


| Basic Information | |
|---|---|
| Family ID | F045827 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RMTEAQKGALSRETAEKVEQVEELNARSRKYNLPSASAPER |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.67 % |
| % of genes near scaffold ends (potentially truncated) | 96.71 % |
| % of genes from short scaffolds (< 2000 bps) | 92.76 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.737 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.842 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.526 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 3.95 |
| PF01436 | NHL | 1.97 |
| PF13561 | adh_short_C2 | 1.32 |
| PF01979 | Amidohydro_1 | 1.32 |
| PF00135 | COesterase | 1.32 |
| PF00857 | Isochorismatase | 1.32 |
| PF00072 | Response_reg | 0.66 |
| PF00497 | SBP_bac_3 | 0.66 |
| PF06441 | EHN | 0.66 |
| PF00196 | GerE | 0.66 |
| PF04199 | Cyclase | 0.66 |
| PF13432 | TPR_16 | 0.66 |
| PF04392 | ABC_sub_bind | 0.66 |
| PF14832 | Tautomerase_3 | 0.66 |
| PF00903 | Glyoxalase | 0.66 |
| PF02424 | ApbE | 0.66 |
| PF06707 | DUF1194 | 0.66 |
| PF05199 | GMC_oxred_C | 0.66 |
| PF13360 | PQQ_2 | 0.66 |
| PF08450 | SGL | 0.66 |
| PF08308 | PEGA | 0.66 |
| PF01909 | NTP_transf_2 | 0.66 |
| PF01149 | Fapy_DNA_glyco | 0.66 |
| PF13714 | PEP_mutase | 0.66 |
| PF02668 | TauD | 0.66 |
| PF02872 | 5_nucleotid_C | 0.66 |
| PF01551 | Peptidase_M23 | 0.66 |
| PF00296 | Bac_luciferase | 0.66 |
| PF03707 | MHYT | 0.66 |
| PF13673 | Acetyltransf_10 | 0.66 |
| PF02452 | PemK_toxin | 0.66 |
| PF02310 | B12-binding | 0.66 |
| PF13751 | DDE_Tnp_1_6 | 0.66 |
| PF12681 | Glyoxalase_2 | 0.66 |
| PF13358 | DDE_3 | 0.66 |
| PF01613 | Flavin_Reduct | 0.66 |
| PF02738 | MoCoBD_1 | 0.66 |
| PF08241 | Methyltransf_11 | 0.66 |
| PF13676 | TIR_2 | 0.66 |
| PF12697 | Abhydrolase_6 | 0.66 |
| PF13340 | DUF4096 | 0.66 |
| PF00254 | FKBP_C | 0.66 |
| PF13442 | Cytochrome_CBB3 | 0.66 |
| PF02899 | Phage_int_SAM_1 | 0.66 |
| PF03928 | HbpS-like | 0.66 |
| PF13193 | AMP-binding_C | 0.66 |
| PF07366 | SnoaL | 0.66 |
| PF03466 | LysR_substrate | 0.66 |
| PF13924 | Lipocalin_5 | 0.66 |
| PF14588 | YjgF_endoribonc | 0.66 |
| PF03734 | YkuD | 0.66 |
| PF00226 | DnaJ | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.32 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.32 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.32 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.66 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.66 |
| COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 0.66 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.66 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.66 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.66 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.66 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.66 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.66 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 0.66 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.66 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.66 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.66 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.66 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.74 % |
| Unclassified | root | N/A | 30.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001977|JGI24746J21847_1068977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300003987|Ga0055471_10056193 | Not Available | 1077 | Open in IMG/M |
| 3300004080|Ga0062385_11014238 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005177|Ga0066690_10479752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300005186|Ga0066676_10903593 | Not Available | 592 | Open in IMG/M |
| 3300005332|Ga0066388_101444520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300005332|Ga0066388_102233307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300005332|Ga0066388_105910548 | Not Available | 618 | Open in IMG/M |
| 3300005364|Ga0070673_100513560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1085 | Open in IMG/M |
| 3300005444|Ga0070694_100667664 | Not Available | 843 | Open in IMG/M |
| 3300005456|Ga0070678_101092488 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005530|Ga0070679_101907137 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005542|Ga0070732_10050835 | Not Available | 2394 | Open in IMG/M |
| 3300005554|Ga0066661_10686607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005556|Ga0066707_10103360 | Not Available | 1753 | Open in IMG/M |
| 3300005556|Ga0066707_10256580 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300005559|Ga0066700_10697779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300005578|Ga0068854_102017973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300005598|Ga0066706_10986885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300005598|Ga0066706_11438711 | Not Available | 519 | Open in IMG/M |
| 3300005843|Ga0068860_101054991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 831 | Open in IMG/M |
| 3300006041|Ga0075023_100572267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300006052|Ga0075029_100048040 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300006052|Ga0075029_100658701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300006162|Ga0075030_100373340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300006237|Ga0097621_100194818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCD8929 | 1757 | Open in IMG/M |
| 3300006237|Ga0097621_101971779 | Not Available | 558 | Open in IMG/M |
| 3300006796|Ga0066665_11196706 | Not Available | 580 | Open in IMG/M |
| 3300006854|Ga0075425_101036347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300006881|Ga0068865_101148430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300007255|Ga0099791_10106160 | Not Available | 1295 | Open in IMG/M |
| 3300009012|Ga0066710_100291962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2383 | Open in IMG/M |
| 3300009012|Ga0066710_100729417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1513 | Open in IMG/M |
| 3300009012|Ga0066710_101758591 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300009089|Ga0099828_11061197 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300009094|Ga0111539_10906737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 1025 | Open in IMG/M |
| 3300009098|Ga0105245_13074474 | Not Available | 517 | Open in IMG/M |
| 3300009156|Ga0111538_10605479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1389 | Open in IMG/M |
| 3300009176|Ga0105242_11606470 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300009520|Ga0116214_1315627 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300009792|Ga0126374_10239062 | Not Available | 1178 | Open in IMG/M |
| 3300009824|Ga0116219_10071219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2042 | Open in IMG/M |
| 3300010043|Ga0126380_10382132 | Not Available | 1038 | Open in IMG/M |
| 3300010304|Ga0134088_10001486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9097 | Open in IMG/M |
| 3300010304|Ga0134088_10261499 | Not Available | 833 | Open in IMG/M |
| 3300010335|Ga0134063_10719007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010358|Ga0126370_11785338 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010360|Ga0126372_10272643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1467 | Open in IMG/M |
| 3300010361|Ga0126378_10341186 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300010362|Ga0126377_11022926 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300010362|Ga0126377_11642794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
| 3300010366|Ga0126379_13362929 | Not Available | 536 | Open in IMG/M |
| 3300010398|Ga0126383_12247389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300010399|Ga0134127_10344329 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300010400|Ga0134122_11599212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300010403|Ga0134123_11547366 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300011271|Ga0137393_10752602 | Not Available | 834 | Open in IMG/M |
| 3300011397|Ga0137444_1031736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300011416|Ga0137422_1132192 | Not Available | 589 | Open in IMG/M |
| 3300011417|Ga0137326_1054579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300011422|Ga0137425_1116141 | Not Available | 659 | Open in IMG/M |
| 3300011430|Ga0137423_1008940 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
| 3300011435|Ga0137426_1132217 | Not Available | 723 | Open in IMG/M |
| 3300011444|Ga0137463_1198547 | Not Available | 752 | Open in IMG/M |
| 3300012134|Ga0137330_1046293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300012173|Ga0137327_1077713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300012189|Ga0137388_11411810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300012199|Ga0137383_11039065 | Not Available | 596 | Open in IMG/M |
| 3300012203|Ga0137399_11063447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 681 | Open in IMG/M |
| 3300012205|Ga0137362_11749220 | Not Available | 508 | Open in IMG/M |
| 3300012206|Ga0137380_10474931 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300012207|Ga0137381_10718550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300012285|Ga0137370_10494419 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300012349|Ga0137387_10966619 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012410|Ga0134060_1061984 | Not Available | 559 | Open in IMG/M |
| 3300012486|Ga0157331_1037253 | Not Available | 511 | Open in IMG/M |
| 3300012685|Ga0137397_10995385 | Not Available | 617 | Open in IMG/M |
| 3300012900|Ga0157292_10172949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300012918|Ga0137396_10518468 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012922|Ga0137394_10361706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1238 | Open in IMG/M |
| 3300012924|Ga0137413_11105963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300012930|Ga0137407_12431309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012944|Ga0137410_11486544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300013297|Ga0157378_13098004 | Not Available | 516 | Open in IMG/M |
| 3300013306|Ga0163162_13274249 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300013308|Ga0157375_13298765 | Not Available | 538 | Open in IMG/M |
| 3300014164|Ga0181532_10710084 | Not Available | 542 | Open in IMG/M |
| 3300014657|Ga0181522_10892576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300014968|Ga0157379_11154034 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300014968|Ga0157379_12032530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 568 | Open in IMG/M |
| 3300014969|Ga0157376_10453079 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300014969|Ga0157376_10813816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300015254|Ga0180089_1070137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300015371|Ga0132258_12454982 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300015371|Ga0132258_13141058 | Not Available | 1141 | Open in IMG/M |
| 3300015374|Ga0132255_101306545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
| 3300015374|Ga0132255_105613974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300016270|Ga0182036_11694415 | Not Available | 534 | Open in IMG/M |
| 3300016357|Ga0182032_10818754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300016445|Ga0182038_11350030 | Not Available | 638 | Open in IMG/M |
| 3300017654|Ga0134069_1313488 | Not Available | 558 | Open in IMG/M |
| 3300017659|Ga0134083_10605061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300017997|Ga0184610_1194433 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300018052|Ga0184638_1266460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300018466|Ga0190268_12325105 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018482|Ga0066669_10590917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300020034|Ga0193753_10334830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300021081|Ga0210379_10146587 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300021082|Ga0210380_10208069 | Not Available | 885 | Open in IMG/M |
| 3300021420|Ga0210394_11470970 | Not Available | 577 | Open in IMG/M |
| 3300021445|Ga0182009_10841967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300025796|Ga0210113_1069480 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025901|Ga0207688_10304573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira | 975 | Open in IMG/M |
| 3300025907|Ga0207645_11082256 | Not Available | 541 | Open in IMG/M |
| 3300025916|Ga0207663_10610321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300025938|Ga0207704_10884810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300025960|Ga0207651_10448560 | Not Available | 1106 | Open in IMG/M |
| 3300026088|Ga0207641_11258770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria → unclassified Ruegeria → Ruegeria sp. HKCCD8929 | 740 | Open in IMG/M |
| 3300026121|Ga0207683_10636488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 988 | Open in IMG/M |
| 3300026297|Ga0209237_1039806 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300026320|Ga0209131_1021449 | All Organisms → cellular organisms → Bacteria | 3871 | Open in IMG/M |
| 3300026320|Ga0209131_1291767 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300026507|Ga0257165_1007276 | Not Available | 1651 | Open in IMG/M |
| 3300026557|Ga0179587_10791738 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300027490|Ga0209899_1115547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300027835|Ga0209515_10119726 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300027855|Ga0209693_10371360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300027898|Ga0209067_10839985 | Not Available | 537 | Open in IMG/M |
| 3300028784|Ga0307282_10253844 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300028789|Ga0302232_10424407 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300028803|Ga0307281_10114875 | Not Available | 917 | Open in IMG/M |
| 3300030058|Ga0302179_10336714 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031232|Ga0302323_102833871 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031538|Ga0310888_10985046 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031547|Ga0310887_10295343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300031573|Ga0310915_10914780 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031715|Ga0307476_11071840 | Not Available | 592 | Open in IMG/M |
| 3300031720|Ga0307469_11146053 | Not Available | 733 | Open in IMG/M |
| 3300031720|Ga0307469_11991096 | Not Available | 564 | Open in IMG/M |
| 3300031820|Ga0307473_10012265 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
| 3300031858|Ga0310892_10578103 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031940|Ga0310901_10250209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300032059|Ga0318533_10687852 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300032179|Ga0310889_10237446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira | 858 | Open in IMG/M |
| 3300032205|Ga0307472_101245377 | Not Available | 713 | Open in IMG/M |
| 3300032515|Ga0348332_13628018 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300032893|Ga0335069_11150314 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300033289|Ga0310914_10311768 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300033412|Ga0310810_10380377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1468 | Open in IMG/M |
| 3300033433|Ga0326726_12407255 | Not Available | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.84% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.32% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.32% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.32% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.66% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.66% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.66% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24746J21847_10689772 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVELKTTGHMTEAQKGALSRETSEKVEQVDELNARSRKYNLPSASAPER* |
| Ga0055471_100561932 | 3300003987 | Natural And Restored Wetlands | LKATGRMVEAQKGALNDATADKIEQVEELNARSVKYNLPRSSGREQR* |
| Ga0062385_110142381 | 3300004080 | Bog Forest Soil | ELQSTGRMAEAQKGALGRATVEKVQRVEELNARSRKYNLPSGSGQER* |
| Ga0066690_104797521 | 3300005177 | Soil | LQATGQIAEAQKGTLSRAMSDKVEQVEELNARARKYNLPRGSAAER* |
| Ga0066676_109035931 | 3300005186 | Soil | KTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0066388_1014445201 | 3300005332 | Tropical Forest Soil | TGRMTEAQKGSLSREMSDKVEQVEELNARSRKYNLPRPSASER* |
| Ga0066388_1022333071 | 3300005332 | Tropical Forest Soil | TGRMTEAQKGSLSREMSDKVEQVEELNARSRKYNLPRPSAPER* |
| Ga0066388_1059105481 | 3300005332 | Tropical Forest Soil | TEAQKGALSRETTEKVEQVDALNARSRKYNLPSASTPER* |
| Ga0070673_1005135601 | 3300005364 | Switchgrass Rhizosphere | LQTTGVIPNAQKTALSRVTSDKVEQVEELNARSAKYNLPKGSATER* |
| Ga0070694_1006676642 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ATGRMTEAQKGTLNRATTDKVEQVEELNQRSRKYNLPSASGPER* |
| Ga0070678_1010924882 | 3300005456 | Miscanthus Rhizosphere | DKALAELKATGRMVEAEKGAVSGATRDKVEQVEELNARARKYNLPIGTASGSGAKR* |
| Ga0070679_1019071371 | 3300005530 | Corn Rhizosphere | ELKTTGQMTEAQKSALSRETAEKLEQVAQLNARSQKYHLPAASASER* |
| Ga0070732_100508351 | 3300005542 | Surface Soil | KTLAELKATGRMTEAQKGVLNPETSRKVQHVEELNARSRKYNLPGIGSTSER* |
| Ga0066661_106866071 | 3300005554 | Soil | ELKATGQMTAAQKGALGRETAEKLEHVEELNARSRKYNLPRGSAPER* |
| Ga0066707_101033601 | 3300005556 | Soil | ELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPGGSAPERQ* |
| Ga0066707_102565803 | 3300005556 | Soil | ELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0066700_106977792 | 3300005559 | Soil | GRMTEAQKGALSREMSDKVEQVAELNARSRKYNLPSASAPER* |
| Ga0068854_1020179732 | 3300005578 | Corn Rhizosphere | HMTEAQKGALSRETSEKVEQVDELNARSRKYNLPSASAPER* |
| Ga0066706_109868852 | 3300005598 | Soil | TGRMTEAQKGALSREMSDKVEQVEELNARSRKYNLPPASAPER* |
| Ga0066706_114387111 | 3300005598 | Soil | TGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0068860_1010549911 | 3300005843 | Switchgrass Rhizosphere | MIEAQKVALSRETAAKVEQAEELNVRSRRYNLPTASASER* |
| Ga0075023_1005722671 | 3300006041 | Watersheds | KATGRSAEAQKTALGADTTRKVQRVDELNARSRKYNLPGSGSASER* |
| Ga0075029_1000480401 | 3300006052 | Watersheds | TGRMTEAQKGALSPETAAKVEHVEELNARSRKYNLPIASTSER* |
| Ga0075029_1006587012 | 3300006052 | Watersheds | LQATGQIAEAQKGALSRATVEKVERVEELNALSRKYNLPSASASER* |
| Ga0075030_1003733404 | 3300006162 | Watersheds | ELKATGRMTQAQRGALSRETSEKVERVEELNARSRKYNLPSPSASER* |
| Ga0097621_1001948182 | 3300006237 | Miscanthus Rhizosphere | TGRMTEAQKGSLSREMSDKVEQVAELNARSRKYNLPSASAPER* |
| Ga0097621_1019717792 | 3300006237 | Miscanthus Rhizosphere | EAQKGALSRETSDKVEQVAELNARSRKYNLPSASTPER* |
| Ga0066665_111967061 | 3300006796 | Soil | GSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0075425_1010363471 | 3300006854 | Populus Rhizosphere | GSLSREMSDKVEQVEELNARSRKYNLPRPSAPER* |
| Ga0068865_1011484301 | 3300006881 | Miscanthus Rhizosphere | EAQKGALSRETSDKVEQVADLNARSRKYNLPSASAPER* |
| Ga0099791_101061601 | 3300007255 | Vadose Zone Soil | TGRMTEAQKGAVSRATRDKVEQVEELDARARKYNLPKAMASGSGAER* |
| Ga0066710_1002919624 | 3300009012 | Grasslands Soil | LAELKATGRMTEAQKGAVSRATREKVEQVEELNARARKYNLPSGSGSER |
| Ga0066710_1007294173 | 3300009012 | Grasslands Soil | TAAAKGALGRETAEKVVQVAELNARARKYNLPSASAPER |
| Ga0066710_1017585911 | 3300009012 | Grasslands Soil | RALAELKATGRMTEAQKGAVSRAMREKVEQVEELDARARKYNLPRATATGSGAER |
| Ga0099828_110611971 | 3300009089 | Vadose Zone Soil | MTAAQKGALGRETAEKLEHVEELNARSRKYNLPRASAPER* |
| Ga0111539_109067372 | 3300009094 | Populus Rhizosphere | MTEAQKGALSRETSEKVEQVDELNARSRKYNLPSASAPER* |
| Ga0105245_130744741 | 3300009098 | Miscanthus Rhizosphere | QSLGRIESHGRMTEAQKGALSRETAAKVEQVEELNARSLKYNLPIASASER* |
| Ga0111538_106054791 | 3300009156 | Populus Rhizosphere | KGALSRETADKVERVEELNARSRKYNLPTASAAERQP* |
| Ga0105242_116064702 | 3300009176 | Miscanthus Rhizosphere | MAAAAKGALSREMSDKVEQDEQVNARSRKYNLRSTSAPER* |
| Ga0116214_13156272 | 3300009520 | Peatlands Soil | MTEAQKGALGRATVEKVERVEELNARSRKYNLPSGSASER* |
| Ga0126374_102390623 | 3300009792 | Tropical Forest Soil | ATGRMTDAQKGALNRATMEKVEQVDELNARARKYNLPSGSGSER* |
| Ga0116219_100712191 | 3300009824 | Peatlands Soil | KGALGRATVEKVERVEELNARSRKYNLPSGSASER* |
| Ga0126380_103821322 | 3300010043 | Tropical Forest Soil | MTEAQKGALNREMSDKVEQVAELNARSRKYNLPAASAPER* |
| Ga0134088_100014861 | 3300010304 | Grasslands Soil | LKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0134088_102614991 | 3300010304 | Grasslands Soil | LKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSGSAPERQ* |
| Ga0134063_107190072 | 3300010335 | Grasslands Soil | LVELKATGQMTAAGKASLSREMAAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0126370_117853382 | 3300010358 | Tropical Forest Soil | KATGQMAVANRGALSRETSEKVEHVEELNARSRKYNLPSPSAPERQ* |
| Ga0126372_102726431 | 3300010360 | Tropical Forest Soil | ELKGTGRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASAPER* |
| Ga0126378_103411861 | 3300010361 | Tropical Forest Soil | ALAELKGTGRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER* |
| Ga0126377_110229261 | 3300010362 | Tropical Forest Soil | IDRALAELKATGRMVEAQKGAVSRATRDKVEQVEELNARARKYNLPVGTASGSGAER* |
| Ga0126377_116427941 | 3300010362 | Tropical Forest Soil | ELKTTGRMAEAQKGALSEEISDKVEQVDELNTRSRKYNLPRASAPERP* |
| Ga0126379_133629291 | 3300010366 | Tropical Forest Soil | KGALNRATMEKVEQVEELNARSRKYNLPSGTASER* |
| Ga0126383_122473893 | 3300010398 | Tropical Forest Soil | LKATGRMTEAQKSALSPQTAAKVEQAEEVNARSRKYNLPIASASER* |
| Ga0134127_103443295 | 3300010399 | Terrestrial Soil | AEAQKGALGDAMSDKIEQVAELNARSAKYNLPKASAPERPNAK* |
| Ga0134122_115992122 | 3300010400 | Terrestrial Soil | GALSEEVSDKVEQVEELNTRSRKYNLPRASAPERP* |
| Ga0134123_115473662 | 3300010403 | Terrestrial Soil | LKTTGRMTEAQKGALSREMAAKVEQIEELNALSRKYNLPTASASER* |
| Ga0137393_107526021 | 3300011271 | Vadose Zone Soil | QKGALSRETSRKVERVEELNARSRKYNLPSASASER* |
| Ga0137444_10317361 | 3300011397 | Soil | HMTAAAKGALGRETAEKVEQVEELNARSRKYNLPSASAPER* |
| Ga0137422_11321922 | 3300011416 | Soil | EAQKGALSRETAAKVEQVEELNARSRKYNLPIASTSER* |
| Ga0137326_10545792 | 3300011417 | Soil | TEAQKGALGRETAEKIEQVEELNARSRKYNLPSASAPER* |
| Ga0137425_11161412 | 3300011422 | Soil | RMAEAQKGALSRETAEKIEQVEELNARSRKYNLPSASAPER* |
| Ga0137423_10089405 | 3300011430 | Soil | ELKATGRMTEAQKGALSRETAAKVEQVEDLNARSRKYNLPIASASER* |
| Ga0137426_11322172 | 3300011435 | Soil | ELKATGRMAEAQKGALSRETAAKVEQVEELNARSRKYNLPIASTSER* |
| Ga0137463_11985472 | 3300011444 | Soil | MTEAQKGALNRETSEKVERVEELNTRARKYNLPAASSGPER* |
| Ga0137330_10462932 | 3300012134 | Soil | GALGRETAEKVEQVEELNARSRKYNLPRASAPER* |
| Ga0137327_10777132 | 3300012173 | Soil | ELKATGRMTEAQKGALGRETAEKIEQVEELNARSRKYNLPSASAPER* |
| Ga0137388_114118102 | 3300012189 | Vadose Zone Soil | RMTEAQKGALSRETSRKVERVEELNARSRKYNLPIASASER* |
| Ga0137383_110390651 | 3300012199 | Vadose Zone Soil | AEKGSLSRETSAKVEQVEELNARSRKYSLPNASAPER* |
| Ga0137399_110634471 | 3300012203 | Vadose Zone Soil | KGALSQQMAAKVEQVEELNARSRKYNLPVASVSER* |
| Ga0137362_117492201 | 3300012205 | Vadose Zone Soil | TQKGALSRATVEKVERVEELNALSRKYNLPSASASER* |
| Ga0137380_104749311 | 3300012206 | Vadose Zone Soil | ALAELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0137381_107185501 | 3300012207 | Vadose Zone Soil | ALTETLATGRMVEAQKGALNRETSEKVERVEELNARSRKYNLPAASGPER* |
| Ga0137370_104944191 | 3300012285 | Vadose Zone Soil | RMTEAQKGVLSRATLEKVERVEELNARSRKYNLPIASASER* |
| Ga0137387_109666191 | 3300012349 | Vadose Zone Soil | AGKGSLGRETAAKVEQVEELNARSRKYNLPSGSAPER* |
| Ga0134060_10619841 | 3300012410 | Grasslands Soil | DKALAELKTTGQMTAAEKGSLSRETSAKVEQVEELNARSRKYNLPSASAPER* |
| Ga0157331_10372532 | 3300012486 | Soil | GALSRETSDKVEQVAELNARSRKYNLPSASTPER* |
| Ga0137397_109953851 | 3300012685 | Vadose Zone Soil | ATGRMTEAQKGALNRATSEKVERVEELNARSRKYNLPAASGPER* |
| Ga0157292_101729492 | 3300012900 | Soil | RMTEAQKGALSRETTEKVEQVEALNARSRKYNLPSASAPER* |
| Ga0137396_105184681 | 3300012918 | Vadose Zone Soil | KATGQMTTAAKAALGRETAEKLEHVEELNARSRKYNLPRASAPER* |
| Ga0137394_103617061 | 3300012922 | Vadose Zone Soil | QKGALSRETTEKVEQVEELNARSRKYNLPSASAPER* |
| Ga0137413_111059631 | 3300012924 | Vadose Zone Soil | QTTGKIPEAQKGALSRQVSDKVEQVEEINARAKKYNLPVGSATER* |
| Ga0137407_124313091 | 3300012930 | Vadose Zone Soil | AELKATGRMADAQKGALNRATMEKVEQVEELNARSRKYNLPSGSASER* |
| Ga0137410_114865442 | 3300012944 | Vadose Zone Soil | ETQKGALNRATVEKVERVEELNALSRKYNLPSGSAPER* |
| Ga0157378_130980041 | 3300013297 | Miscanthus Rhizosphere | EAQKGALNRATSDKVEQVEELIARARKYNLPAASGPER* |
| Ga0163162_132742491 | 3300013306 | Switchgrass Rhizosphere | KTALSRATSDKVEQVEELNARAAKYNLPKGSATER* |
| Ga0157375_132987651 | 3300013308 | Miscanthus Rhizosphere | LATTGRMTEAQKGALNRATSDKVEQVEQLNGRARKYNLPSASGPER* |
| Ga0181532_107100841 | 3300014164 | Bog | MTEAQKGALGRATVEKVERVEELNARSRKYNLPSASAPER* |
| Ga0181522_108925762 | 3300014657 | Bog | ATGGMAEAQKGALGRATAEKVERVEELNARSRKYNLPTASASER* |
| Ga0157379_111540342 | 3300014968 | Switchgrass Rhizosphere | AIDKALAELKATGRMVEAEKGAVSGATRDKVEQVEELNARARKYNLPIGTASGSGAKR* |
| Ga0157379_120325302 | 3300014968 | Switchgrass Rhizosphere | EAQKGALSREISDKVEQVEELNARAAKYNLPKGSATER* |
| Ga0157376_104530791 | 3300014969 | Miscanthus Rhizosphere | ELKTTGRMTEAQKGALSREMAAKVEQIEELNALSRKYNLPTASASER* |
| Ga0157376_108138162 | 3300014969 | Miscanthus Rhizosphere | GRMTDAQKGALNRETTDKIEQVDELNARSRKYNLPSASAPER* |
| Ga0180089_10701373 | 3300015254 | Soil | GRMIAAQKGALSRETSEKVEQVEELNARSRKYNLPSASAPER* |
| Ga0132258_124549821 | 3300015371 | Arabidopsis Rhizosphere | QMTAAQKAALGRETSDKVEQVDELNARSKKYNLPTASAPER* |
| Ga0132258_131410581 | 3300015371 | Arabidopsis Rhizosphere | ELKATGRMTEAQKGAVSRATREKVEQVAELDARARKYNLPKATASGSGAER* |
| Ga0132255_1013065452 | 3300015374 | Arabidopsis Rhizosphere | MTDAQKGALNRATSDKVEQVDELNGRSRKYNLPSASGPER* |
| Ga0132255_1056139741 | 3300015374 | Arabidopsis Rhizosphere | MTEAQKGSLIREMSDNVEQVEELNARSRKYNLPRPSAPER* |
| Ga0182036_116944151 | 3300016270 | Soil | AQKGALSPDTSRKVQRVEELNARSRKYNLPGTGSTSER |
| Ga0182032_108187541 | 3300016357 | Soil | KALVELKGTGRMTEAQKGTLSRATVDKIEQVEELNARSRKYNLPSGSASER |
| Ga0182037_108083311 | 3300016404 | Soil | TTESAKGALSRETFAKLEQVEELNARSRKYHLPSGSASER |
| Ga0182038_113500301 | 3300016445 | Soil | GALSPDTSRKVQRVEELNARSRKYNLPGTGSTSER |
| Ga0134069_13134881 | 3300017654 | Grasslands Soil | ALAELKTTGQMTAAEKGALSRETSAKVEQVEELNARSRKYNLPSASAPER |
| Ga0134083_106050611 | 3300017659 | Grasslands Soil | KGALSREVSDKVEQVTELNARSRKYNLPSASAPERP |
| Ga0184610_11944332 | 3300017997 | Groundwater Sediment | FAELKATGRMTEAQKGALSRETSEKIEHVEELNVRSRKYNLPRGSASERQ |
| Ga0184638_12664603 | 3300018052 | Groundwater Sediment | MTEAQKGALSEEISDKVEQVEELNTRSRKYNLPRASAPERQ |
| Ga0190268_123251052 | 3300018466 | Soil | VELKATGRMVEAQKGALNDATADKIEQVEELNARSVKYNLPRSSGREQR |
| Ga0066669_105909171 | 3300018482 | Grasslands Soil | LVELKATGRMTEAQKGTLSREMTDKVEQVEELNARSRKYNLPRASAPER |
| Ga0193753_103348301 | 3300020034 | Soil | TTGKIADAQKGALSRQTSDKVEQVEELNARSRKYNLPSGSATER |
| Ga0210379_101465872 | 3300021081 | Groundwater Sediment | RMTEAQKGALSRETAEKVEQVEELNARSRKYNLPSASAPER |
| Ga0210380_102080692 | 3300021082 | Groundwater Sediment | GQMTAAAKGALGRETAEKVEQVAELNARARKYNLPSASAPER |
| Ga0210394_114709702 | 3300021420 | Soil | KGALSRDMSEKVEHVEELNARSRKYNLPRASAAER |
| Ga0182009_108419672 | 3300021445 | Soil | AQKGALDRATTEKVEQVEELNRRSRKYNLPSGSGPER |
| Ga0210113_10694801 | 3300025796 | Natural And Restored Wetlands | MVEAQKGALNDATADKIEQVEELNARSVKYNLPRSSGREQR |
| Ga0207688_103045731 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | GRMTEAQKGALGRETAEKVEQVEELNARSRKYNLPSASAPER |
| Ga0207645_110822561 | 3300025907 | Miscanthus Rhizosphere | TTGRMTEAQKGALNRATSDKVEQVEQLNGRARKYNLPSASGPER |
| Ga0207663_106103212 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QKGALNRETTDKIEQVDELNARSRKYNLPSASAPER |
| Ga0207704_108848102 | 3300025938 | Miscanthus Rhizosphere | MTEAQKGALSRETSDKVEQVADLNARSRKYNLPSASAPER |
| Ga0207651_104485602 | 3300025960 | Switchgrass Rhizosphere | MTEAQKGALNRATSDKVEQVEQLNGRARKYNLPSASGPER |
| Ga0207641_112587701 | 3300026088 | Switchgrass Rhizosphere | QKGSLSREMSDKVEQVAELNARSRKYNLPSASAPER |
| Ga0207683_106364882 | 3300026121 | Miscanthus Rhizosphere | TGVIPNAQKTALSRVTSDKVEQVEELNARSAKYNLPKGSATER |
| Ga0209237_10398064 | 3300026297 | Grasslands Soil | EAQKGALSREASRKVERVEELNARSRKYNLPSASASER |
| Ga0209131_10214491 | 3300026320 | Grasslands Soil | AELKGTGRMTEAQKGALSRETSREVERVEELNARSRKYNLPSASASER |
| Ga0209131_12917671 | 3300026320 | Grasslands Soil | MTEAQKGALSRETAAKVEHVEELNARSRKYNLPIASASER |
| Ga0257165_10072761 | 3300026507 | Soil | TEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER |
| Ga0179587_107917381 | 3300026557 | Vadose Zone Soil | RMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER |
| Ga0209899_11155472 | 3300027490 | Groundwater Sand | GRMTEAQKGALSEEISDKVEQVEELNTRSRKYNLPRASAPER |
| Ga0209515_101197264 | 3300027835 | Groundwater | GSAKGALGRETSEKVERVEALNARSRKYNLPSASAPER |
| Ga0209693_103713602 | 3300027855 | Soil | LGELQATGQMTEAQKGALSRETSRKVEQVGELNARSRKYNLPSASASER |
| Ga0209067_108399851 | 3300027898 | Watersheds | TGQIAEAQKGALSRATVEKVERVEELNALSRKYNLPSASASER |
| Ga0307282_102538441 | 3300028784 | Soil | GRMTEAQKGALSREMSDKVEQVSELNARSRKYNLPSASAPER |
| Ga0302232_104244072 | 3300028789 | Palsa | GRMADAQKGALSRATVEKVEQVEELNARSRKYNLPSASSPER |
| Ga0307281_101148751 | 3300028803 | Soil | MTAAAKGALGRETAEKVEQVAELNARARKYNLPSASAPER |
| Ga0302179_103367142 | 3300030058 | Palsa | RMADAQKGALSRATVEKVEQVEELNARSRKYNLPSASSPER |
| Ga0302323_1028338712 | 3300031232 | Fen | TGRMTEAQKGALNRATREKIEQVEELNARARKYNLPGGSASEP |
| Ga0310888_109850461 | 3300031538 | Soil | KALTELKATGRMTEAQKGALSEEISGKVEQVDELNTRSRKYNLPRASAPER |
| Ga0310887_102953431 | 3300031547 | Soil | TTGRMTEAQKGALSRETADKVEQVEELNARSRKYNLPAASAPERQP |
| Ga0310915_109147802 | 3300031573 | Soil | LQATGRMAEAQKGALSRATSEKVERVEELNARSRKYNLPKASASER |
| Ga0307476_110718402 | 3300031715 | Hardwood Forest Soil | LTSTGRMAEAQKGALNRATSEKVEQVEELNARSRKYNLPGGSASER |
| Ga0307469_105855661 | 3300031720 | Hardwood Forest Soil | EAAKGSLSRESYAKVQQIEELDARSRKYHLPTAGSAPER |
| Ga0307469_111460532 | 3300031720 | Hardwood Forest Soil | MTEAQKGALSREMSDKVEQVAELNARSRKYNLPSASAPER |
| Ga0307469_119910961 | 3300031720 | Hardwood Forest Soil | GRMTEAQKGALNRETSDKVEQIEELNARARKYNLPRASAPEGR |
| Ga0307473_100122653 | 3300031820 | Hardwood Forest Soil | TTGRMTEAQKGALGRETTEKVEQVEELNARSRKYNLPSASAPER |
| Ga0310892_105781032 | 3300031858 | Soil | QKGALSEEISGKVEQVDELNTRSRKYNLPRASAPER |
| Ga0310901_102502091 | 3300031940 | Soil | LVELKTTGRMTEAQKGALSRETADKVEQVEELNARSRKYNLPAASAPERQP |
| Ga0318533_106878521 | 3300032059 | Soil | ELKGTGRMTEAQKGALSRETSRKVERVEELNARSRKYNLPSASASER |
| Ga0310889_102374462 | 3300032179 | Soil | MTEAQKGALGRETAEKVEQVEELNARSRKYNLPSASAPER |
| Ga0307472_1012453773 | 3300032205 | Hardwood Forest Soil | ALAELKATGRMTEAQKGAVSRATRDKVEQVEELDARARKYNLPIGTASGSGAER |
| Ga0348332_136280181 | 3300032515 | Plant Litter | ALAELQATGRMTEAQKGALNRATREKVEQVEDLNARARKYNLPSGSASEP |
| Ga0335069_111503141 | 3300032893 | Soil | MTDAQKGSLGRATSDKVEQVEELNARSRKYNLPSGSATER |
| Ga0310914_103117684 | 3300033289 | Soil | GRMAEAQKAALSRETSDKIEQVAELNTRSQKYNLPRGSAPER |
| Ga0310810_103803773 | 3300033412 | Soil | ELKTTGRMTEAQKGSLSREMSDKVEQVAELNARSRKYNLPSASAPER |
| Ga0326726_124072552 | 3300033433 | Peat Soil | AAAKGALGRETAEKVEQVAELNARARKYNLPSASTPER |
| ⦗Top⦘ |