


| Basic Information | |
|---|---|
| Family ID | F045577 |
| Family Type | Metagenome |
| Number of Sequences | 152 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL |
| Number of Associated Samples | 33 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.27 % |
| % of genes near scaffold ends (potentially truncated) | 59.21 % |
| % of genes from short scaffolds (< 2000 bps) | 88.16 % |
| Associated GOLD sequencing projects | 32 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.763 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (79.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.605 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (82.237 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 3.29 |
| PF07311 | Dodecin | 3.29 |
| PF04226 | Transgly_assoc | 1.97 |
| PF04471 | Mrr_cat | 1.32 |
| PF10049 | DUF2283 | 1.32 |
| PF00313 | CSD | 1.32 |
| PF07676 | PD40 | 1.32 |
| PF00582 | Usp | 0.66 |
| PF00583 | Acetyltransf_1 | 0.66 |
| PF00353 | HemolysinCabind | 0.66 |
| PF00805 | Pentapeptide | 0.66 |
| PF04134 | DCC1-like | 0.66 |
| PF00011 | HSP20 | 0.66 |
| PF01566 | Nramp | 0.66 |
| PF01595 | CNNM | 0.66 |
| PF03288 | Pox_D5 | 0.66 |
| PF13560 | HTH_31 | 0.66 |
| PF13751 | DDE_Tnp_1_6 | 0.66 |
| PF00166 | Cpn10 | 0.66 |
| PF06197 | DUF998 | 0.66 |
| PF13367 | PrsW-protease | 0.66 |
| PF07883 | Cupin_2 | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 3.29 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.97 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.66 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.66 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.66 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.66 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.66 |
| COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.76 % |
| All Organisms | root | All Organisms | 32.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005562|Ga0058697_10077306 | Not Available | 1335 | Open in IMG/M |
| 3300005562|Ga0058697_10246537 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005562|Ga0058697_10816710 | Not Available | 505 | Open in IMG/M |
| 3300006894|Ga0079215_10241320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300007004|Ga0079218_13121789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300009789|Ga0126307_10053697 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3150 | Open in IMG/M |
| 3300009789|Ga0126307_10067680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces roseoverticillatus | 2807 | Open in IMG/M |
| 3300009789|Ga0126307_10165350 | Not Available | 1773 | Open in IMG/M |
| 3300009789|Ga0126307_10174576 | Not Available | 1722 | Open in IMG/M |
| 3300009789|Ga0126307_10220860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1522 | Open in IMG/M |
| 3300009789|Ga0126307_10385549 | Not Available | 1129 | Open in IMG/M |
| 3300009789|Ga0126307_10597028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 891 | Open in IMG/M |
| 3300009789|Ga0126307_10645361 | Not Available | 854 | Open in IMG/M |
| 3300009789|Ga0126307_10709416 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300009789|Ga0126307_10951167 | Not Available | 694 | Open in IMG/M |
| 3300009789|Ga0126307_11378308 | Not Available | 571 | Open in IMG/M |
| 3300009789|Ga0126307_11479377 | Not Available | 551 | Open in IMG/M |
| 3300009789|Ga0126307_11693507 | Not Available | 514 | Open in IMG/M |
| 3300009789|Ga0126307_11768803 | Not Available | 503 | Open in IMG/M |
| 3300009840|Ga0126313_10006287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 7167 | Open in IMG/M |
| 3300009840|Ga0126313_10152431 | Not Available | 1747 | Open in IMG/M |
| 3300009840|Ga0126313_10182219 | Not Available | 1604 | Open in IMG/M |
| 3300009840|Ga0126313_10266350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1332 | Open in IMG/M |
| 3300009840|Ga0126313_10329399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300009840|Ga0126313_10389635 | Not Available | 1104 | Open in IMG/M |
| 3300009840|Ga0126313_10802650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 766 | Open in IMG/M |
| 3300009840|Ga0126313_10841268 | Not Available | 747 | Open in IMG/M |
| 3300009840|Ga0126313_11396662 | Not Available | 580 | Open in IMG/M |
| 3300009840|Ga0126313_11420986 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300009840|Ga0126313_11521994 | Not Available | 556 | Open in IMG/M |
| 3300010036|Ga0126305_10001450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10582 | Open in IMG/M |
| 3300010036|Ga0126305_10003898 | All Organisms → cellular organisms → Bacteria | 7030 | Open in IMG/M |
| 3300010036|Ga0126305_10034668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces roseoverticillatus | 2777 | Open in IMG/M |
| 3300010036|Ga0126305_10048453 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300010036|Ga0126305_10087689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1845 | Open in IMG/M |
| 3300010036|Ga0126305_10115810 | Not Available | 1630 | Open in IMG/M |
| 3300010036|Ga0126305_10452324 | Not Available | 852 | Open in IMG/M |
| 3300010036|Ga0126305_10484828 | Not Available | 823 | Open in IMG/M |
| 3300010036|Ga0126305_10541008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 779 | Open in IMG/M |
| 3300010036|Ga0126305_10549628 | Not Available | 773 | Open in IMG/M |
| 3300010036|Ga0126305_10550735 | Not Available | 772 | Open in IMG/M |
| 3300010036|Ga0126305_10737961 | Not Available | 667 | Open in IMG/M |
| 3300010036|Ga0126305_10743136 | Not Available | 665 | Open in IMG/M |
| 3300010036|Ga0126305_11230693 | Not Available | 517 | Open in IMG/M |
| 3300010037|Ga0126304_10026601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3363 | Open in IMG/M |
| 3300010037|Ga0126304_10630323 | Not Available | 723 | Open in IMG/M |
| 3300010037|Ga0126304_11159319 | Not Available | 529 | Open in IMG/M |
| 3300010037|Ga0126304_11176595 | Not Available | 525 | Open in IMG/M |
| 3300010038|Ga0126315_10058845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Reticulibacteraceae → Reticulibacter → Reticulibacter mediterranei | 2108 | Open in IMG/M |
| 3300010038|Ga0126315_10937901 | Not Available | 577 | Open in IMG/M |
| 3300010039|Ga0126309_10093782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1533 | Open in IMG/M |
| 3300010039|Ga0126309_10425720 | Not Available | 800 | Open in IMG/M |
| 3300010039|Ga0126309_10446791 | Not Available | 784 | Open in IMG/M |
| 3300010040|Ga0126308_10002696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 7690 | Open in IMG/M |
| 3300010040|Ga0126308_10173625 | Not Available | 1373 | Open in IMG/M |
| 3300010040|Ga0126308_10176885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1361 | Open in IMG/M |
| 3300010040|Ga0126308_10249871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 1153 | Open in IMG/M |
| 3300010040|Ga0126308_10280434 | Not Available | 1091 | Open in IMG/M |
| 3300010040|Ga0126308_10386911 | Not Available | 931 | Open in IMG/M |
| 3300010040|Ga0126308_10413589 | Not Available | 901 | Open in IMG/M |
| 3300010040|Ga0126308_10434159 | Not Available | 880 | Open in IMG/M |
| 3300010040|Ga0126308_10467018 | Not Available | 849 | Open in IMG/M |
| 3300010040|Ga0126308_10619813 | Not Available | 739 | Open in IMG/M |
| 3300010040|Ga0126308_10657699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter marinus | 718 | Open in IMG/M |
| 3300010040|Ga0126308_10714577 | Not Available | 690 | Open in IMG/M |
| 3300010040|Ga0126308_10788594 | Not Available | 657 | Open in IMG/M |
| 3300010040|Ga0126308_10843039 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010040|Ga0126308_10945323 | Not Available | 602 | Open in IMG/M |
| 3300010040|Ga0126308_10978459 | Not Available | 592 | Open in IMG/M |
| 3300010040|Ga0126308_11000791 | Not Available | 586 | Open in IMG/M |
| 3300010040|Ga0126308_11044907 | Not Available | 574 | Open in IMG/M |
| 3300010040|Ga0126308_11160894 | Not Available | 545 | Open in IMG/M |
| 3300010040|Ga0126308_11306116 | Not Available | 515 | Open in IMG/M |
| 3300010041|Ga0126312_10159461 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300010041|Ga0126312_10164498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1544 | Open in IMG/M |
| 3300010041|Ga0126312_10238888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1275 | Open in IMG/M |
| 3300010041|Ga0126312_10264691 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300010041|Ga0126312_10425756 | Not Available | 945 | Open in IMG/M |
| 3300010041|Ga0126312_10483813 | Not Available | 885 | Open in IMG/M |
| 3300010041|Ga0126312_10515499 | Not Available | 856 | Open in IMG/M |
| 3300010041|Ga0126312_10709882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300010041|Ga0126312_10950336 | Not Available | 628 | Open in IMG/M |
| 3300010041|Ga0126312_11128252 | Not Available | 576 | Open in IMG/M |
| 3300010041|Ga0126312_11312452 | Not Available | 535 | Open in IMG/M |
| 3300010041|Ga0126312_11326152 | Not Available | 533 | Open in IMG/M |
| 3300010042|Ga0126314_10009022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 5588 | Open in IMG/M |
| 3300010042|Ga0126314_10055784 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
| 3300010042|Ga0126314_10123887 | Not Available | 1780 | Open in IMG/M |
| 3300010042|Ga0126314_10176820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1497 | Open in IMG/M |
| 3300010042|Ga0126314_10193911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1429 | Open in IMG/M |
| 3300010042|Ga0126314_10349762 | Not Available | 1060 | Open in IMG/M |
| 3300010042|Ga0126314_10356957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300010042|Ga0126314_10470399 | Not Available | 910 | Open in IMG/M |
| 3300010042|Ga0126314_10745918 | Not Available | 719 | Open in IMG/M |
| 3300010042|Ga0126314_11299090 | Not Available | 545 | Open in IMG/M |
| 3300010042|Ga0126314_11319870 | Not Available | 541 | Open in IMG/M |
| 3300010044|Ga0126310_10023890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 3105 | Open in IMG/M |
| 3300010044|Ga0126310_10074249 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300010044|Ga0126310_10175820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1386 | Open in IMG/M |
| 3300010044|Ga0126310_10393932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 984 | Open in IMG/M |
| 3300010044|Ga0126310_10701175 | Not Available | 767 | Open in IMG/M |
| 3300010044|Ga0126310_10784204 | Not Available | 731 | Open in IMG/M |
| 3300010044|Ga0126310_10870418 | Not Available | 699 | Open in IMG/M |
| 3300010044|Ga0126310_10973652 | Not Available | 666 | Open in IMG/M |
| 3300010044|Ga0126310_11067853 | Not Available | 640 | Open in IMG/M |
| 3300010044|Ga0126310_11591465 | Not Available | 539 | Open in IMG/M |
| 3300010045|Ga0126311_10040353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter radiotolerans | 2941 | Open in IMG/M |
| 3300010045|Ga0126311_10168443 | Not Available | 1575 | Open in IMG/M |
| 3300010045|Ga0126311_10529509 | Not Available | 925 | Open in IMG/M |
| 3300010045|Ga0126311_11168357 | Not Available | 635 | Open in IMG/M |
| 3300010045|Ga0126311_11326735 | Not Available | 599 | Open in IMG/M |
| 3300010045|Ga0126311_11476026 | Not Available | 569 | Open in IMG/M |
| 3300010045|Ga0126311_11532738 | Not Available | 559 | Open in IMG/M |
| 3300010045|Ga0126311_11549965 | Not Available | 556 | Open in IMG/M |
| 3300010045|Ga0126311_11599138 | Not Available | 548 | Open in IMG/M |
| 3300010045|Ga0126311_11917981 | Not Available | 503 | Open in IMG/M |
| 3300010166|Ga0126306_10070060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces roseoverticillatus | 2476 | Open in IMG/M |
| 3300010166|Ga0126306_10169787 | Not Available | 1632 | Open in IMG/M |
| 3300010166|Ga0126306_10332807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1176 | Open in IMG/M |
| 3300010166|Ga0126306_10359523 | Not Available | 1132 | Open in IMG/M |
| 3300010166|Ga0126306_10402892 | Not Available | 1070 | Open in IMG/M |
| 3300010166|Ga0126306_10653898 | Not Available | 840 | Open in IMG/M |
| 3300010166|Ga0126306_11092349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 653 | Open in IMG/M |
| 3300010166|Ga0126306_11121602 | Not Available | 644 | Open in IMG/M |
| 3300010166|Ga0126306_11156699 | Not Available | 635 | Open in IMG/M |
| 3300012186|Ga0136620_10019272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 3237 | Open in IMG/M |
| 3300014487|Ga0182000_10499834 | Not Available | 565 | Open in IMG/M |
| 3300018466|Ga0190268_10474928 | Not Available | 838 | Open in IMG/M |
| 3300018481|Ga0190271_11172910 | Not Available | 891 | Open in IMG/M |
| 3300018920|Ga0190273_12278748 | Not Available | 511 | Open in IMG/M |
| 3300019767|Ga0190267_10580968 | Not Available | 688 | Open in IMG/M |
| 3300027750|Ga0209461_10164486 | Not Available | 547 | Open in IMG/M |
| 3300030613|Ga0299915_10970413 | Not Available | 518 | Open in IMG/M |
| 3300031548|Ga0307408_100704209 | Not Available | 908 | Open in IMG/M |
| 3300031731|Ga0307405_10848844 | Not Available | 769 | Open in IMG/M |
| 3300031731|Ga0307405_11861995 | Not Available | 536 | Open in IMG/M |
| 3300031901|Ga0307406_10168991 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300031903|Ga0307407_11042278 | Not Available | 634 | Open in IMG/M |
| 3300031903|Ga0307407_11437795 | Not Available | 544 | Open in IMG/M |
| 3300031911|Ga0307412_11967532 | Not Available | 540 | Open in IMG/M |
| 3300031995|Ga0307409_100197444 | Not Available | 1797 | Open in IMG/M |
| 3300031995|Ga0307409_101417441 | Not Available | 721 | Open in IMG/M |
| 3300032002|Ga0307416_100467901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1317 | Open in IMG/M |
| 3300032002|Ga0307416_102123638 | Not Available | 663 | Open in IMG/M |
| 3300032002|Ga0307416_102314961 | Not Available | 637 | Open in IMG/M |
| 3300032002|Ga0307416_102811372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 582 | Open in IMG/M |
| 3300032002|Ga0307416_103695062 | Not Available | 512 | Open in IMG/M |
| 3300032004|Ga0307414_10044392 | Not Available | 3035 | Open in IMG/M |
| 3300032005|Ga0307411_11035195 | Not Available | 737 | Open in IMG/M |
| 3300032005|Ga0307411_11887977 | Not Available | 556 | Open in IMG/M |
| 3300032159|Ga0268251_10283406 | Not Available | 681 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 79.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 11.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.29% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.32% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.66% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0058697_100773062 | 3300005562 | Agave | LYPTASERGECMLAMLFWVLAALAVVGALGIVWGLYLLVRRWL* |
| Ga0058697_102465373 | 3300005562 | Agave | TILLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0058697_108167101 | 3300005562 | Agave | VPYRTPTASKRGKCILAMLFWVVAVLAVLVVVAMVGALYFLVRRWL* |
| Ga0079215_102413203 | 3300006894 | Agricultural Soil | LYPTASERGECMLAMLFWVLAALAVVGALAIVWGL |
| Ga0079218_131217891 | 3300007004 | Agricultural Soil | RGILRASERGECMLAMLFWVVAVLSVVGVLATVGGLYLLARRWL* |
| Ga0126307_100536973 | 3300009789 | Serpentine Soil | LYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYL |
| Ga0126307_100676803 | 3300009789 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLAR |
| Ga0126307_101653503 | 3300009789 | Serpentine Soil | LYPTASERRECMLAMLFWVVAALAVASALAVVWGLYLLVRRWL* |
| Ga0126307_101745761 | 3300009789 | Serpentine Soil | LYPTASERGECMLAMLFWLLAALAVVGALAIVWVLYLLVHRWL* |
| Ga0126307_102208602 | 3300009789 | Serpentine Soil | LHERLPWVTTLLYPTASEREECMLSMLFWVLAALAVVGALAIVWGLYLLVHRWL* |
| Ga0126307_103855493 | 3300009789 | Serpentine Soil | EGKRGECIPSMLFWVIAVLSVVGAFAVVWGLYLLVRRRL* |
| Ga0126307_105970283 | 3300009789 | Serpentine Soil | LHERQPWVTTLLYPTASEREECMLSMLFWVLAALAVGGALTAVWGMYLLARRWL* |
| Ga0126307_106453613 | 3300009789 | Serpentine Soil | LHERLPWVTILLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126307_107094162 | 3300009789 | Serpentine Soil | ERGECMLAMLFWVLATLAVVGALAIVWGLYLLARRWL* |
| Ga0126307_109511671 | 3300009789 | Serpentine Soil | MILLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVRR |
| Ga0126307_113783081 | 3300009789 | Serpentine Soil | LYPTASERGECMLAMLFWALAALAVVGALAIVWVLYLLVRR* |
| Ga0126307_114793771 | 3300009789 | Serpentine Soil | PWVTILLYPTASEREECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL* |
| Ga0126307_116935071 | 3300009789 | Serpentine Soil | LYPTASERGEMLAMLFWVLAALAVVGSLAIVWGLYLLVRRWL* |
| Ga0126307_117688032 | 3300009789 | Serpentine Soil | RGECMLAMLFWVLAALAVVGALAIVWGLYLLACRWL* |
| Ga0126313_1000628712 | 3300009840 | Serpentine Soil | TMLLYPTASEREECMLSMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126313_101524312 | 3300009840 | Serpentine Soil | LYPNASDQGERTVMLFWVLAALAVLGALALVWGLYLLARRWM* |
| Ga0126313_101822192 | 3300009840 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLVRRWL* |
| Ga0126313_102663501 | 3300009840 | Serpentine Soil | PWVTTLLYPTASEREECMLSMLFWVLAALAVGGALTAVWGLYLLARRWL* |
| Ga0126313_103293991 | 3300009840 | Serpentine Soil | RERGEKCIPAMLFDVFAVLSVVGVLAIVWGLYLLVRRWL* |
| Ga0126313_103896352 | 3300009840 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIVWG |
| Ga0126313_108026502 | 3300009840 | Serpentine Soil | VTILLYPTASERGECMLAMLFWVLAALAVVGALAIVWVLYLLVRRWL* |
| Ga0126313_108412682 | 3300009840 | Serpentine Soil | LYPTASEREECMLSMLFWVLAALAVVGVLAIVWGLYLLVHRWL* |
| Ga0126313_113966621 | 3300009840 | Serpentine Soil | MLLYPTASEREECMLSMLFWVLAALAVVGALAIVWGMYLLAHRWL* |
| Ga0126313_114209862 | 3300009840 | Serpentine Soil | LYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL* |
| Ga0126313_115219942 | 3300009840 | Serpentine Soil | LPWVTILLYPTASERGECMLAMLFWVLAALAVVGTLAIVWGLYLLARRWL* |
| Ga0126305_1000145015 | 3300010036 | Serpentine Soil | LPWVTILLYPTASERGECMLAMLFWVLAALAVGGALAIVWGLYLLAHRWL* |
| Ga0126305_100038988 | 3300010036 | Serpentine Soil | LYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLVRRWL* |
| Ga0126305_100346683 | 3300010036 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126305_100484531 | 3300010036 | Serpentine Soil | TASEREECMLSMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126305_100876894 | 3300010036 | Serpentine Soil | LLYPTASEREECMLAMLFFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126305_101158101 | 3300010036 | Serpentine Soil | LLYPTASERGECMLSMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126305_104523241 | 3300010036 | Serpentine Soil | EREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126305_104848281 | 3300010036 | Serpentine Soil | LPWVPILLYPTASERGECMLAMLFWVLAALAVVGTLAIVGGLYLLARRWL* |
| Ga0126305_105410081 | 3300010036 | Serpentine Soil | WVTTLLYPTASEREECMLSMLFWVLAALAVGGALTAVWGMYLLARRWL* |
| Ga0126305_105496281 | 3300010036 | Serpentine Soil | MILLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVR |
| Ga0126305_105507352 | 3300010036 | Serpentine Soil | LYPTTSEREECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL* |
| Ga0126305_107379612 | 3300010036 | Serpentine Soil | LYPTASERGECMLAMLFWVLAALAVGGALAVVWVLYLLVRRWL* |
| Ga0126305_107431361 | 3300010036 | Serpentine Soil | SLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126305_112306931 | 3300010036 | Serpentine Soil | LYLTASEREECMLAMLFWVFAALAVVGVLAIDWGLYLLARRWL* |
| Ga0126304_100266015 | 3300010037 | Serpentine Soil | ECMLAMLFWVLAALAVGGALAIVWGLYLLAHRWL* |
| Ga0126304_106303233 | 3300010037 | Serpentine Soil | YPTASERGECMLAMLFWVLAALAVGGALAVVWVLYLLVRRWL* |
| Ga0126304_111593192 | 3300010037 | Serpentine Soil | WVTILLYPTASEREECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL* |
| Ga0126304_111765952 | 3300010037 | Serpentine Soil | VGNDSLLYPTASERGECMLAMLFFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126315_100588452 | 3300010038 | Serpentine Soil | LYPTASEREECLLAMLFWVLAVLAVVGALAIVWVLYLLVRRWLQQRGAGRG* |
| Ga0126315_109379012 | 3300010038 | Serpentine Soil | MLLYPAASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126309_100937823 | 3300010039 | Serpentine Soil | LYPTASERGECILAMLFWVLAALAVGGVLAVVWGLYLLVRRWL* |
| Ga0126309_104257201 | 3300010039 | Serpentine Soil | ECMLAMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126309_104467912 | 3300010039 | Serpentine Soil | LYPTASERRECMLAMLFWVLAALAVVRALVIVWVLYLLARRWL* |
| Ga0126309_110200371 | 3300010039 | Serpentine Soil | LMYPTASKGRRCIPAMLFWIVAALSVLGTLATVWGLYLFARRWL* |
| Ga0126308_100026968 | 3300010040 | Serpentine Soil | VGNDSLLYPTASEREECMLAMLFFWVLAALAVGGALAIDWGLYLLARRWL* |
| Ga0126308_101736251 | 3300010040 | Serpentine Soil | GCALILAMLFWVVAVSSIVGVLAIVGGLYLLARR* |
| Ga0126308_101768853 | 3300010040 | Serpentine Soil | LYPTASEREECMLAMLFFWVLAALAVGGALAIVWGLYLLARRWL* |
| Ga0126308_102498712 | 3300010040 | Serpentine Soil | LLQRHPPWVTTLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126308_102804342 | 3300010040 | Serpentine Soil | LYPTAREREECMLAMLFWVVAVLSVVGVLVIVGGLYVLARRWL* |
| Ga0126308_103869111 | 3300010040 | Serpentine Soil | MYPTASKGRRCIPAMLFWIVAALSVLGTLATVWGLYLFARRWL* |
| Ga0126308_104135892 | 3300010040 | Serpentine Soil | LYPTASEREECMLAMLFWVFAALAVVGALAIVWGLYLLARRWL* |
| Ga0126308_104341591 | 3300010040 | Serpentine Soil | PWVTTLLYPTASERGECMLAMLFWVIAALAVVGALVIVWGLYLLTRRWL* |
| Ga0126308_104670183 | 3300010040 | Serpentine Soil | PWVTTSLYPTASERGECMLAMLFWVLAALAVVGTLAIVWGLFLLARRWL* |
| Ga0126308_106198132 | 3300010040 | Serpentine Soil | LYLTASEREECMLAMLFWVLAALAVVGVLAIDWGLYLLARRWL* |
| Ga0126308_106576991 | 3300010040 | Serpentine Soil | TVGNDSLLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL* |
| Ga0126308_107145771 | 3300010040 | Serpentine Soil | QPIGECIPAIFFWAVAVLGVLVVLAIVWGLYLLVRRWL* |
| Ga0126308_107885942 | 3300010040 | Serpentine Soil | LLYPTASERRECMLAMLFWVLAALAVVGALTIVWGLYLLARRWL* |
| Ga0126308_108430391 | 3300010040 | Serpentine Soil | ASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVHRWL* |
| Ga0126308_109453231 | 3300010040 | Serpentine Soil | LLYPTASEREECMLSMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126308_109784591 | 3300010040 | Serpentine Soil | LYPTASERRECMLAMLFWVLAALAVVGALAIDWGLYLLVRRWL* |
| Ga0126308_110007911 | 3300010040 | Serpentine Soil | VGNDSLLYPTASERGEWMLAMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126308_110449071 | 3300010040 | Serpentine Soil | WVTTLLYPTASEREECMLSMLFWVLAALAVVGALAIVWGLYLLVHRWL* |
| Ga0126308_111608941 | 3300010040 | Serpentine Soil | LYLTAGERGEGILAMLFWVLAALAVVGVLAIVWGLYLLG |
| Ga0126308_113061161 | 3300010040 | Serpentine Soil | LLYPTASERGECILAMLFWVLAALAVVGALAIVLGLYLLVRRWL* |
| Ga0126312_101594613 | 3300010041 | Serpentine Soil | VPDSKRERGECMLAMLFWVLAALAVVGALAIVWGLYLLACRWL* |
| Ga0126312_101644981 | 3300010041 | Serpentine Soil | TASERGECMLSMLFWVLAALAVVGALAIVWGLYLLVHRWL* |
| Ga0126312_102388882 | 3300010041 | Serpentine Soil | LYPTASEREECMLAMLFWVLATLAVVGALAIDWGLYLLARRWL* |
| Ga0126312_102646911 | 3300010041 | Serpentine Soil | RLPWVTTFLYPTASDRGECILAMLFWVVAVLSVVCVLAIVWGLYLLVRRRL* |
| Ga0126312_104257561 | 3300010041 | Serpentine Soil | LYPTASERGECILAMLFFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126312_104838131 | 3300010041 | Serpentine Soil | LYPTASEREECMLAMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126312_105154992 | 3300010041 | Serpentine Soil | LHPTASERGECMLAMLFWVLAVLSVVGALAFVGGLYLLARRWL* |
| Ga0126312_107098822 | 3300010041 | Serpentine Soil | ERLPWVTTLLYPTASEREECMLAMLFFWVLAALAVGGALAIVWGLYLSVRRWL* |
| Ga0126312_109503361 | 3300010041 | Serpentine Soil | LYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRRL* |
| Ga0126312_111282521 | 3300010041 | Serpentine Soil | ASERGECMLAMLFFWVLAALAVVGALAIVGGLYILARRWL* |
| Ga0126312_113124521 | 3300010041 | Serpentine Soil | QARPPWVTTSWHPTASDRGEDILAMLFWVLAALAIVGVLAIVWGLYFLVYRRL* |
| Ga0126312_113261521 | 3300010041 | Serpentine Soil | RVGGCMLAMLFWVLAALAVGGALAIVWGLYLLVRRWL* |
| Ga0126314_100090229 | 3300010042 | Serpentine Soil | LYPTASEREECMLSMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126314_100557843 | 3300010042 | Serpentine Soil | LYPTASERRECMLAMLFWVVAALAVASALAVLWGLYLLVRRWL* |
| Ga0126314_101238871 | 3300010042 | Serpentine Soil | LYPTASERGECMLAMLFWVLAALAVVGVLAIVWGLYLSVRRWL* |
| Ga0126314_101768201 | 3300010042 | Serpentine Soil | RLLWVTTSLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126314_101939114 | 3300010042 | Serpentine Soil | LYPTASERGECMLAMLFWVLAALAVVGALAIVWVLYLLVHRWL* |
| Ga0126314_103497621 | 3300010042 | Serpentine Soil | LYPTASEREECMLAMLFWVLAALAVVGALVIDWGLYLLARRWL* |
| Ga0126314_103569571 | 3300010042 | Serpentine Soil | ERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126314_104703991 | 3300010042 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYL |
| Ga0126314_107459183 | 3300010042 | Serpentine Soil | VGNDSLLYPTASERGECMLAMLFWVLAALAVVGALTIVWGLYLLARRWL* |
| Ga0126314_112990901 | 3300010042 | Serpentine Soil | MLLYPTASEREECMLSMLFWVLAALAVGGALAIVWGMYLLARRWL* |
| Ga0126314_113198702 | 3300010042 | Serpentine Soil | LLYPTASERGECMLAMLFWVLAALAVVGALAIVWVLYLLVRR* |
| Ga0126310_100238904 | 3300010044 | Serpentine Soil | LYPTASERGECILAMLFWVLAALALVGALAGVWGLYLLVRRWL* |
| Ga0126310_100742493 | 3300010044 | Serpentine Soil | CMLAMLFFWVLAALAVVGALAIVWVLYLLARRWL* |
| Ga0126310_101758202 | 3300010044 | Serpentine Soil | LYPTASERGECMLAMLFWVAAVLSVVGVLAIVWGMYLLARRWF* |
| Ga0126310_103939322 | 3300010044 | Serpentine Soil | GECIPAMFFWVVAALAVVGVLAIIWGLYLLVGRRL* |
| Ga0126310_107011751 | 3300010044 | Serpentine Soil | LVYQAASEGRRCIPAMLFDVFAALSVVGVLSKEEGLYLLVRRWL* |
| Ga0126310_107842041 | 3300010044 | Serpentine Soil | NDSLLYPTASERGECMLAMLFWVLAALAVVGALTIVWGLYLLARRWL* |
| Ga0126310_108704181 | 3300010044 | Serpentine Soil | LYPTASEREECMLSLLFWVLAALAVVGALAIVWGLYLLVHRWL* |
| Ga0126310_109736522 | 3300010044 | Serpentine Soil | ECMLAMLFWVLAALAVVGALTIVWGLYLLVRRWL* |
| Ga0126310_110678531 | 3300010044 | Serpentine Soil | LLWVTTSLYPTASERRECMLAMLFWVLAALAVVGALAIDWGLYLLVRRWL* |
| Ga0126310_115914651 | 3300010044 | Serpentine Soil | WVTMLLYPTASEREECMLSMLFWVLAGLAVVGALAIVWGMYLLAHRWL* |
| Ga0126311_100403533 | 3300010045 | Serpentine Soil | VGNDSVLYPTASERGECILAMLFWVLAALALVGALAGVWGLYLLVRRWL* |
| Ga0126311_101684431 | 3300010045 | Serpentine Soil | LYPTASEREECMLAMLFFWVLAALAVAGALVIVWGLYLLTCRWL* |
| Ga0126311_105295091 | 3300010045 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLVR |
| Ga0126311_111683571 | 3300010045 | Serpentine Soil | REECMLAMLFWVLAALAVVGALAIDWGLYLLVRRWL* |
| Ga0126311_113267351 | 3300010045 | Serpentine Soil | RLPWVTMLLYPTASEREECMLSMLFWVLAALAVVGALAIVWGMYLLAHRWL* |
| Ga0126311_114760261 | 3300010045 | Serpentine Soil | EECMLAMLFWVLAALAVVGALAIVWGLYLLAHRWL* |
| Ga0126311_115327381 | 3300010045 | Serpentine Soil | MLLYPTASEREECMLSMLFWVLAGLAVVGALAIVWGMYLLAHRWL* |
| Ga0126311_115499651 | 3300010045 | Serpentine Soil | MILLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126311_115991382 | 3300010045 | Serpentine Soil | LVEAAAGEGRWCIPAMLFDVFAVLSVVGVLAIVGGLYLLVRRWL* |
| Ga0126311_119179811 | 3300010045 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIVWGLYLLAHRW |
| Ga0126306_100700602 | 3300010166 | Serpentine Soil | MLLYPTASEREECMLAMLFWVLAALAVVGALAIDWG |
| Ga0126306_101697872 | 3300010166 | Serpentine Soil | VGNDSLLYPTASERGEGMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL* |
| Ga0126306_103328071 | 3300010166 | Serpentine Soil | TTLLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL* |
| Ga0126306_103595232 | 3300010166 | Serpentine Soil | MLLYPTASEREECMLSMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126306_104028921 | 3300010166 | Serpentine Soil | WVPMLLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0126306_106538981 | 3300010166 | Serpentine Soil | LYPTASERGECMLAMLFWVLAALAVVGALAIVWVLYLLVRRWL* |
| Ga0126306_110923492 | 3300010166 | Serpentine Soil | EREEWMLSMLFWVLAALAVGGALATVWGLYLLARRWL* |
| Ga0126306_111216021 | 3300010166 | Serpentine Soil | LYPIASEREECMLAMLFWVLAALAVEGALAIVWGLYLLVRRWL* |
| Ga0126306_111566991 | 3300010166 | Serpentine Soil | LYPTASERRECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL* |
| Ga0136620_100192721 | 3300012186 | Polar Desert Sand | MYPTASEGRRCIPAMLFWVVAALAILSVLAIVWGLYLLVRRWL* |
| Ga0182000_104998341 | 3300014487 | Soil | MLLYPTASEREECMLAMLFWALAALAVVGALAIVWGLYLLARRWL* |
| Ga0190268_104749282 | 3300018466 | Soil | REECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL |
| Ga0190271_111729101 | 3300018481 | Soil | LYPTASEREECTLAMLFWVLAALGVVGALVIVWGLYLLVRRWL |
| Ga0190273_122787482 | 3300018920 | Soil | PTASEGRRCIPAMLFWVVAALEILSVLAIVWGLYLLGRRWL |
| Ga0190267_105809681 | 3300019767 | Soil | LLYPTASEGGECILVMPFWVVAALAVAGALGIVWGLYLLA |
| Ga0209461_101644861 | 3300027750 | Agave | LLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLARRWL |
| Ga0299915_109704131 | 3300030613 | Soil | SDRGECMLAMLFWVLAALAVAGVLAIVLGLYLLTRRWL |
| Ga0307408_1007042091 | 3300031548 | Rhizosphere | LYPTASERGECMLAMLFWVLAALAVVGALAIVWVLYLLVRR |
| Ga0307405_108488441 | 3300031731 | Rhizosphere | LYPTASEREECILAMLFWVLAALAVVGALAIDWGLYLLARRWL |
| Ga0307405_118619952 | 3300031731 | Rhizosphere | LYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL |
| Ga0307406_101689913 | 3300031901 | Rhizosphere | PILLYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLARRWL |
| Ga0307407_110422782 | 3300031903 | Rhizosphere | RLLWVTILLYPTASERGECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL |
| Ga0307407_114377951 | 3300031903 | Rhizosphere | LYPTASEREECMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL |
| Ga0307412_119675321 | 3300031911 | Rhizosphere | LYPTASEREECMLSMLFWVLAALAVVGALAIVWGLYLLAHRWL |
| Ga0307409_1001974441 | 3300031995 | Rhizosphere | LYPTASEREECMLAMLFWVLAALAVVGALAIDWGLYLLVRRWL |
| Ga0307409_1014174412 | 3300031995 | Rhizosphere | YPTASEREECMLAMLFWVFAALAVVGALAIVWGLYLLARRWL |
| Ga0307416_1004679012 | 3300032002 | Rhizosphere | VGNDSLLYPTASERGECILAMLFWVLAALAVVGALA |
| Ga0307416_1021236381 | 3300032002 | Rhizosphere | LYPTASERGECMLAMLFWILAALAVVGALAIVWGLYLLARRWL |
| Ga0307416_1023149611 | 3300032002 | Rhizosphere | LYPTASERGEGMLAMLFWVLAALAVVGALAIVWGLYLLVRRWL |
| Ga0307416_1028113722 | 3300032002 | Rhizosphere | LQERQPWVRILLYPTASEREECMLSMLFWVLAALAVVGALAIDWGLYLLARRWL |
| Ga0307416_1036950621 | 3300032002 | Rhizosphere | LYPTASERGEGMLAMLFWVLAALAVVGALAIVWVLYLLVHRCP |
| Ga0307414_100443926 | 3300032004 | Rhizosphere | EECMLSMLFWVLAALAVVGALAIVWGLYLLAHRWL |
| Ga0307411_110351951 | 3300032005 | Rhizosphere | TIVLYPTASERGECMLAMLFWVLATLAVVGALAIDWGLYLLTRRWL |
| Ga0307411_118879772 | 3300032005 | Rhizosphere | PDSKRERGEMLSMLFWVLAALAVVGALVIVWGLYLLVHRWL |
| Ga0268251_102834061 | 3300032159 | Agave | LLQRRLPWVTTLLYPTASERGECMLAMLFWVLAALAVVGALTIVWVLYLLARRWL |
| ⦗Top⦘ |