |
| Ga0310913_101414161 | 3300031945 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVKRVLPEPAPVTLGARIMLFPGTAALW |
| Ga0310913_107598741 | 3300031945 | Soil | MTVLLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIVLFPGTA |
| Ga0310909_100747741 | 3300031947 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARI |
| Ga0310909_103260541 | 3300031947 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVTLGARIVLFPGAVAL |
| Ga0306926_115594611 | 3300031954 | Soil | VIMPLLTLALYAAAGIAIAAAFLVFGVTRVLPEPAPV |
| Ga0306926_120174191 | 3300031954 | Soil | MIVLLALALYAAVGVVIAAAFLAFGVTRVLPDLASVTLGARIVL |
| Ga0318530_101170391 | 3300031959 | Soil | MIVLLALVLYAAAGIVIAAAFLVFGVTRVLPEPAPVTLGARIVLFPGA |
| Ga0306922_106634323 | 3300032001 | Soil | VNSNGICSSVIIVLLAVELYAVAGVVIAVAFLAFGVTRVLPTPAPVTLGAR |
| Ga0306922_112388573 | 3300032001 | Soil | MILLQAVALYAAAGVVIAATFLAFGVTRVLPTCSSVTLGARI |
| Ga0318559_102876343 | 3300032039 | Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTL |
| Ga0318556_100380614 | 3300032043 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVKRVLPEPAPVTLGARIMLFPGTAAL |
| Ga0318556_101234933 | 3300032043 | Soil | MIMLLAVTLYATAGTVIAAAFLAFGVTRVLPTPAPVTLGARIMFFP |
| Ga0318532_100832871 | 3300032051 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLF |
| Ga0318506_102089022 | 3300032052 | Soil | MIVLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIL |
| Ga0318533_113140041 | 3300032059 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPAPVT |
| Ga0318505_103216313 | 3300032060 | Soil | MIVLLALALYAAAGIAIAAAFLVFGVTRVLPEPAPVTLGARLVL |
| Ga0306924_106596803 | 3300032076 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPGPVTLGARI |
| Ga0318577_100332155 | 3300032091 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVTLGARIVLF |
| Ga0318540_103678582 | 3300032094 | Soil | MIVLLALTLYAATGIATAAAFLVFGVTRVLPEPAPVTLGARIVLFPGAVALPE |
| Ga0307470_106357381 | 3300032174 | Hardwood Forest Soil | MIVLLAIALYAAAGIAIAAAFLAFGVTRVLPEPVPVTLGTRIVL |
| Ga0307470_113611412 | 3300032174 | Hardwood Forest Soil | MIVLLAATLYAAAGIVIAAAFLAFGVTRVLPAPAAVTLGARIMLFPGAVA |
| Ga0307471_1003280041 | 3300032180 | Hardwood Forest Soil | MILSLALYAAAGVAVGLAFVVFGVSRVLPEPAPVSIGARVLLFPGAA |
| Ga0307472_1008706511 | 3300032205 | Hardwood Forest Soil | MIMLLALGLYAATGIAIAAAFLVFGVTRVLPKPVPVT |
| Ga0307472_1024882981 | 3300032205 | Hardwood Forest Soil | MIVLLAATLYAAAGIVIAAAFLAFGVTRVLPAPAAVTLGARIMLFPG |
| Ga0306920_1023507301 | 3300032261 | Soil | MIVLLALVLYAAAGIAIAAAFLMFGVTRVLPEPAPVTLGARIVLFPGAAA |
| Ga0306920_1024950513 | 3300032261 | Soil | MIVLIALALYAAAGFAVAVAFLVFGVTRVLPEPAPVTLGARIMLFPGTAALW |
| Ga0318519_109249521 | 3300033290 | Soil | VIVPLLALALYAAAGFAVAVAFLVFGVTRVLPEPG |
| ⦗Top⦘ |