


| Basic Information | |
|---|---|
| Family ID | F045740 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AAAVATVVTLPYGVLVGVLLYLDLRARKENLTLEALRADLQASAA |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.26 % |
| % of genes near scaffold ends (potentially truncated) | 90.13 % |
| % of genes from short scaffolds (< 2000 bps) | 84.87 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.289 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.658 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.184 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 6.58 |
| PF03795 | YCII | 5.92 |
| PF00144 | Beta-lactamase | 4.61 |
| PF01569 | PAP2 | 2.63 |
| PF08734 | GYD | 2.63 |
| PF13473 | Cupredoxin_1 | 2.63 |
| PF02652 | Lactate_perm | 1.97 |
| PF02371 | Transposase_20 | 1.97 |
| PF00589 | Phage_integrase | 1.97 |
| PF03006 | HlyIII | 1.97 |
| PF10604 | Polyketide_cyc2 | 1.97 |
| PF01513 | NAD_kinase | 1.97 |
| PF01243 | Putative_PNPOx | 1.32 |
| PF08031 | BBE | 1.32 |
| PF13427 | DUF4111 | 1.32 |
| PF14329 | DUF4386 | 1.32 |
| PF00999 | Na_H_Exchanger | 1.32 |
| PF12697 | Abhydrolase_6 | 1.32 |
| PF07452 | CHRD | 0.66 |
| PF01794 | Ferric_reduct | 0.66 |
| PF00196 | GerE | 0.66 |
| PF00583 | Acetyltransf_1 | 0.66 |
| PF08281 | Sigma70_r4_2 | 0.66 |
| PF12695 | Abhydrolase_5 | 0.66 |
| PF00107 | ADH_zinc_N | 0.66 |
| PF00892 | EamA | 0.66 |
| PF00535 | Glycos_transf_2 | 0.66 |
| PF02036 | SCP2 | 0.66 |
| PF16158 | N_BRCA1_IG | 0.66 |
| PF10648 | Gmad2 | 0.66 |
| PF12728 | HTH_17 | 0.66 |
| PF13401 | AAA_22 | 0.66 |
| PF12146 | Hydrolase_4 | 0.66 |
| PF00890 | FAD_binding_2 | 0.66 |
| PF14230 | DUF4333 | 0.66 |
| PF03992 | ABM | 0.66 |
| PF01850 | PIN | 0.66 |
| PF06305 | LapA_dom | 0.66 |
| PF00406 | ADK | 0.66 |
| PF01610 | DDE_Tnp_ISL3 | 0.66 |
| PF13683 | rve_3 | 0.66 |
| PF11716 | MDMPI_N | 0.66 |
| PF00582 | Usp | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 5.92 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 4.61 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.61 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 4.61 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 2.63 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 1.97 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 1.97 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.97 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.32 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.32 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.32 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.32 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.32 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.32 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.66 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.66 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.29 % |
| Unclassified | root | N/A | 46.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0953244 | Not Available | 511 | Open in IMG/M |
| 3300000550|F24TB_10856263 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300000956|JGI10216J12902_107585837 | Not Available | 774 | Open in IMG/M |
| 3300000956|JGI10216J12902_122670887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora erythraea | 986 | Open in IMG/M |
| 3300003373|JGI25407J50210_10173332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 532 | Open in IMG/M |
| 3300005518|Ga0070699_100387899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1262 | Open in IMG/M |
| 3300005562|Ga0058697_10207849 | Not Available | 890 | Open in IMG/M |
| 3300005981|Ga0081538_10016233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5722 | Open in IMG/M |
| 3300005981|Ga0081538_10017708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 5392 | Open in IMG/M |
| 3300005981|Ga0081538_10117833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1285 | Open in IMG/M |
| 3300005985|Ga0081539_10029947 | All Organisms → cellular organisms → Bacteria | 3389 | Open in IMG/M |
| 3300006572|Ga0074051_10306619 | Not Available | 649 | Open in IMG/M |
| 3300006844|Ga0075428_100935119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 919 | Open in IMG/M |
| 3300006845|Ga0075421_100635002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
| 3300006871|Ga0075434_101825109 | Not Available | 615 | Open in IMG/M |
| 3300009100|Ga0075418_11255626 | Not Available | 803 | Open in IMG/M |
| 3300009156|Ga0111538_13723803 | Not Available | 528 | Open in IMG/M |
| 3300009162|Ga0075423_12729140 | Not Available | 541 | Open in IMG/M |
| 3300009815|Ga0105070_1055273 | Not Available | 740 | Open in IMG/M |
| 3300009821|Ga0105064_1054577 | Not Available | 774 | Open in IMG/M |
| 3300009836|Ga0105068_1008376 | Not Available | 1650 | Open in IMG/M |
| 3300010036|Ga0126305_11115983 | Not Available | 543 | Open in IMG/M |
| 3300010038|Ga0126315_10016779 | All Organisms → cellular organisms → Bacteria | 3600 | Open in IMG/M |
| 3300010038|Ga0126315_10292785 | Not Available | 1003 | Open in IMG/M |
| 3300010038|Ga0126315_10567850 | Not Available | 730 | Open in IMG/M |
| 3300010038|Ga0126315_10575649 | Not Available | 725 | Open in IMG/M |
| 3300010042|Ga0126314_10393141 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300010044|Ga0126310_10181811 | Not Available | 1367 | Open in IMG/M |
| 3300010044|Ga0126310_10302487 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300010044|Ga0126310_10478264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 905 | Open in IMG/M |
| 3300010045|Ga0126311_10476669 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300010045|Ga0126311_11839165 | Not Available | 514 | Open in IMG/M |
| 3300010166|Ga0126306_10014124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5139 | Open in IMG/M |
| 3300010166|Ga0126306_10368740 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300010166|Ga0126306_11287570 | Not Available | 603 | Open in IMG/M |
| 3300012204|Ga0137374_10001205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 29016 | Open in IMG/M |
| 3300012204|Ga0137374_10058919 | All Organisms → cellular organisms → Bacteria | 3875 | Open in IMG/M |
| 3300012350|Ga0137372_10348718 | Not Available | 1134 | Open in IMG/M |
| 3300012350|Ga0137372_10764623 | Not Available | 695 | Open in IMG/M |
| 3300012351|Ga0137386_10822718 | Not Available | 667 | Open in IMG/M |
| 3300012353|Ga0137367_10069538 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300012353|Ga0137367_10075798 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300012356|Ga0137371_10241264 | Not Available | 1412 | Open in IMG/M |
| 3300012359|Ga0137385_10442663 | Not Available | 1104 | Open in IMG/M |
| 3300012360|Ga0137375_10231798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1720 | Open in IMG/M |
| 3300012938|Ga0162651_100073761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 564 | Open in IMG/M |
| 3300014487|Ga0182000_10240075 | Not Available | 720 | Open in IMG/M |
| 3300014487|Ga0182000_10333202 | Not Available | 647 | Open in IMG/M |
| 3300015371|Ga0132258_10166120 | All Organisms → cellular organisms → Bacteria | 5314 | Open in IMG/M |
| 3300015371|Ga0132258_10695582 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
| 3300015374|Ga0132255_100847279 | Not Available | 1364 | Open in IMG/M |
| 3300017792|Ga0163161_10277385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group → Pseudomonas fluorescens | 1314 | Open in IMG/M |
| 3300017965|Ga0190266_10919710 | Not Available | 576 | Open in IMG/M |
| 3300017965|Ga0190266_11049898 | Not Available | 550 | Open in IMG/M |
| 3300018028|Ga0184608_10168829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300018028|Ga0184608_10333638 | Not Available | 666 | Open in IMG/M |
| 3300018075|Ga0184632_10001413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9833 | Open in IMG/M |
| 3300018075|Ga0184632_10008206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4359 | Open in IMG/M |
| 3300018076|Ga0184609_10204346 | Not Available | 920 | Open in IMG/M |
| 3300018476|Ga0190274_10074327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2583 | Open in IMG/M |
| 3300018476|Ga0190274_13775218 | Not Available | 512 | Open in IMG/M |
| 3300019279|Ga0184642_1629667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300022756|Ga0222622_10040201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 2570 | Open in IMG/M |
| 3300025933|Ga0207706_11366899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 583 | Open in IMG/M |
| 3300026790|Ga0208710_100423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2049 | Open in IMG/M |
| 3300027056|Ga0209879_1048381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300027718|Ga0209795_10241117 | Not Available | 506 | Open in IMG/M |
| 3300027750|Ga0209461_10082531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 705 | Open in IMG/M |
| 3300027809|Ga0209574_10036374 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300027809|Ga0209574_10130960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 746 | Open in IMG/M |
| 3300027809|Ga0209574_10185683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 656 | Open in IMG/M |
| 3300027907|Ga0207428_11066160 | Not Available | 566 | Open in IMG/M |
| 3300027909|Ga0209382_10869998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300028589|Ga0247818_10561269 | Not Available | 782 | Open in IMG/M |
| 3300028712|Ga0307285_10042440 | Not Available | 1118 | Open in IMG/M |
| 3300028717|Ga0307298_10092080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 857 | Open in IMG/M |
| 3300028717|Ga0307298_10173990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 630 | Open in IMG/M |
| 3300028719|Ga0307301_10058395 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300028719|Ga0307301_10175514 | Not Available | 693 | Open in IMG/M |
| 3300028720|Ga0307317_10300356 | Not Available | 542 | Open in IMG/M |
| 3300028722|Ga0307319_10046631 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300028722|Ga0307319_10055487 | Not Available | 1246 | Open in IMG/M |
| 3300028744|Ga0307318_10006933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3660 | Open in IMG/M |
| 3300028744|Ga0307318_10072026 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300028744|Ga0307318_10108443 | Not Available | 942 | Open in IMG/M |
| 3300028744|Ga0307318_10339425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 528 | Open in IMG/M |
| 3300028771|Ga0307320_10185467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 811 | Open in IMG/M |
| 3300028771|Ga0307320_10481777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300028778|Ga0307288_10117794 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300028787|Ga0307323_10020232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia → unclassified Georgenia → Georgenia sp. EYE_87 | 2273 | Open in IMG/M |
| 3300028791|Ga0307290_10214250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 706 | Open in IMG/M |
| 3300028796|Ga0307287_10030152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1933 | Open in IMG/M |
| 3300028796|Ga0307287_10397970 | Not Available | 518 | Open in IMG/M |
| 3300028807|Ga0307305_10408640 | Not Available | 613 | Open in IMG/M |
| 3300028810|Ga0307294_10075054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia → unclassified Georgenia → Georgenia sp. EYE_87 | 1030 | Open in IMG/M |
| 3300028814|Ga0307302_10417943 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300028819|Ga0307296_10017946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3711 | Open in IMG/M |
| 3300028819|Ga0307296_10461659 | Not Available | 695 | Open in IMG/M |
| 3300028872|Ga0307314_10293592 | Not Available | 516 | Open in IMG/M |
| 3300028875|Ga0307289_10007845 | All Organisms → cellular organisms → Bacteria | 4098 | Open in IMG/M |
| 3300028875|Ga0307289_10170336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 895 | Open in IMG/M |
| 3300028876|Ga0307286_10279738 | Not Available | 614 | Open in IMG/M |
| 3300028878|Ga0307278_10211001 | Not Available | 865 | Open in IMG/M |
| 3300028878|Ga0307278_10318895 | Not Available | 686 | Open in IMG/M |
| 3300028880|Ga0307300_10004041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3709 | Open in IMG/M |
| 3300028880|Ga0307300_10271569 | Not Available | 567 | Open in IMG/M |
| 3300028881|Ga0307277_10424419 | Not Available | 595 | Open in IMG/M |
| 3300028889|Ga0247827_10506297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
| 3300030336|Ga0247826_10225433 | Not Available | 1299 | Open in IMG/M |
| 3300030336|Ga0247826_11383356 | Not Available | 568 | Open in IMG/M |
| 3300030499|Ga0268259_10076948 | Not Available | 718 | Open in IMG/M |
| 3300030511|Ga0268241_10147572 | Not Available | 573 | Open in IMG/M |
| 3300030514|Ga0268253_10008676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2275 | Open in IMG/M |
| 3300030516|Ga0268255_10130329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 744 | Open in IMG/M |
| 3300030988|Ga0308183_1122627 | Not Available | 615 | Open in IMG/M |
| 3300031505|Ga0308150_1033760 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031731|Ga0307405_10211110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1417 | Open in IMG/M |
| 3300031731|Ga0307405_11473125 | Not Available | 597 | Open in IMG/M |
| 3300031824|Ga0307413_10089019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2004 | Open in IMG/M |
| 3300031824|Ga0307413_10567586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 923 | Open in IMG/M |
| 3300031824|Ga0307413_11093926 | Not Available | 688 | Open in IMG/M |
| 3300031824|Ga0307413_12109456 | Not Available | 510 | Open in IMG/M |
| 3300031852|Ga0307410_10806242 | Not Available | 799 | Open in IMG/M |
| 3300031852|Ga0307410_10967568 | Not Available | 732 | Open in IMG/M |
| 3300031852|Ga0307410_11813763 | Not Available | 542 | Open in IMG/M |
| 3300031901|Ga0307406_10149697 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300031901|Ga0307406_11175645 | Not Available | 665 | Open in IMG/M |
| 3300031901|Ga0307406_11641626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300031903|Ga0307407_11455850 | Not Available | 541 | Open in IMG/M |
| 3300031911|Ga0307412_12331061 | Not Available | 500 | Open in IMG/M |
| 3300031995|Ga0307409_100518317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1164 | Open in IMG/M |
| 3300031995|Ga0307409_100956925 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031995|Ga0307409_101473569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
| 3300031995|Ga0307409_102862564 | Not Available | 510 | Open in IMG/M |
| 3300032002|Ga0307416_100822930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300032002|Ga0307416_102968263 | Not Available | 567 | Open in IMG/M |
| 3300032004|Ga0307414_10349954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1268 | Open in IMG/M |
| 3300032004|Ga0307414_10735874 | Not Available | 895 | Open in IMG/M |
| 3300032004|Ga0307414_11589610 | Not Available | 609 | Open in IMG/M |
| 3300032005|Ga0307411_10123333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1879 | Open in IMG/M |
| 3300032005|Ga0307411_10751385 | Not Available | 854 | Open in IMG/M |
| 3300032126|Ga0307415_100143846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 1825 | Open in IMG/M |
| 3300032126|Ga0307415_100175880 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300032126|Ga0307415_100351787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1240 | Open in IMG/M |
| 3300032126|Ga0307415_100878435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
| 3300032126|Ga0307415_102511742 | Not Available | 507 | Open in IMG/M |
| 3300032159|Ga0268251_10074736 | Not Available | 1162 | Open in IMG/M |
| 3300033004|Ga0335084_11556718 | Not Available | 652 | Open in IMG/M |
| 3300033550|Ga0247829_11813960 | Not Available | 503 | Open in IMG/M |
| 3300034172|Ga0334913_036922 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300034172|Ga0334913_049155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 896 | Open in IMG/M |
| 3300034174|Ga0334932_040369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 794 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 19.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.26% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 5.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.63% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.97% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.32% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.32% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.66% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.66% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.66% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.66% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026790 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_09532441 | 2228664021 | Soil | VTMPYGALVGVLLYLDLRARKERLDLDTLKADLQASTA |
| F24TB_108562631 | 3300000550 | Soil | PYSVLVGVLLYLDLRARKETLNLERLRADLQASAT* |
| JGI10216J12902_1075858371 | 3300000956 | Soil | TLPYGVLVGVLLYLDLRARKERLTRETLRADLQASAA* |
| JGI10216J12902_1226708873 | 3300000956 | Soil | YGTLVGVLLYLDLRARKEQLTLERLRADLQASAT* |
| JGI25407J50210_101733321 | 3300003373 | Tabebuia Heterophylla Rhizosphere | QGLVSAVATTVTMPYGVLVGVLLYLDLRARKENLTLERLRTDLQASAT* |
| Ga0070699_1003878993 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VATVVTLPYGALVGVLLYLDLRTRKERLDLETLRADLQASAA* |
| Ga0058697_102078491 | 3300005562 | Agave | WFVQAIAAAVATVVTLPYSVLVGVLLYLDLRARKEDLSLETLRADLQASAT* |
| Ga0081538_100162331 | 3300005981 | Tabebuia Heterophylla Rhizosphere | AAVATVVTLPYGVLAGVLLYLDLRARKENLNVERLRADLQASAA* |
| Ga0081538_100177086 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VATVVTLPYGVLAGVLLYLDLRARKENLNVERLRADLQASAADPW* |
| Ga0081538_101178334 | 3300005981 | Tabebuia Heterophylla Rhizosphere | TTVTMPYGVLVGVLLYLDLRARKENLTLEALRADLQASAA* |
| Ga0081539_100299472 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKHQIEVGVLLYLDLRARNGQLTLERLRADLQASAA* |
| Ga0074051_103066192 | 3300006572 | Soil | PYGALVGVLLYLDLRARRERLDLDTLKTDLQASTA* |
| Ga0075428_1009351191 | 3300006844 | Populus Rhizosphere | VHDTTGVATVVTLPYGTLVGVLLYLDAARKEQLTLERPRADLQASAT* |
| Ga0075421_1006350021 | 3300006845 | Populus Rhizosphere | VVTLPYGVLVGVLLYLDLRARKERLTLETLRADLQASAA* |
| Ga0075434_1018251091 | 3300006871 | Populus Rhizosphere | VVTLPYGVLVGVLLYLDLRARNEQLTLERLRADLQASAA* |
| Ga0075418_112556261 | 3300009100 | Populus Rhizosphere | LPYGALVGVLLYLDLRARKERLDLDTLKANLQASTA* |
| Ga0111538_137238032 | 3300009156 | Populus Rhizosphere | YGVLVGVLLYLDLRARKEALTLERLRADLQASAS* |
| Ga0075423_127291402 | 3300009162 | Populus Rhizosphere | MPYGALVGVLLYLDLRARRERLDLDTLKTDLQASTA* |
| Ga0105070_10552731 | 3300009815 | Groundwater Sand | TLPYGVLVGVLLYLDLRARKENLTLETLRADLQTSAA* |
| Ga0105064_10545772 | 3300009821 | Groundwater Sand | VATTVTLPYGALVGVLLYLDLRTRKEGLDLDTVKANLEASTA* |
| Ga0105068_10083761 | 3300009836 | Groundwater Sand | GVAAAVATVVTLPYGVLVGVLLYLDLRARKENLTLETLRADLQASAA* |
| Ga0126305_111159831 | 3300010036 | Serpentine Soil | TTVTLPYGALVGVLLYLDLRARKERLDLGPLTADLQASTA* |
| Ga0126315_100167792 | 3300010038 | Serpentine Soil | MPYGALVGVVLDLDLRARKGRLELDTLKTDLQTSAAFLEPGG* |
| Ga0126315_102927852 | 3300010038 | Serpentine Soil | VATVITLPYGVLVGVLLYLDLRARKEQLNLERLRTDLQASAT* |
| Ga0126315_105678502 | 3300010038 | Serpentine Soil | AAAVATVITLPYGVLVGVLLYLDLRARKENLNLERLRADLQASAA* |
| Ga0126315_105756492 | 3300010038 | Serpentine Soil | FVQGVVAAVATVITMPYGVLVGVLLYLDLRARKENLTLETLRTDLQASAA* |
| Ga0126314_103931412 | 3300010042 | Serpentine Soil | IAAAVATVITLPYGVLVGVLLYLDLRARKEQLNLERLRTDLQASAT* |
| Ga0126310_101818111 | 3300010044 | Serpentine Soil | AVAAAVATVITLPYGVLVGVLLYLDLRARKEQLTLERLRTDLQASAT* |
| Ga0126310_103024871 | 3300010044 | Serpentine Soil | TMPYSVLVGVLLYLDLRARKEQLTLERLRTDLQASAT* |
| Ga0126310_104782641 | 3300010044 | Serpentine Soil | QTVVAAIATTITLPYGALVGVLLYLDLRARKETLTLETLRADLQASAA* |
| Ga0126311_104766691 | 3300010045 | Serpentine Soil | QGLVAAVATVITMPYGVLVGVLLYLDLRARKENQTMEALRTDLQASAA* |
| Ga0126311_118391651 | 3300010045 | Serpentine Soil | IATVITMPYSVLVGVLLYLDLRARKEQLNLDRLRADLQASAT* |
| Ga0126306_100141245 | 3300010166 | Serpentine Soil | VATTVTLPYGALVGVLLYLDLRARKERLDLDTLKADLQASAA* |
| Ga0126306_103687401 | 3300010166 | Serpentine Soil | YGVLVGVLLYLDLRARKEQLNLERLRTDLQASAT* |
| Ga0126306_112875701 | 3300010166 | Serpentine Soil | VITMPYGVLVGVLLYLDLRARKENLTLETLRTDLQASAA* |
| Ga0137374_100012056 | 3300012204 | Vadose Zone Soil | VQGLAAAVATVVTLPYGALVGVLLYLDLRARKERLDLDTLRADLQASAA* |
| Ga0137374_100589191 | 3300012204 | Vadose Zone Soil | VVTLPYGVLVGVLLYLDLRARKENLTLEALRADLQASAA* |
| Ga0137372_103487182 | 3300012350 | Vadose Zone Soil | TLPYGALVGVLLYLDLRARKERLDLETLRADLQASAA* |
| Ga0137372_107646231 | 3300012350 | Vadose Zone Soil | TIVTLPYTTLVGVLLYLDLRARKEALTLDTLRADLQRSTA* |
| Ga0137386_108227182 | 3300012351 | Vadose Zone Soil | AWFVQGVAAAVATIVTLPFEALVGVLLYLDLRARKERLDLDTLKADLQASAA* |
| Ga0137367_100695385 | 3300012353 | Vadose Zone Soil | AAAVATVVTLPYGVLVGVLLYLDLRARKENLTLEALRADLQASAA* |
| Ga0137367_100757984 | 3300012353 | Vadose Zone Soil | AAAVATVVTLPYGVLVGVLLYLDLRARKENLTLEALRADLRASAA* |
| Ga0137371_102412643 | 3300012356 | Vadose Zone Soil | MWAWCSSRSTVVTLPYGALVGVLLYLDLRARKERLDLDTLRADLQASAA* |
| Ga0137385_104426632 | 3300012359 | Vadose Zone Soil | QGVAAAVATVVTLPYGALVGVLLYLDLRARKERLDLETLRADLQASAA* |
| Ga0137375_102317983 | 3300012360 | Vadose Zone Soil | VVQALAAAVATVVTLPYGVLVGVLLYLDLRARKENLTLEALRADLQASAA* |
| Ga0162651_1000737611 | 3300012938 | Soil | AVAAAVATVVTLPYGVLVGVLLYLDLRARKESLTMETLRTDLQASAA* |
| Ga0182000_102400751 | 3300014487 | Soil | VAAIATVITLPYGTLVGVLLYLDLRARKEQLTLERLRADLQASAT* |
| Ga0182000_103332021 | 3300014487 | Soil | AVATVITMPYSVLVGVLLYLDLRARKENLNLERLRTDLQTSAA* |
| Ga0132258_101661201 | 3300015371 | Arabidopsis Rhizosphere | TSWFLQAVVAAVATVITLPYGTLVGVLLYLDLRARKEQLTLEGLRADLQASAT* |
| Ga0132258_106955825 | 3300015371 | Arabidopsis Rhizosphere | YGTLVGVLLYLDLRARKEQLTLERLRADLQTSAN* |
| Ga0132255_1008472791 | 3300015374 | Arabidopsis Rhizosphere | VAAVATVITLPYGTLVGVLLYLDLRARKEQLTLERLRADLQTSAN* |
| Ga0163161_102773852 | 3300017792 | Switchgrass Rhizosphere | AAVATVVTLPYGVLVGVLLYLDLRARKERLTMEALRADLQASAT |
| Ga0190266_109197101 | 3300017965 | Soil | NTSWFVQAIAAAIATVITLPYGVLVGVLLYLDLRARKETLTLERLRTDLQTSAT |
| Ga0190266_110498982 | 3300017965 | Soil | AAAVATVITMPYSVLVGVLLYLDLRARKEQLTLERLRADLQASAT |
| Ga0184608_101688291 | 3300018028 | Groundwater Sediment | TVVTLPYSTLVGLLLYLDLRARKESLTMDTLRTDLQASAA |
| Ga0184608_103336382 | 3300018028 | Groundwater Sediment | VAAAIATTVTLPYGALVGVLLYLDLRARKERLDLDTLKANLHASTA |
| Ga0184632_100014131 | 3300018075 | Groundwater Sediment | NWFAQGVAAAVATVITLPYGVLVGVLLYLDLRARKENLTLEALRADLQASAA |
| Ga0184632_100082061 | 3300018075 | Groundwater Sediment | NWFAQGVAAAVATVITLPYGVLVGVLLYLDLRARKENLTLETLRADLQASAA |
| Ga0184609_102043461 | 3300018076 | Groundwater Sediment | VQGIAAAVATTVTLPYGALVGVLLYLDLRARKERLHLDTLKADLQASTA |
| Ga0190274_100743273 | 3300018476 | Soil | VATTVTLPYGALVGVLLYLDLRARKERLDLDTLKADLQASAA |
| Ga0190274_137752181 | 3300018476 | Soil | IVAAVATVVTLPYGVLVGVLLYLDLRARKEQLTLETLRTDLQASAA |
| Ga0184642_16296671 | 3300019279 | Groundwater Sediment | QGVAAAVATIVTLPFGALVGVLLYLDLRARKEPLDLDTLKTDLQATGA |
| Ga0222622_100402013 | 3300022756 | Groundwater Sediment | VATVVTLPYSALVGVLLYLDLRARKESLTLETLTTDLQASAA |
| Ga0207706_113668992 | 3300025933 | Corn Rhizosphere | VQAVAAAVATVVTLPYSALVGVLLYLDLRARKESLTMETLRTDLQASAT |
| Ga0208710_1004231 | 3300026790 | Soil | AIATVITLPYGVLVGVLLYLDLRARKEQLTLDRLRADLQASAT |
| Ga0209879_10483812 | 3300027056 | Groundwater Sand | TVVTLPYGVLVGVLLYLDLRARKERLTMETLRADLQASAA |
| Ga0209795_102411171 | 3300027718 | Agave | GQAVAAAVATVITLPYSTLVGVLLYLDLRARKENLTLERLQADLQASAT |
| Ga0209461_100825312 | 3300027750 | Agave | LPYSALVGVLLYLDLRARKERLTLEALTTDLQASAA |
| Ga0209574_100363741 | 3300027809 | Agave | TMPYGVLVGALLYLDMRARKENLTLDTLRTDLQASAA |
| Ga0209574_101309602 | 3300027809 | Agave | VVAAVATTITLPYGALVGVLLYLDLRARKETLTLETLRADLAASAA |
| Ga0209574_101856831 | 3300027809 | Agave | TVTLPFGALVGVLLYLDLRARKERLDLDTLTTDLETSAA |
| Ga0207428_110661602 | 3300027907 | Populus Rhizosphere | TTVTLPYGALVGVLLYLDLRARKERLDLDTLKANLQASTA |
| Ga0209382_108699981 | 3300027909 | Populus Rhizosphere | TLPYGALIGVLLYLDLRARKERLTLETLRADLQASAA |
| Ga0247818_105612691 | 3300028589 | Soil | IVTMPYGALVGVLLYLDLRARRERLDLDTLKTDLQSSTA |
| Ga0307285_100424401 | 3300028712 | Soil | VQAVVAAVATVVTLPYGVLVGVLLYLDLRARKESLTMEALRADLQASAA |
| Ga0307298_100920801 | 3300028717 | Soil | PYGALVGVLLYLDLRARKEPLDLDTLKANLQATAA |
| Ga0307298_101739901 | 3300028717 | Soil | QAVAAAVATVVTLPYSALVGVLLYLDLRARKESLTMETLRTDLQASAA |
| Ga0307301_100583951 | 3300028719 | Soil | QAVVAAVATVVTLPYGVLVGVLLYLDLRARKESLTMEALRADLQASAA |
| Ga0307301_101755142 | 3300028719 | Soil | AAVATTVTLPYGALVGVLLYLDLRARKERLDLDTLKANLQASTA |
| Ga0307317_103003561 | 3300028720 | Soil | TVVILPYGVLVGVLLYLDLRARKERLTLEALRADLQASAT |
| Ga0307319_100466311 | 3300028722 | Soil | VATVVTLPYGVLVGVLLYLDLRARKESLTMEALRADLQASAA |
| Ga0307319_100554871 | 3300028722 | Soil | ATVVTLPYGVLVGVLLYLDLRARKESLTMEALRADLQASAA |
| Ga0307318_100069336 | 3300028744 | Soil | FLQAVVAAMATVITLPYGTLVGVLLYLDLRARKEQLTLERLRADLQASAT |
| Ga0307318_100720263 | 3300028744 | Soil | QAVVAAVATVVTLPYGVLVGVLLYLDLRARKERLTLEALRADLQASAT |
| Ga0307318_101084433 | 3300028744 | Soil | TTVTLPYGALVGVLLYLDLRARKEPLDLGTIKADLQASTA |
| Ga0307318_103394251 | 3300028744 | Soil | SGAAAVATVVTLPYSALVGVLLYLDLRARKESLTLETLTTDLQASAA |
| Ga0307320_101854671 | 3300028771 | Soil | WFVQAVAAAVATVVTLPYSALVGVLLYLDLRARKESLTMEALRTDLEASAA |
| Ga0307320_104817771 | 3300028771 | Soil | VVTLPYGVLVGVLLYLDLRARKEGLTLETVRTDLQASAA |
| Ga0307288_101177942 | 3300028778 | Soil | TVVTLPYGVLVGVLLYLDLRARKERLTLEALRADLQASAT |
| Ga0307323_100202321 | 3300028787 | Soil | TLPYGTLVGVLLYLDLRARKEQLTLERLRADLQESAT |
| Ga0307290_102142501 | 3300028791 | Soil | VAALLLVPYGAAVLVVLYLDLRARKERVDLEVLTADLRASAA |
| Ga0307287_100301521 | 3300028796 | Soil | LLQGIAAAVATIVTLPYGALVGVLLYLDLRARKEPLDLDTLKANLQATAA |
| Ga0307287_103979702 | 3300028796 | Soil | WFVQAVAAAVATVVTLPYSALVGVLLYLDLRARKESLTMDTLRTDLQASAA |
| Ga0307305_104086402 | 3300028807 | Soil | VRRATVVTLPYSALVGVLLYLDLRARKERLDHATLRADLQASAA |
| Ga0307294_100750542 | 3300028810 | Soil | TVITLPYGTLVGVLLYLDLRARKEQLTLERLRADLQESAT |
| Ga0307302_104179432 | 3300028814 | Soil | VVAAVATVVTLPYGVLVGVLLYLDLRARKERLTLEALRADLQASAT |
| Ga0307296_100179461 | 3300028819 | Soil | ITLPYGTLVGVLLYLDLRARKEQLTLERLRADLQASAT |
| Ga0307296_104616591 | 3300028819 | Soil | AWLLQGIAAAVATTVTLPFGALVGVLLYLDLRARKERLHLDTLKADLQASTV |
| Ga0307314_102935922 | 3300028872 | Soil | VVVAVATVITLPYGTLVGVLLYLDLRARKEQLTLERLRADLQESAT |
| Ga0307289_100078455 | 3300028875 | Soil | LPYGTLVGVLLYLDLRARKEQLTLERLRADLQESAT |
| Ga0307289_101703362 | 3300028875 | Soil | VAAVATVVTLPYGVLVGVLLYLDLRARKERLTLEALRADLQASAT |
| Ga0307286_102797384 | 3300028876 | Soil | VVTLPYGVLVGVLLYLDLRARKESLTMEALRADLQASAA |
| Ga0307278_102110011 | 3300028878 | Soil | VIAAAVGTVVTLPYGVLVGVLLYLDLRARKERLSLETLRTEL |
| Ga0307278_103188951 | 3300028878 | Soil | GMSWVVQALAAAVATVITLPYGVLVGVLLYLDLRARKENLSMEALRADLRTSAA |
| Ga0307300_100040411 | 3300028880 | Soil | TVVTLPYSALVGVLLYLDLRARKESLTMETLRTDLQASAA |
| Ga0307300_102715692 | 3300028880 | Soil | AVATVITLPYSALVGVLLYLDLRARKENLTLETLRTDLQTSAA |
| Ga0307277_104244191 | 3300028881 | Soil | AWFIQGIAAAVATTVTLPYGALVGVLLYLDLRARKEALDLDTLKADLQASTA |
| Ga0247827_105062971 | 3300028889 | Soil | ATTVTLPYGALVGVLLYLDLRARKEPLDLDTLKANLQASTA |
| Ga0247826_102254333 | 3300030336 | Soil | VAAAVATIVTMPYGALVGVLLYLDLRARRERLDLDTLKTDLQSSTA |
| Ga0247826_113833561 | 3300030336 | Soil | AVATTVTLPYGALVGVLLYLDLRARKERLDLDTLKANLQASTA |
| Ga0268259_100769481 | 3300030499 | Agave | AIAAAIATVITVPYSVLVGVLLYLDLRARKENLNLERLRTDLQTSAA |
| Ga0268241_101475721 | 3300030511 | Soil | TLPYGALVGVLLYLDLRARKERLDLETLRADLQASAA |
| Ga0268253_100086764 | 3300030514 | Agave | VITMPYSVLVGVLLYLDLRARKEALTLEGLRTDLQASAT |
| Ga0268255_101303291 | 3300030516 | Agave | PYSALVGVLLYLDLRARKENLTLETLRTDLQASAT |
| Ga0308183_11226272 | 3300030988 | Soil | AAAVATTVTLPYGALVGVLLYLDLRARKERLDLDTLKADLQASAA |
| Ga0308150_10337601 | 3300031505 | Soil | IVTLPFGALVGVLLYVDLRARKERLDLDTLKTDLQATAA |
| Ga0307405_102111101 | 3300031731 | Rhizosphere | FIQAVVAAVATVVTLPYGVLVGVLLYLDLRARKEQLTLERLRTDLQASAT |
| Ga0307405_114731251 | 3300031731 | Rhizosphere | GWFVHAVAAAVATVVTLPYGVLVGVLLYLDLRARKERLTLEALRADLQASAA |
| Ga0307413_100890192 | 3300031824 | Rhizosphere | AVATTVTLPYGALVGVLLYLDLRARKERLDLDTLKADLQASAA |
| Ga0307413_105675862 | 3300031824 | Rhizosphere | TVVTLPYGVLVGVLLYLDLRARKERLTLDTLRADLQASAA |
| Ga0307413_110939262 | 3300031824 | Rhizosphere | VAAAVATVVTLPYSALVGVLLYLDLRARKENLTLETLRTDLQASAA |
| Ga0307413_121094561 | 3300031824 | Rhizosphere | GWFVQAIAAAVATVITLPYGVLVGVLLYLDLRARKENLTLERLRTDLQTSAA |
| Ga0307410_108062422 | 3300031852 | Rhizosphere | WFVQAIAAAVATVITLPYGVLVGVLLYLDLRARKEQLTLERLRTDLQTSAA |
| Ga0307410_109675681 | 3300031852 | Rhizosphere | ATVITMPYGVLVGVLLYLDLRARKENLNLERLRTDLQTSAA |
| Ga0307410_118137631 | 3300031852 | Rhizosphere | VQAVAAAIATVITLPYGVLVGVLLYLDLRARKEQLTLERLRTDLQASAA |
| Ga0307406_101496972 | 3300031901 | Rhizosphere | WFVQAIAAAVATVITMPYSVLVGVLLYLDLRARKEQLNLERLRTDLQASAT |
| Ga0307406_111756451 | 3300031901 | Rhizosphere | AVATTVTLPYGALVGVLLYLDLRARKERLDLDTLKANLQASAA |
| Ga0307406_116416261 | 3300031901 | Rhizosphere | AAVATVVTLPYGVLVGVLLYLDLRARKEQLTLERLRSDLQASAT |
| Ga0307407_114558501 | 3300031903 | Rhizosphere | AAAVATVVTLPYSALVGVLLYLDLRARKESLTMETLKTDLQASAA |
| Ga0307412_123310612 | 3300031911 | Rhizosphere | LPYGVLVGVLLYLDLRARKENLTLERLRTDLQTSAA |
| Ga0307409_1005183171 | 3300031995 | Rhizosphere | ASLLATLVGLLLYLDLRARKERLDLDTLKANLQASTA |
| Ga0307409_1009569252 | 3300031995 | Rhizosphere | PYSVLVGVLLYLDLRARKEQLNLERLRTDLQASAT |
| Ga0307409_1014735692 | 3300031995 | Rhizosphere | TMPYSVLVGVLLYLDLRARKEALTLEGLRTDLQASAP |
| Ga0307409_1028625642 | 3300031995 | Rhizosphere | WFVQGVAAAVATVVTLPYGVLVGVLLYLDLRARKERLSLEALRADLQASAA |
| Ga0307416_1008229303 | 3300032002 | Rhizosphere | VAAAIATVITLPYGVLVGVLLYLDLRARKEQLTLERLRTDLQASAA |
| Ga0307416_1029682632 | 3300032002 | Rhizosphere | TMPYSVLVGVLLYLDLRARKEQLNLERLRTDLQTSAT |
| Ga0307414_103499541 | 3300032004 | Rhizosphere | PYGALVGVLLYLDLRARKEGLSLDTLRADLQASIA |
| Ga0307414_107358741 | 3300032004 | Rhizosphere | AAVATVITLPYGVLVGVLLYLDLRARKENLTLERLRTDLQTSAA |
| Ga0307414_115896102 | 3300032004 | Rhizosphere | VTLPYGALVGVLLYLDLRARKERLDLDALKADLQASTA |
| Ga0307411_101233335 | 3300032005 | Rhizosphere | TLPYGVLVGVLLYLDLRARKEQLNLERLRSDLQASAT |
| Ga0307411_107513851 | 3300032005 | Rhizosphere | TVITLPYGVLVGVLLYLDLRARKEQLNLERLRTDLQASAT |
| Ga0307415_1001438461 | 3300032126 | Rhizosphere | VVAAVATTITLPYGALVGVLLYLDLRARKETLTLETLRTDLQASAA |
| Ga0307415_1001758803 | 3300032126 | Rhizosphere | AVVAAVATTITLPYGALVGVLLYLDLRARKETLTVETLRADLQASAA |
| Ga0307415_1003517871 | 3300032126 | Rhizosphere | VAAVATVVTLPYGVLVGVLLYLDLRARKEQLTLERLRTDLQASAT |
| Ga0307415_1008784351 | 3300032126 | Rhizosphere | PYGALVGVLLYLDLRARKENLRLETLRAELQASTA |
| Ga0307415_1025117421 | 3300032126 | Rhizosphere | TMPYGVLVGVLLYLDLRARKENLTLETLRTDLQASAA |
| Ga0268251_100747361 | 3300032159 | Agave | VQGVVAAVATVVTMPYGVLVGVLLYLDLRARKENLTLDTLRTDLQASAA |
| Ga0335084_115567182 | 3300033004 | Soil | AQMITLPFSTTVGVLLYIDLRARKEALSADRLRADLQMSA |
| Ga0247829_118139601 | 3300033550 | Soil | AVAAALATMVTLPYGVLVGVLLYLDLRARREPLSPDTLTADLEASAV |
| Ga0334913_036922_673_792 | 3300034172 | Sub-Biocrust Soil | VVTLPYSALVGVLLYLDLRARKENLTMETLRTDLQASAA |
| Ga0334913_049155_2_145 | 3300034172 | Sub-Biocrust Soil | AVAAAVATVITLPYGVLVGVLLYLDLRARMENLTLEGLRTDLQASAT |
| Ga0334932_040369_265_402 | 3300034174 | Sub-Biocrust Soil | VQAVVAAVATVVTLAYGVLLYLDLRARKEGLTPEMLRTNLQTSAA |
| ⦗Top⦘ |