


| Basic Information | |
|---|---|
| Family ID | F045796 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTLSYNSLQSLALSLVGALVASSLFLSAAVGPVPVI |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.72 % |
| % of genes near scaffold ends (potentially truncated) | 7.24 % |
| % of genes from short scaffolds (< 2000 bps) | 74.34 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.553 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (28.947 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.737 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.947 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF04024 | PspC | 48.03 |
| PF13561 | adh_short_C2 | 5.26 |
| PF00375 | SDF | 3.95 |
| PF11026 | DUF2721 | 3.29 |
| PF13545 | HTH_Crp_2 | 2.63 |
| PF07715 | Plug | 1.97 |
| PF01274 | Malate_synthase | 1.97 |
| PF00578 | AhpC-TSA | 1.32 |
| PF06127 | Mpo1-like | 1.32 |
| PF09836 | DUF2063 | 1.32 |
| PF09411 | PagL | 1.32 |
| PF06841 | Phage_T4_gp19 | 0.66 |
| PF06736 | TMEM175 | 0.66 |
| PF04055 | Radical_SAM | 0.66 |
| PF07498 | Rho_N | 0.66 |
| PF13439 | Glyco_transf_4 | 0.66 |
| PF12902 | Ferritin-like | 0.66 |
| PF07681 | DoxX | 0.66 |
| PF01189 | Methyltr_RsmB-F | 0.66 |
| PF00194 | Carb_anhydrase | 0.66 |
| PF03544 | TonB_C | 0.66 |
| PF02586 | SRAP | 0.66 |
| PF00271 | Helicase_C | 0.66 |
| PF08309 | LVIVD | 0.66 |
| PF07896 | DUF1674 | 0.66 |
| PF00345 | PapD_N | 0.66 |
| PF00144 | Beta-lactamase | 0.66 |
| PF06348 | DUF1059 | 0.66 |
| PF01755 | Glyco_transf_25 | 0.66 |
| PF14219 | DUF4328 | 0.66 |
| PF05114 | DUF692 | 0.66 |
| PF09966 | DUF2200 | 0.66 |
| PF13520 | AA_permease_2 | 0.66 |
| PF12760 | Zn_Tnp_IS1595 | 0.66 |
| PF12697 | Abhydrolase_6 | 0.66 |
| PF05960 | DUF885 | 0.66 |
| PF06242 | TrcR | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG2225 | Malate synthase | Energy production and conversion [C] | 1.97 |
| COG3121 | P pilus assembly protein, chaperone PapD | Extracellular structures [W] | 1.32 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 1.32 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.66 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.66 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.66 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.66 |
| COG3220 | Uncharacterized conserved protein, UPF0276 family | Function unknown [S] | 0.66 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| COG3338 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.66 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.66 |
| COG3820 | Cell cycle regulator TrcR, DUF1013 family | Transcription [K] | 0.66 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.66 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.66 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.66 |
| COG5508 | Uncharacterized conserved protein, DUF1674 domain | Function unknown [S] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.55 % |
| Unclassified | root | N/A | 41.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10203653 | Not Available | 1333 | Open in IMG/M |
| 3300001989|JGI24739J22299_10058130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1229 | Open in IMG/M |
| 3300002184|JGI24770J26754_10018689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3731 | Open in IMG/M |
| 3300005334|Ga0068869_101045272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 713 | Open in IMG/M |
| 3300005355|Ga0070671_100938020 | Not Available | 757 | Open in IMG/M |
| 3300005543|Ga0070672_100552863 | Not Available | 1000 | Open in IMG/M |
| 3300005548|Ga0070665_100000317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 74997 | Open in IMG/M |
| 3300005564|Ga0070664_101960253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 556 | Open in IMG/M |
| 3300005719|Ga0068861_102095380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 565 | Open in IMG/M |
| 3300005843|Ga0068860_100504023 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300006031|Ga0066651_10001442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 8170 | Open in IMG/M |
| 3300006353|Ga0075370_10377661 | Not Available | 849 | Open in IMG/M |
| 3300006871|Ga0075434_100265297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1736 | Open in IMG/M |
| 3300007004|Ga0079218_13319789 | Not Available | 545 | Open in IMG/M |
| 3300009078|Ga0105106_11331930 | Not Available | 509 | Open in IMG/M |
| 3300009094|Ga0111539_11554347 | Not Available | 767 | Open in IMG/M |
| 3300009094|Ga0111539_11705907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300009098|Ga0105245_10067230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3245 | Open in IMG/M |
| 3300009098|Ga0105245_10625604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300009098|Ga0105245_12052808 | Not Available | 625 | Open in IMG/M |
| 3300009148|Ga0105243_10514201 | Not Available | 1137 | Open in IMG/M |
| 3300009176|Ga0105242_11759605 | Not Available | 657 | Open in IMG/M |
| 3300009553|Ga0105249_12150032 | Not Available | 631 | Open in IMG/M |
| 3300010051|Ga0133939_1041623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 8095 | Open in IMG/M |
| 3300010333|Ga0134080_10510298 | Not Available | 573 | Open in IMG/M |
| 3300010371|Ga0134125_12728627 | Not Available | 537 | Open in IMG/M |
| 3300010399|Ga0134127_12038818 | Not Available | 652 | Open in IMG/M |
| 3300010399|Ga0134127_12955294 | Not Available | 554 | Open in IMG/M |
| 3300010400|Ga0134122_11685636 | Not Available | 661 | Open in IMG/M |
| 3300010400|Ga0134122_12033518 | Not Available | 614 | Open in IMG/M |
| 3300010401|Ga0134121_10556797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium | 1066 | Open in IMG/M |
| 3300010874|Ga0136264_10367729 | Not Available | 524 | Open in IMG/M |
| 3300011119|Ga0105246_10501011 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300011196|Ga0137482_100334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8007 | Open in IMG/M |
| 3300011198|Ga0137472_100753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1949 | Open in IMG/M |
| 3300011244|Ga0137483_102524 | Not Available | 2103 | Open in IMG/M |
| 3300011443|Ga0137457_1104495 | Not Available | 903 | Open in IMG/M |
| 3300012208|Ga0137376_11377484 | Not Available | 596 | Open in IMG/M |
| 3300012212|Ga0150985_104776044 | Not Available | 591 | Open in IMG/M |
| 3300012212|Ga0150985_120476194 | Not Available | 926 | Open in IMG/M |
| 3300012668|Ga0157216_10009848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5237 | Open in IMG/M |
| 3300012892|Ga0157294_10226827 | Not Available | 563 | Open in IMG/M |
| 3300012943|Ga0164241_10189984 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300012958|Ga0164299_11178093 | Not Available | 578 | Open in IMG/M |
| 3300012989|Ga0164305_10480706 | Not Available | 972 | Open in IMG/M |
| 3300013297|Ga0157378_12745934 | Not Available | 545 | Open in IMG/M |
| 3300013308|Ga0157375_11248358 | Not Available | 872 | Open in IMG/M |
| 3300014325|Ga0163163_11810342 | Not Available | 671 | Open in IMG/M |
| 3300014325|Ga0163163_11858845 | Not Available | 662 | Open in IMG/M |
| 3300014326|Ga0157380_10958063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 886 | Open in IMG/M |
| 3300014969|Ga0157376_11637636 | Not Available | 678 | Open in IMG/M |
| 3300015064|Ga0167641_109216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1172 | Open in IMG/M |
| 3300015067|Ga0167640_109719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 907 | Open in IMG/M |
| 3300015069|Ga0167633_100120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 37799 | Open in IMG/M |
| 3300015161|Ga0167623_1055993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 750 | Open in IMG/M |
| 3300015168|Ga0167631_1029217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 885 | Open in IMG/M |
| 3300015189|Ga0167667_1005627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3983 | Open in IMG/M |
| 3300015371|Ga0132258_10731565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2492 | Open in IMG/M |
| 3300015371|Ga0132258_11489292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1709 | Open in IMG/M |
| 3300015374|Ga0132255_102868047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 737 | Open in IMG/M |
| 3300017792|Ga0163161_10937366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087 | 736 | Open in IMG/M |
| 3300017965|Ga0190266_10000528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 6384 | Open in IMG/M |
| 3300018422|Ga0190265_10000200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 56003 | Open in IMG/M |
| 3300018422|Ga0190265_10001317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 16197 | Open in IMG/M |
| 3300018422|Ga0190265_10002832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 11721 | Open in IMG/M |
| 3300018422|Ga0190265_10056931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3449 | Open in IMG/M |
| 3300018422|Ga0190265_10098595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2731 | Open in IMG/M |
| 3300018422|Ga0190265_10233622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1875 | Open in IMG/M |
| 3300018422|Ga0190265_10580425 | Not Available | 1239 | Open in IMG/M |
| 3300018422|Ga0190265_10666633 | Not Available | 1161 | Open in IMG/M |
| 3300018422|Ga0190265_10776296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300018422|Ga0190265_10822855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1051 | Open in IMG/M |
| 3300018422|Ga0190265_10866254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300018429|Ga0190272_10060934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2238 | Open in IMG/M |
| 3300018429|Ga0190272_10213273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1409 | Open in IMG/M |
| 3300018429|Ga0190272_10227313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1377 | Open in IMG/M |
| 3300018429|Ga0190272_10448557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1074 | Open in IMG/M |
| 3300018429|Ga0190272_10738823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 894 | Open in IMG/M |
| 3300018429|Ga0190272_10996148 | Not Available | 799 | Open in IMG/M |
| 3300018429|Ga0190272_11581223 | Not Available | 671 | Open in IMG/M |
| 3300018429|Ga0190272_11927628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300018432|Ga0190275_10000015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 287251 | Open in IMG/M |
| 3300018432|Ga0190275_10000352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 43086 | Open in IMG/M |
| 3300018465|Ga0190269_10156769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium | 1185 | Open in IMG/M |
| 3300018469|Ga0190270_12084085 | Not Available | 626 | Open in IMG/M |
| 3300018476|Ga0190274_10000220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 38564 | Open in IMG/M |
| 3300018476|Ga0190274_10642989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella | 1095 | Open in IMG/M |
| 3300018476|Ga0190274_11663386 | Not Available | 732 | Open in IMG/M |
| 3300018481|Ga0190271_11357511 | Not Available | 830 | Open in IMG/M |
| 3300018920|Ga0190273_11822555 | Not Available | 555 | Open in IMG/M |
| 3300019208|Ga0180110_1097874 | Not Available | 573 | Open in IMG/M |
| 3300019360|Ga0187894_10000007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 405218 | Open in IMG/M |
| 3300019360|Ga0187894_10000398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 58544 | Open in IMG/M |
| 3300019361|Ga0173482_10442771 | Not Available | 615 | Open in IMG/M |
| 3300019377|Ga0190264_10093047 | Not Available | 1387 | Open in IMG/M |
| 3300020027|Ga0193752_1011699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4565 | Open in IMG/M |
| 3300020027|Ga0193752_1122379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087 | 1044 | Open in IMG/M |
| 3300020027|Ga0193752_1182875 | Not Available | 806 | Open in IMG/M |
| 3300020034|Ga0193753_10162578 | Not Available | 1053 | Open in IMG/M |
| 3300020059|Ga0193745_1000005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 267691 | Open in IMG/M |
| 3300020202|Ga0196964_10102525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella | 1261 | Open in IMG/M |
| 3300021061|Ga0196973_1056756 | Not Available | 753 | Open in IMG/M |
| 3300021067|Ga0196978_1001856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8562 | Open in IMG/M |
| 3300021339|Ga0193706_1129971 | Not Available | 686 | Open in IMG/M |
| 3300025315|Ga0207697_10227427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Parasphingorhabdus → Parasphingorhabdus marina → Parasphingorhabdus marina DSM 22363 | 823 | Open in IMG/M |
| 3300025893|Ga0207682_10000998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13085 | Open in IMG/M |
| 3300025893|Ga0207682_10162785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. ERG5 | 1012 | Open in IMG/M |
| 3300025901|Ga0207688_10294403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 991 | Open in IMG/M |
| 3300025903|Ga0207680_11050578 | Not Available | 583 | Open in IMG/M |
| 3300025907|Ga0207645_10465205 | Not Available | 854 | Open in IMG/M |
| 3300025923|Ga0207681_10318946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300025923|Ga0207681_10749774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sphingosinicella → unclassified Sphingosinicella → Sphingosinicella sp. CPCC 101087 | 814 | Open in IMG/M |
| 3300025926|Ga0207659_11010523 | Not Available | 716 | Open in IMG/M |
| 3300025927|Ga0207687_11226419 | Not Available | 645 | Open in IMG/M |
| 3300025930|Ga0207701_11284902 | Not Available | 600 | Open in IMG/M |
| 3300025935|Ga0207709_10273256 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300025941|Ga0207711_10491035 | Not Available | 1144 | Open in IMG/M |
| 3300025942|Ga0207689_10172844 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300025960|Ga0207651_10329514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → Novosphingobium resinovorum | 1279 | Open in IMG/M |
| 3300025972|Ga0207668_10154125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1783 | Open in IMG/M |
| 3300026306|Ga0209468_1005306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5044 | Open in IMG/M |
| 3300027907|Ga0207428_11211571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300028379|Ga0268266_10000388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 66871 | Open in IMG/M |
| 3300028380|Ga0268265_10390155 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300028578|Ga0272482_10013960 | Not Available | 2010 | Open in IMG/M |
| 3300028578|Ga0272482_10077602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 913 | Open in IMG/M |
| 3300028590|Ga0247823_10627082 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300028596|Ga0247821_10310706 | Not Available | 963 | Open in IMG/M |
| 3300028802|Ga0307503_10000015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 206343 | Open in IMG/M |
| 3300031228|Ga0299914_10522675 | Not Available | 1023 | Open in IMG/M |
| 3300031229|Ga0299913_10003962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 12317 | Open in IMG/M |
| 3300031455|Ga0307505_10030563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2438 | Open in IMG/M |
| 3300031455|Ga0307505_10346443 | Not Available | 701 | Open in IMG/M |
| 3300031456|Ga0307513_10167417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2080 | Open in IMG/M |
| 3300031456|Ga0307513_10484052 | Not Available | 957 | Open in IMG/M |
| 3300031548|Ga0307408_100717779 | Not Available | 900 | Open in IMG/M |
| 3300031824|Ga0307413_10059868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2342 | Open in IMG/M |
| 3300032004|Ga0307414_10371081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1234 | Open in IMG/M |
| 3300032004|Ga0307414_10979810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 778 | Open in IMG/M |
| 3300032005|Ga0307411_10741283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 860 | Open in IMG/M |
| 3300032075|Ga0310890_11386658 | Not Available | 577 | Open in IMG/M |
| 3300032205|Ga0307472_100334547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1235 | Open in IMG/M |
| 3300032896|Ga0335075_10000067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 215320 | Open in IMG/M |
| 3300032896|Ga0335075_10723177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 952 | Open in IMG/M |
| 3300034006|Ga0334934_006018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1618 | Open in IMG/M |
| 3300034006|Ga0334934_016257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
| 3300034134|Ga0334928_138934 | Not Available | 503 | Open in IMG/M |
| 3300034169|Ga0370480_0253804 | Not Available | 593 | Open in IMG/M |
| 3300034195|Ga0370501_0386833 | Not Available | 511 | Open in IMG/M |
| 3300034251|Ga0334947_001471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 6597 | Open in IMG/M |
| 3300034965|Ga0370497_0000001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 865326 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 28.95% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 6.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.97% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.32% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 1.32% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.32% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.32% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.32% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.32% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.66% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.66% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010874 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011196 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 17 - S13.2.60.2.a - transect 2, repeat 2, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300011198 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 7 - S13.1.40.a - transect 1, age 29 years, surface depth) | Environmental | Open in IMG/M |
| 3300011244 | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth) | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015064 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015067 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021061 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5-13C | Environmental | Open in IMG/M |
| 3300021067 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13C | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300034006 | Biocrust microbial communities from Mojave Desert, California, United States - 30SMC | Environmental | Open in IMG/M |
| 3300034134 | Biocrust microbial communities from Mojave Desert, California, United States - 24HNC | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034251 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 43SMS | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_102036532 | 3300001686 | Soil | MSLSIHNIQALALSVIGAVLASSLFLSAAVGPVPVI* |
| JGI24739J22299_100581302 | 3300001989 | Corn Rhizosphere | MTISFNTMQSLAISLVGALVASSLFLSAAVGPVPMI* |
| JGI24770J26754_100186895 | 3300002184 | Freshwater And Sediment | MTVSYNLQKLALSVFGALVASSLFLAAAVGPVPVI* |
| Ga0068869_1010452721 | 3300005334 | Miscanthus Rhizosphere | RYEMTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI* |
| Ga0070671_1009380201 | 3300005355 | Switchgrass Rhizosphere | MTYSLNSLQTLAFSLVGALVASSLFLSAAVGPADDLIPLTR |
| Ga0070672_1005528633 | 3300005543 | Miscanthus Rhizosphere | MSTYANLYNVAFSIVGALFASTLFISAAVGPVQVI* |
| Ga0070665_10000031769 | 3300005548 | Switchgrass Rhizosphere | MSVSFNLQKLALSVFGALVASSLFLTAALGPVPVI* |
| Ga0070664_1019602532 | 3300005564 | Corn Rhizosphere | MTLSYNSLQSLALSLVGALVASSLFLSAAVGPVPMI* |
| Ga0068861_1020953801 | 3300005719 | Switchgrass Rhizosphere | RRYEMTLSINSLQSLAISLVGALVASSLFLSAAVGPVPVI* |
| Ga0068860_1005040233 | 3300005843 | Switchgrass Rhizosphere | MTVSYNLQKLVLSVFGALVASSLFLTAAVGPVPVI* |
| Ga0066651_100014421 | 3300006031 | Soil | MTLSIHSLQTLAFSLVGALVASSLFLSAAIGPVPVI* |
| Ga0075370_103776613 | 3300006353 | Populus Endosphere | MTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI* |
| Ga0075434_1002652971 | 3300006871 | Populus Rhizosphere | MTLSINSLQTLTISLFGALVASSLFLSAAVGPVPVL* |
| Ga0079218_133197892 | 3300007004 | Agricultural Soil | MTLSYANLHQIAYSILGALFASSLFISAAVGPVPVI* |
| Ga0105106_113319301 | 3300009078 | Freshwater Sediment | MSISYANLQSLVVSVIGAVLASSLFISAAGSVPIV* |
| Ga0111539_115543472 | 3300009094 | Populus Rhizosphere | MKMSIYANLYNVAFSIVGALFASTLFISAAVGPVQVI* |
| Ga0111539_117059071 | 3300009094 | Populus Rhizosphere | SDGPVARFRRMKMSISYANLYNVAFSIVGALFASSLFISAAVGPVQII* |
| Ga0105245_100672304 | 3300009098 | Miscanthus Rhizosphere | MSLSINSLQSLAISLVGALVASSLFLSAAVGPVPVI* |
| Ga0105245_106256042 | 3300009098 | Miscanthus Rhizosphere | MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQIV* |
| Ga0105245_120528082 | 3300009098 | Miscanthus Rhizosphere | MSLSINSLQSLAISLIGALVASSLFLSAAVGPVPVI* |
| Ga0105243_105142011 | 3300009148 | Miscanthus Rhizosphere | MTLSINSLQSLAISLVGALVASSLFLSAAIGPVPQVL* |
| Ga0105242_117596053 | 3300009176 | Miscanthus Rhizosphere | MTLSINSLQSLALSFVGALVASSLFLSAAVGPVPTII* |
| Ga0105249_121500322 | 3300009553 | Switchgrass Rhizosphere | MKMSISYANLYSVAFSIVGALFASSLFISAAVGPVQII* |
| Ga0133939_10416239 | 3300010051 | Industrial Wastewater | MSVSLPSLQNLTLSVVGAVIASSLFLSAALSSAPIL* |
| Ga0134080_105102981 | 3300010333 | Grasslands Soil | MTLSLNTLQTLTVSLVGALVASSLFLSAAVGPVPII* |
| Ga0134125_127286272 | 3300010371 | Terrestrial Soil | MTLSINTMQSLAISLVGALVASSLFLSAAVGPVPAII* |
| Ga0134127_120388182 | 3300010399 | Terrestrial Soil | MTLSYSNLQSLAVSVVGALLAASLFVSAAVGPVPIV* |
| Ga0134127_129552941 | 3300010399 | Terrestrial Soil | MTLSINSLQSLAISLVGALVASSLFLSAAVGPVPMI* |
| Ga0134122_116856362 | 3300010400 | Terrestrial Soil | MSISINSLQSLAISLVGALVASSLFLSAAIGPVPVI* |
| Ga0134122_120335183 | 3300010400 | Terrestrial Soil | MTLSINTMQSLAISLVGALVASSLFLSAAVGPVPVI* |
| Ga0134121_105567972 | 3300010401 | Terrestrial Soil | MTLSYSNLQSLAVSVIGAMLAASLFVSAAIGPVPIV* |
| Ga0136264_103677292 | 3300010874 | Soil | RYQMSLSIQNLQSLAVSLVGAVLVSSLFLSAAMGPVSVI* |
| Ga0105246_105010112 | 3300011119 | Miscanthus Rhizosphere | MTLSLNSLQSLALSFVGALVASSLFLSAAVGPVPMI* |
| Ga0137482_1003345 | 3300011196 | Glacier Forefield Soil | MTLSYSNLQQLAVSLIGAIVASSLFISAAVGPVPIV* |
| Ga0137472_1007533 | 3300011198 | Glacier Forefield Soil | MTLSINLQKLALSVFGALVASSLFISAAVGPVSVI* |
| Ga0137483_1025243 | 3300011244 | Glacier Forefield Soil | MSISLTSLQSLAVSLIGAIVASSLLLSAAMGPVPIV* |
| Ga0137457_11044952 | 3300011443 | Soil | MKMSIYANLYNVAFSIVGALFASSLFISAAVGPVPVI* |
| Ga0137376_113774842 | 3300012208 | Vadose Zone Soil | MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQII* |
| Ga0150985_1047760443 | 3300012212 | Avena Fatua Rhizosphere | MTLSLNTLQTLTVSLVGALVASSLFLSAAIGPVPII* |
| Ga0150985_1204761944 | 3300012212 | Avena Fatua Rhizosphere | MTLSLNTMQSLALSLVGALVASSLFLSAAMGPVQIV* |
| Ga0157216_100098487 | 3300012668 | Glacier Forefield Soil | MSLSIHGLQSLAISMIGAVFASSLFLSAALSSAPVI* |
| Ga0157294_102268271 | 3300012892 | Soil | MTLSYSNLQALTVSVVGALLAASLFVSAAVGPVPIV* |
| Ga0164241_101899841 | 3300012943 | Soil | MTVSYNLQKLLLSAFGALVASSLFLTAAMGPVPVI* |
| Ga0164299_111780931 | 3300012958 | Soil | MTLSINTLQTLTVSLVGALVASSLFLSAVIGPVSMV* |
| Ga0164305_104807062 | 3300012989 | Soil | MTVSYNLQKLALSVFGALVASSLFLTAAVGPVPVI* |
| Ga0157378_127459341 | 3300013297 | Miscanthus Rhizosphere | MSLSINGLQSLAISLIGALVASSLFLSAAVGPVPVI* |
| Ga0157375_112483581 | 3300013308 | Miscanthus Rhizosphere | MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQVV* |
| Ga0163163_118103421 | 3300014325 | Switchgrass Rhizosphere | MTLSYNSLQSLALSLVGALVASSLFLSAAVGPVPVI* |
| Ga0163163_118588451 | 3300014325 | Switchgrass Rhizosphere | MTYSLNSLQTLAFSLVGALVASSHFLSAAVGPVPMI* |
| Ga0157380_109580631 | 3300014326 | Switchgrass Rhizosphere | MSITFNLQKLALSVFGALVASSLFLTAAVGPVPVI* |
| Ga0157376_116376361 | 3300014969 | Miscanthus Rhizosphere | SRSRRYEMTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI* |
| Ga0167641_1092161 | 3300015064 | Glacier Forefield Soil | MSLSIHSLQSLAISLVGAIVASSLFLSAAVGPVPVI* |
| Ga0167640_1097194 | 3300015067 | Glacier Forefield Soil | MTLSFNMQKLALSVFGALLASSLFLSAAIGPVPVI* |
| Ga0167633_10012015 | 3300015069 | Glacier Forefield Soil | MTLSFNLQQLAVSVIGALLASSLFISAAIGPVPII* |
| Ga0167623_10559933 | 3300015161 | Glacier Forefield Soil | MSLSIQSLQSLAISLIGAFVASSLFLSAAIGPVPVI* |
| Ga0167631_10292172 | 3300015168 | Glacier Forefield Soil | MTLSFNMQKLALSVFGALVASSLFLSAAIGPVPIA* |
| Ga0167667_10056274 | 3300015189 | Glacier Forefield Soil | MTLSINLQKLTLSVFGALVASSLFISAAVGPVPVI* |
| Ga0132258_107315653 | 3300015371 | Arabidopsis Rhizosphere | MSISIHSLQTMAVSLIGALVASSLFLSAAVGPVPVI* |
| Ga0132258_114892923 | 3300015371 | Arabidopsis Rhizosphere | MSISIHNLQTMAVSLIGALVASSLFLSAAVGPVPVI* |
| Ga0132255_1028680472 | 3300015374 | Arabidopsis Rhizosphere | MTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPII* |
| Ga0163161_109373662 | 3300017792 | Switchgrass Rhizosphere | MTVSYNLQKLVLSVFGALVASSLFLTAAMGPVQVI |
| Ga0190266_1000052813 | 3300017965 | Soil | MTLSIHSLQTMAFSLIGALVASSLFLSAAIGPVPVI |
| Ga0190265_1000020057 | 3300018422 | Soil | MTLSFNIQQLAFSVIGALVASSLFISAAVGPVPVI |
| Ga0190265_100013174 | 3300018422 | Soil | MTFSYANIQQMALSVIGALVASSLFISAAVGPVPIL |
| Ga0190265_1000283219 | 3300018422 | Soil | MTLSFNSLQQLVVSAIGAVLVSTLFISAAIGPVPIV |
| Ga0190265_100569313 | 3300018422 | Soil | MTLSFNLQQLAVSVIGALVASSLFISAAVGPVPII |
| Ga0190265_100985955 | 3300018422 | Soil | MTLNLTSLQQIAFSVVGALFASSLFLTAAIGPVPIV |
| Ga0190265_102336223 | 3300018422 | Soil | MTLSYSTLQQLAVSVIGALVASSLFISAAIGPVPII |
| Ga0190265_105804254 | 3300018422 | Soil | MTISLNIQQLAVSLIGALVASSLFISAAVGPVPVI |
| Ga0190265_106666331 | 3300018422 | Soil | MSVSFNLQKLALSVFGALVASSLFLTAAVGPVPIV |
| Ga0190265_107762961 | 3300018422 | Soil | MSLSIHSLQSLAISLIGAVFASSLFLSAALSSAPVI |
| Ga0190265_108228552 | 3300018422 | Soil | MTLSYANLHQIAYSILGALFASSLFISAAVGPVPVI |
| Ga0190265_108662542 | 3300018422 | Soil | MTLSYASLHQIAFSVLGALFASTLFISAAVGPVPVI |
| Ga0190272_100609344 | 3300018429 | Soil | MTLSINLQKLALSVFGALVASSLFLSAAVGPAQVI |
| Ga0190272_102132733 | 3300018429 | Soil | MTLSYNMQQLALSVIGALVASSLFISAAVGPVPVI |
| Ga0190272_102273133 | 3300018429 | Soil | MTLSLNIQQLAVSVLGALVASSLFISAAVGPVPVI |
| Ga0190272_104485573 | 3300018429 | Soil | MTLSYSNLQQLAVSLIGAIVASSLFISAAVGPVPIV |
| Ga0190272_107388231 | 3300018429 | Soil | MTVSLNLQKLALSVFGALVASSLFLTAAVGPVPVI |
| Ga0190272_109961483 | 3300018429 | Soil | MTMSYNFSQLMVSLVGALIASSLFITAAVGPVPII |
| Ga0190272_115812232 | 3300018429 | Soil | MTLSYANMQQLALSVIGALVASSLFISAAVGPVPII |
| Ga0190272_119276283 | 3300018429 | Soil | TMTLSINLQKLALSVFGALVASSLFLSAAVGPVQVI |
| Ga0190275_10000015152 | 3300018432 | Soil | MTLSINLQKLALSVFGAIVASSLFLSAAVGPVQVI |
| Ga0190275_1000035234 | 3300018432 | Soil | MSLSIHSLQSLAISLIGAVFASSLFLSAALSSASVI |
| Ga0190269_101567692 | 3300018465 | Soil | MTVTSNLQKLALSVFGALVASSLFLTAAVGPVPVI |
| Ga0190270_120840852 | 3300018469 | Soil | MSISYANLQSLVVSVIGAVLASSLFISAAGSVPIV |
| Ga0190274_100002202 | 3300018476 | Soil | MTLSFNNLQQLAASVIGAVLVSTLFISAAIGPVPIV |
| Ga0190274_106429891 | 3300018476 | Soil | WRPKMTLTYANLQKITFSIVGALVASSLFLSAAVGPVPFV |
| Ga0190274_116633862 | 3300018476 | Soil | MTLSYSNLQALTVSVVGALLAASLFVSAAVGPVPII |
| Ga0190271_113575112 | 3300018481 | Soil | MKMSIYANLQHVALSIVGALLASSLFISAAVGPVPVI |
| Ga0190273_118225551 | 3300018920 | Soil | MTLSYDKLHRIAFSVLGALFASSLFISAAVGPVPVI |
| Ga0180110_10978743 | 3300019208 | Groundwater Sediment | GPVARFRRMKMSIYANLYNVAFSIVGALFASSLFISAAVGPVQVI |
| Ga0187894_10000007171 | 3300019360 | Microbial Mat On Rocks | MTIYANLQSLALSVVGAIVASSLFITAAVGPVPVI |
| Ga0187894_1000039837 | 3300019360 | Microbial Mat On Rocks | MSVSINLQKLALSVFGALVASSLFLTAAVGPVPVI |
| Ga0173482_104427712 | 3300019361 | Soil | MKMSIYANLYNVAFSIVGALFASTLFISAAVGPVQVI |
| Ga0190264_100930472 | 3300019377 | Soil | MTISLNLQQLALSVIGALVASSLFISAAVGPVPVV |
| Ga0193752_10116995 | 3300020027 | Soil | MTISFNLQQLAVSVIGALLASSLFISAAVGPVPII |
| Ga0193752_11223791 | 3300020027 | Soil | MTLSINLQKLALSVFGAVVASSLFLSAAVGPGQII |
| Ga0193752_11828754 | 3300020027 | Soil | MTLSINSLQTLAFSLIGALVASSLFLSAAVGPVPVI |
| Ga0193753_101625784 | 3300020034 | Soil | MTVTINTMQSLAISLFGALVATSLFLSAAVGPAPVL |
| Ga0193745_100000567 | 3300020059 | Soil | MSLSIHSLQSLAISLVGAIVASSLFLSAAVGPVPVI |
| Ga0196964_101025253 | 3300020202 | Soil | MTLSYTFSQLMVSAIGALVASSLFISAAVGPVPVI |
| Ga0196973_10567562 | 3300021061 | Soil | MSLSYANLQALALSVVGAIIASSLFVSAAVGPVPIV |
| Ga0196978_10018569 | 3300021067 | Soil | MTLSYDNMHRIAFSVLGALFASTLFISAAVGPVPVI |
| Ga0193706_11299712 | 3300021339 | Soil | MTLSINLQKLALSVFGALVASSLFISAAVGPVPII |
| Ga0207697_102274273 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSYNLQKLALSVFGALVASSLFLTAAVGPVPVI |
| Ga0207682_1000099810 | 3300025893 | Miscanthus Rhizosphere | MTLSFNNLQQLAASVIGAVLVSTLFISAAVGPVPII |
| Ga0207682_101627851 | 3300025893 | Miscanthus Rhizosphere | MTLSIHSLQTMAFSLVGALVASSLFLSAAIGPVPVI |
| Ga0207688_102944032 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSYNLQKLVLSVFGALVASSLFLTAAVGPVPVI |
| Ga0207680_110505783 | 3300025903 | Switchgrass Rhizosphere | MTLSLNSLQTLAFSLVGALVASSLFLSAAMGPVQIV |
| Ga0207645_104652052 | 3300025907 | Miscanthus Rhizosphere | MSLSINSLQSLAISLVGALVASSLFLSAAVGPVPVI |
| Ga0207681_103189464 | 3300025923 | Switchgrass Rhizosphere | MTLSIHGLQTLAFSLVGALVASSLFLSAAIGPVPVL |
| Ga0207681_107497742 | 3300025923 | Switchgrass Rhizosphere | MSVSINLQKLAISVFGALVASSLFLTAAVGPVPVI |
| Ga0207659_110105232 | 3300025926 | Miscanthus Rhizosphere | MTVSHNLQKLALSVFGALVASSLFLTAAVGPVPVI |
| Ga0207687_112264192 | 3300025927 | Miscanthus Rhizosphere | MSLSINSLQSLAISLIGALVASSLFLSAAVGPVPVI |
| Ga0207701_112849022 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIYANLYNVAFSIVGALFASTLFISAAVGPVQII |
| Ga0207709_102732562 | 3300025935 | Miscanthus Rhizosphere | MTLSINSLQSLAISLVGALVASSLFLSAAIGPVPQVL |
| Ga0207711_104910351 | 3300025941 | Switchgrass Rhizosphere | MTLSYNSLQSLALSLVGALVASSLFLSAAMGPVQVV |
| Ga0207689_101728443 | 3300025942 | Miscanthus Rhizosphere | MTLSLNSLQTLAFSLVGALVASSLFLSAAVGPVPMI |
| Ga0207651_103295143 | 3300025960 | Switchgrass Rhizosphere | MSLSIQSLQSLAISLVGALVASSLFLSAAVGPVPVI |
| Ga0207668_101541252 | 3300025972 | Switchgrass Rhizosphere | MTVSYNLQKLALSVFGALVASSLFLAAAVGPVQVI |
| Ga0209468_10053067 | 3300026306 | Soil | MTLSIHSLQTLAFSLVGALVASSLFLSAAIGPVPVI |
| Ga0207428_112115711 | 3300027907 | Populus Rhizosphere | ARFRRMKMSISYANLYNVAFSIVGALFASSLFISAAVGPVQII |
| Ga0268266_100003889 | 3300028379 | Switchgrass Rhizosphere | MSVSFNLQKLALSVFGALVASSLFLTAALGPVPVI |
| Ga0268266_1000048957 | 3300028379 | Switchgrass Rhizosphere | MTLSINTLQTLTISVFGALLASSLFLSAVIGPVSMV |
| Ga0268265_103901553 | 3300028380 | Switchgrass Rhizosphere | MSTYANLYNVAFSIVGALFASTLFISAAVGPVQVI |
| Ga0272482_100139602 | 3300028578 | Soil | MTISLNIQQLAVSLIGALVASSLFISAAVGPVPII |
| Ga0272482_100776022 | 3300028578 | Soil | MTLSYANLHQIAFSVFGALFASMLFISAAVGPVPVI |
| Ga0247823_106270821 | 3300028590 | Soil | MSVSFNLQKLALSVFGALVASSLFLTAAVGPVPVI |
| Ga0247821_103107063 | 3300028596 | Soil | MSIYANLHQIALSVVGALVASSLFITAAVSSAPVI |
| Ga0307503_10000015168 | 3300028802 | Soil | MTLSINLQKLAVSVFGALVASSLFLSAAIGPVQIV |
| Ga0299914_105226754 | 3300031228 | Soil | MTLSFANLHQTALSIVGALFASTLFVSAAVGSVPVI |
| Ga0299913_100039627 | 3300031229 | Soil | MTLSFANLHQIALSIVGALFASSLFLSAAVGPVPVI |
| Ga0307505_100305633 | 3300031455 | Soil | MSISFNLQQIAVSVIGALVASSLFISAAVGPVPII |
| Ga0307505_103464432 | 3300031455 | Soil | MTLSYNFSQLMVSVMGALIASSLFISAAVGPVPVI |
| Ga0307513_101674172 | 3300031456 | Ectomycorrhiza | MTLSYSNLQSLAVSVVGALFAASLFVSAAVGPVPIV |
| Ga0307513_104840522 | 3300031456 | Ectomycorrhiza | MTLSYSNLQALTVSVVGALLAASLFVSAAVGPVPIV |
| Ga0307408_1007177792 | 3300031548 | Rhizosphere | MTLSYTFSQLMVSVMGALIASSLFISAAVGPVPVI |
| Ga0307413_100598684 | 3300031824 | Rhizosphere | MTFSYISLQQLALSIFAAVVTSSLLISAAVGPVPVI |
| Ga0307414_103710811 | 3300032004 | Rhizosphere | MTLSYISLQQLAISIVGAVLASSLFISAAVGPVPLI |
| Ga0307414_109798101 | 3300032004 | Rhizosphere | MTLSYINLQQLALSIVGAVVASSLFISAAVGPVPVI |
| Ga0307411_107412831 | 3300032005 | Rhizosphere | MTVSFNLQKLALSVFGALVASSLFLTAAAGPVLVA |
| Ga0310890_113866583 | 3300032075 | Soil | MSISYANLYSVAFSIVGALFASTLFISAAVGPVQVI |
| Ga0307472_1003345472 | 3300032205 | Hardwood Forest Soil | MSLSIHSLQTMAVSLIGALVASSLFLSAAVGPVPVI |
| Ga0335075_100000674 | 3300032896 | Soil | MSITFNLQKLALSVFGAVVASSLFLAAAVGPVPVI |
| Ga0335075_107231772 | 3300032896 | Soil | MIASVNLQQLAVSVIGALVASSLFLSAAIGPVPVI |
| Ga0334934_006018_468_578 | 3300034006 | Biocrust | MTLSYANLHRLALSVVGALFASTMFITAAVGPVPVI |
| Ga0334934_016257_839_949 | 3300034006 | Biocrust | MTLSYDNFHRIAFSIVGALLASSLFVSAAVGPVPVI |
| Ga0334928_138934_243_356 | 3300034134 | Hypolithic Biocrust | MTFNFSNLQQIAISAVGALLAASLFLSAAAGPVVQFV |
| Ga0370480_0253804_88_195 | 3300034169 | Untreated Peat Soil | MTISYNLQQLAVSVIGALLASSLFISAAIGPVAIV |
| Ga0370501_0386833_198_308 | 3300034195 | Untreated Peat Soil | MTLSLNGLQTLAFSLVGALVASSLFLSAAMGPVQIV |
| Ga0334947_001471_5299_5406 | 3300034251 | Sub-Biocrust Soil | MTLSYNFPQLMVSLVGALVASSLFISAAVGPVPVI |
| Ga0370497_0000001_223177_223284 | 3300034965 | Untreated Peat Soil | MTLSINLQKLALSAFGALVASTLFLSAAIGPVQVI |
| ⦗Top⦘ |