


| Basic Information | |
|---|---|
| Family ID | F045545 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYAACLRCGATITK |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.58 % |
| % of genes near scaffold ends (potentially truncated) | 18.42 % |
| % of genes from short scaffolds (< 2000 bps) | 56.58 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.500 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (23.026 % of family members) |
| Environment Ontology (ENVO) | Unclassified (86.842 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (85.526 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 16.90% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 17.76 |
| PF09834 | DUF2061 | 16.45 |
| PF07235 | DUF1427 | 9.21 |
| PF04820 | Trp_halogenase | 3.95 |
| PF08241 | Methyltransf_11 | 1.97 |
| PF01583 | APS_kinase | 1.97 |
| PF00534 | Glycos_transf_1 | 1.32 |
| PF00011 | HSP20 | 1.32 |
| PF05050 | Methyltransf_21 | 1.32 |
| PF02675 | AdoMet_dc | 1.32 |
| PF13489 | Methyltransf_23 | 0.66 |
| PF00535 | Glycos_transf_2 | 0.66 |
| PF06067 | DUF932 | 0.66 |
| PF03796 | DnaB_C | 0.66 |
| PF00154 | RecA | 0.66 |
| PF13469 | Sulfotransfer_3 | 0.66 |
| PF01370 | Epimerase | 0.66 |
| PF13524 | Glyco_trans_1_2 | 0.66 |
| PF00565 | SNase | 0.66 |
| PF00085 | Thioredoxin | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 9.21 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 1.97 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.32 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.32 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.66 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.66 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.50 % |
| All Organisms | root | All Organisms | 37.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109929335 | Not Available | 2993 | Open in IMG/M |
| 3300002408|B570J29032_109933249 | Not Available | 3184 | Open in IMG/M |
| 3300002408|B570J29032_109938656 | Not Available | 3535 | Open in IMG/M |
| 3300002835|B570J40625_100000341 | Not Available | 76102 | Open in IMG/M |
| 3300002835|B570J40625_100326114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1537 | Open in IMG/M |
| 3300002835|B570J40625_100655022 | Not Available | 949 | Open in IMG/M |
| 3300003277|JGI25908J49247_10011556 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300004128|Ga0066180_10231352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300005580|Ga0049083_10255403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300005581|Ga0049081_10025031 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300005581|Ga0049081_10040060 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300005581|Ga0049081_10049771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
| 3300005581|Ga0049081_10217827 | Not Available | 680 | Open in IMG/M |
| 3300005581|Ga0049081_10310799 | Not Available | 541 | Open in IMG/M |
| 3300005581|Ga0049081_10317767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300005582|Ga0049080_10017434 | Not Available | 2502 | Open in IMG/M |
| 3300005582|Ga0049080_10087260 | Not Available | 1066 | Open in IMG/M |
| 3300005582|Ga0049080_10089542 | Not Available | 1050 | Open in IMG/M |
| 3300005582|Ga0049080_10090264 | Not Available | 1045 | Open in IMG/M |
| 3300005582|Ga0049080_10245977 | Not Available | 584 | Open in IMG/M |
| 3300005582|Ga0049080_10270262 | Not Available | 552 | Open in IMG/M |
| 3300005584|Ga0049082_10093321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
| 3300005584|Ga0049082_10216776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300005584|Ga0049082_10221337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300005585|Ga0049084_10030552 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300005662|Ga0078894_11062722 | Not Available | 693 | Open in IMG/M |
| 3300005805|Ga0079957_1122470 | Not Available | 1372 | Open in IMG/M |
| 3300007735|Ga0104988_10567 | Not Available | 17992 | Open in IMG/M |
| 3300007973|Ga0105746_1320823 | Not Available | 539 | Open in IMG/M |
| 3300008055|Ga0108970_11256500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300008107|Ga0114340_1005554 | Not Available | 6684 | Open in IMG/M |
| 3300008120|Ga0114355_1096359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1175 | Open in IMG/M |
| 3300008263|Ga0114349_1160098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300008450|Ga0114880_1001998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11827 | Open in IMG/M |
| 3300008962|Ga0104242_1039245 | Not Available | 805 | Open in IMG/M |
| 3300009068|Ga0114973_10080206 | Not Available | 1875 | Open in IMG/M |
| 3300009068|Ga0114973_10438132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300009068|Ga0114973_10498807 | Not Available | 631 | Open in IMG/M |
| 3300009068|Ga0114973_10728064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300009152|Ga0114980_10114868 | Not Available | 1606 | Open in IMG/M |
| 3300009152|Ga0114980_10200266 | Not Available | 1175 | Open in IMG/M |
| 3300009158|Ga0114977_10007269 | Not Available | 7032 | Open in IMG/M |
| 3300009158|Ga0114977_10030640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3372 | Open in IMG/M |
| 3300009158|Ga0114977_10031489 | Not Available | 3324 | Open in IMG/M |
| 3300009159|Ga0114978_10023087 | Not Available | 4543 | Open in IMG/M |
| 3300009159|Ga0114978_10191889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1295 | Open in IMG/M |
| 3300009159|Ga0114978_10703465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300009160|Ga0114981_10011633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5224 | Open in IMG/M |
| 3300009160|Ga0114981_10409198 | Not Available | 730 | Open in IMG/M |
| 3300009161|Ga0114966_10522263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300009164|Ga0114975_10116820 | Not Available | 1538 | Open in IMG/M |
| 3300009181|Ga0114969_10457043 | Not Available | 721 | Open in IMG/M |
| 3300009183|Ga0114974_10014273 | Not Available | 5709 | Open in IMG/M |
| 3300010885|Ga0133913_12993147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1127 | Open in IMG/M |
| 3300011995|Ga0153800_1026858 | Not Available | 600 | Open in IMG/M |
| 3300012000|Ga0119951_1001068 | Not Available | 16702 | Open in IMG/M |
| 3300012013|Ga0153805_1028275 | Not Available | 953 | Open in IMG/M |
| 3300013004|Ga0164293_10869573 | Not Available | 568 | Open in IMG/M |
| 3300020151|Ga0211736_10001199 | Not Available | 571 | Open in IMG/M |
| 3300020151|Ga0211736_10230306 | Not Available | 3654 | Open in IMG/M |
| 3300020151|Ga0211736_10375297 | Not Available | 1235 | Open in IMG/M |
| 3300020159|Ga0211734_10056462 | Not Available | 1488 | Open in IMG/M |
| 3300020159|Ga0211734_10258784 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300020159|Ga0211734_10552323 | Not Available | 2372 | Open in IMG/M |
| 3300020159|Ga0211734_11177052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300020160|Ga0211733_10014931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
| 3300020160|Ga0211733_10791856 | Not Available | 526 | Open in IMG/M |
| 3300020161|Ga0211726_10431160 | Not Available | 3131 | Open in IMG/M |
| 3300020161|Ga0211726_10559493 | Not Available | 1413 | Open in IMG/M |
| 3300020161|Ga0211726_10745261 | Not Available | 836 | Open in IMG/M |
| 3300020161|Ga0211726_10776513 | Not Available | 567 | Open in IMG/M |
| 3300020162|Ga0211735_10147718 | Not Available | 830 | Open in IMG/M |
| 3300020162|Ga0211735_10148124 | Not Available | 1040 | Open in IMG/M |
| 3300020162|Ga0211735_11609965 | Not Available | 4025 | Open in IMG/M |
| 3300020172|Ga0211729_10365599 | Not Available | 625 | Open in IMG/M |
| 3300020172|Ga0211729_10605309 | Not Available | 545 | Open in IMG/M |
| 3300020172|Ga0211729_10678665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300020172|Ga0211729_11120679 | Not Available | 841 | Open in IMG/M |
| 3300020172|Ga0211729_11295612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300020172|Ga0211729_11457948 | Not Available | 1053 | Open in IMG/M |
| 3300020205|Ga0211731_10176612 | Not Available | 508 | Open in IMG/M |
| 3300020205|Ga0211731_11262253 | Not Available | 2113 | Open in IMG/M |
| 3300020527|Ga0208232_1002354 | Not Available | 3358 | Open in IMG/M |
| 3300020529|Ga0208233_1005322 | Not Available | 2072 | Open in IMG/M |
| 3300020530|Ga0208235_1027721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300020533|Ga0208364_1056176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300022752|Ga0214917_10004807 | All Organisms → cellular organisms → Bacteria | 14796 | Open in IMG/M |
| 3300023174|Ga0214921_10003743 | Not Available | 22995 | Open in IMG/M |
| 3300023174|Ga0214921_10006111 | Not Available | 16660 | Open in IMG/M |
| 3300023174|Ga0214921_10055340 | Not Available | 3426 | Open in IMG/M |
| 3300023174|Ga0214921_10066932 | Not Available | 2972 | Open in IMG/M |
| 3300023179|Ga0214923_10000268 | Not Available | 79621 | Open in IMG/M |
| 3300023179|Ga0214923_10053252 | Not Available | 3062 | Open in IMG/M |
| 3300027586|Ga0208966_1011902 | Not Available | 2587 | Open in IMG/M |
| 3300027586|Ga0208966_1044299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
| 3300027608|Ga0208974_1010359 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300027608|Ga0208974_1015050 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
| 3300027608|Ga0208974_1018757 | Not Available | 2167 | Open in IMG/M |
| 3300027608|Ga0208974_1062198 | Not Available | 1050 | Open in IMG/M |
| 3300027608|Ga0208974_1075555 | Not Available | 928 | Open in IMG/M |
| 3300027649|Ga0208960_1028996 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300027659|Ga0208975_1006427 | Not Available | 4262 | Open in IMG/M |
| 3300027659|Ga0208975_1053205 | Not Available | 1239 | Open in IMG/M |
| 3300027659|Ga0208975_1156810 | Not Available | 632 | Open in IMG/M |
| 3300027688|Ga0209553_1243436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1019829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5079 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1018776 | Not Available | 5287 | Open in IMG/M |
| 3300027732|Ga0209442_1005143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6656 | Open in IMG/M |
| 3300027733|Ga0209297_1005071 | Not Available | 6820 | Open in IMG/M |
| 3300027733|Ga0209297_1038718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2194 | Open in IMG/M |
| 3300027734|Ga0209087_1005331 | Not Available | 6893 | Open in IMG/M |
| 3300027736|Ga0209190_1002614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12083 | Open in IMG/M |
| 3300027736|Ga0209190_1365302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300027744|Ga0209355_1304214 | Not Available | 603 | Open in IMG/M |
| 3300027759|Ga0209296_1000137 | Not Available | 62841 | Open in IMG/M |
| 3300027759|Ga0209296_1014161 | Not Available | 4689 | Open in IMG/M |
| 3300027770|Ga0209086_10312863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300027772|Ga0209768_10074735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
| 3300027782|Ga0209500_10003239 | Not Available | 11229 | Open in IMG/M |
| 3300027782|Ga0209500_10021741 | Not Available | 3721 | Open in IMG/M |
| 3300027782|Ga0209500_10029969 | Not Available | 3076 | Open in IMG/M |
| 3300027798|Ga0209353_10264976 | Not Available | 736 | Open in IMG/M |
| 3300027892|Ga0209550_10275762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300027963|Ga0209400_1095869 | Not Available | 1393 | Open in IMG/M |
| 3300027971|Ga0209401_1059757 | Not Available | 1691 | Open in IMG/M |
| 3300027973|Ga0209298_10003823 | Not Available | 8914 | Open in IMG/M |
| 3300027973|Ga0209298_10092874 | Not Available | 1326 | Open in IMG/M |
| 3300027974|Ga0209299_1224768 | Not Available | 678 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1009235 | Not Available | 9583 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1072997 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300028025|Ga0247723_1006149 | Not Available | 5291 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1037772 | Not Available | 3004 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1286718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300031758|Ga0315907_10007964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10953 | Open in IMG/M |
| 3300031758|Ga0315907_10061832 | Not Available | 3263 | Open in IMG/M |
| 3300031857|Ga0315909_10283964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
| 3300031857|Ga0315909_10286067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300031857|Ga0315909_10546390 | Not Available | 788 | Open in IMG/M |
| 3300032050|Ga0315906_10825819 | Not Available | 723 | Open in IMG/M |
| 3300034061|Ga0334987_0002819 | Not Available | 16855 | Open in IMG/M |
| 3300034061|Ga0334987_0060791 | All Organisms → cellular organisms → Bacteria | 3072 | Open in IMG/M |
| 3300034062|Ga0334995_0046955 | Not Available | 3559 | Open in IMG/M |
| 3300034062|Ga0334995_0054069 | Not Available | 3261 | Open in IMG/M |
| 3300034071|Ga0335028_0086594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2070 | Open in IMG/M |
| 3300034082|Ga0335020_0039193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2549 | Open in IMG/M |
| 3300034082|Ga0335020_0168006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1103 | Open in IMG/M |
| 3300034082|Ga0335020_0443679 | Not Available | 621 | Open in IMG/M |
| 3300034102|Ga0335029_0083408 | Not Available | 2283 | Open in IMG/M |
| 3300034103|Ga0335030_0019354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5212 | Open in IMG/M |
| 3300034106|Ga0335036_0701520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300034283|Ga0335007_0024937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 4719 | Open in IMG/M |
| 3300034284|Ga0335013_0521747 | Not Available | 707 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.03% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 18.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.97% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.97% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.66% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.66% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.66% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.66% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.66% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1099293358 | 3300002408 | Freshwater | MIKQIALFFICKFKSHSLVDAGSCPFTGKNYVACLRCGATITK* |
| B570J29032_1099332495 | 3300002408 | Freshwater | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYAACLRCGATITK* |
| B570J29032_1099386562 | 3300002408 | Freshwater | MLNFFICKIKSHNLVDAGSCPFTGKSYLACLRCGATITK* |
| B570J40625_10000034169 | 3300002835 | Freshwater | MIKQIILFFICKIKLHNLVDAGSCPFTGKNYAACLRCGVTIVK* |
| B570J40625_1003261144 | 3300002835 | Freshwater | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYAACLRCGATRTK* |
| B570J40625_1006550223 | 3300002835 | Freshwater | MIKQIALFFICKFKSHELIGAGSCPFTGKDYLACLRCGATIEK* |
| JGI25908J49247_100115566 | 3300003277 | Freshwater Lake | MIKQITLFFICKIKSHDLVDAGSCPFTGKNYVACLRCGATITK* |
| Ga0066180_102313523 | 3300004128 | Freshwater Lake | MIKQIGLFFICKIKSHNLVDAGSCPFTGKNYAACLRCGETITK* |
| Ga0049083_102554033 | 3300005580 | Freshwater Lentic | MIKQIGLFFICKIKSHSLVDAGSCPFTGKNYAACLRCGATISK* |
| Ga0049081_100250315 | 3300005581 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACTRCGATITK* |
| Ga0049081_100400605 | 3300005581 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTVTK* |
| Ga0049081_100497713 | 3300005581 | Freshwater Lentic | MIKQIGLFFICKIKLHNLVDAGSCPFTGKNYAACLRCGATITK* |
| Ga0049081_102178272 | 3300005581 | Freshwater Lentic | MIKQIVLFFICKLKSHNLVDAGACPFTGKNYAACLRCGATITK* |
| Ga0049081_103107992 | 3300005581 | Freshwater Lentic | MIKQIALFFVCKLKSHNLVDAGACPFTGKNYAACLRCGATITK* |
| Ga0049081_103177672 | 3300005581 | Freshwater Lentic | MIKQIALFFVCKFKSHNLVDAGACPFTGKNYVACLRCGATIAK* |
| Ga0049080_100174345 | 3300005582 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYNACLRCGVTITK* |
| Ga0049080_100872602 | 3300005582 | Freshwater Lentic | MIKQIALFFICKLKSHSLVDAGSCPFTGKNYVACLRCGATITK* |
| Ga0049080_100895423 | 3300005582 | Freshwater Lentic | MIKQIALFFVCKLKSHNLIDAGSCPFTGKNYAGCIRCGATIAK* |
| Ga0049080_100902642 | 3300005582 | Freshwater Lentic | MIKQVGLFFICKIKSHSLVDAGSCPFTGKNYAACLRCGATISK* |
| Ga0049080_102459772 | 3300005582 | Freshwater Lentic | MIRKVLLLFICKFKKHTLVNAGSCPFTGKDYVACLRCGATIAK* |
| Ga0049080_102702622 | 3300005582 | Freshwater Lentic | LGAKIIKQLLNIFICKIKAHSLVDAGSCPFTGKSYNACLRCGATITK* |
| Ga0049082_100933213 | 3300005584 | Freshwater Lentic | MIKQFGLFFICKIKSHNLVDAGSCPFTGKNYTACLRCGATITK* |
| Ga0049082_102167762 | 3300005584 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKNYAACLRCGATIAK* |
| Ga0049082_102213371 | 3300005584 | Freshwater Lentic | QIGLFFICKIKSHNLVDAGSCPFTGKNYAACLRCGATITK* |
| Ga0049084_100305525 | 3300005585 | Freshwater Lentic | MIKQIVLFFICKLKSHSLVDAGSCPFTGKNYVACLRCGATITK* |
| Ga0078894_110627223 | 3300005662 | Freshwater Lake | FFICKIKSHNLVDAGSCPFTGKNYAACLRCGATITK* |
| Ga0079957_11224705 | 3300005805 | Lake | MIKQIAMFFVCKIKSHNFVEAGSCPFTGKSYRACLRCGVTIAK* |
| Ga0104988_1056732 | 3300007735 | Freshwater | MIKQISLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTVTK* |
| Ga0105746_13208233 | 3300007973 | Estuary Water | VIKQITLFLICKIKSHNLVDAGSCPFTGKSYNACIRCGVTITK* |
| Ga0108970_112565003 | 3300008055 | Estuary | VLFFICKIKSHILVDAGSCPFTGKNYQACLRCGETIAK* |
| Ga0114340_100555418 | 3300008107 | Freshwater, Plankton | MIKNVINYFICKIKEHNLVDAGSCPFTGKNYIACLRCGGLQTK* |
| Ga0114355_10963593 | 3300008120 | Freshwater, Plankton | MIKQIALFFICKIRSHNLVDAGSCPFTGKDYAACLRCGATTAK* |
| Ga0114349_11600981 | 3300008263 | Freshwater, Plankton | KMIKNVINYFICKIKEHNLVDAGSCPFTGKNYIACLRCGGLQTK* |
| Ga0114880_10019981 | 3300008450 | Freshwater Lake | ICKIKKHTLVLSGSCPFTGKTYDVCTRCGVSIPK* |
| Ga0104242_10392452 | 3300008962 | Freshwater | MAHRYSFDKIKNHDLVSAGACPFTGKSYMACLRCGGTIAK* |
| Ga0114973_100802064 | 3300009068 | Freshwater Lake | MLKIFICKLKGHNFVDAGSCPFTGKSYSACLKCGATIAK* |
| Ga0114973_104381323 | 3300009068 | Freshwater Lake | MIKQIGLFFICKIKSHNLVDAGSCPFTGKNYVACLRCGATIEK* |
| Ga0114973_104988072 | 3300009068 | Freshwater Lake | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYLACLRCGVTITK* |
| Ga0114973_107280643 | 3300009068 | Freshwater Lake | MIKQIALFFICKIKSHNLVDAGSCPFTGKDYVACLRCGATTAK* |
| Ga0114980_101148684 | 3300009152 | Freshwater Lake | MIKQIALFFICRIKSHILVDAGSCPFTGKSYNACLRCGATITK* |
| Ga0114980_102002663 | 3300009152 | Freshwater Lake | MIKQIALFFVCKIKTHNFVDAGSCPFTGKSYNACLRCGVTITK* |
| Ga0114977_100072694 | 3300009158 | Freshwater Lake | MIKQIGMFFICKIKSHNFVDAGSCPFTGKSYLACLRCERTLSK* |
| Ga0114977_100306401 | 3300009158 | Freshwater Lake | MIKQIGLFFICKIKSHNFVDAGSCPFTGKSYSACLRCGVTVTK* |
| Ga0114977_1003148911 | 3300009158 | Freshwater Lake | MIKQVGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTVTK* |
| Ga0114978_100230878 | 3300009159 | Freshwater Lake | MIKQIALFFICKFKSHDLVDAGACPFTGKNYVACLRCGGTKTK* |
| Ga0114978_101918892 | 3300009159 | Freshwater Lake | MIKQIALFFVCKFKSHNLVDAGSCPFTGKNYAACLRCGVTITK* |
| Ga0114978_107034651 | 3300009159 | Freshwater Lake | MIKQVGLFFICKIKSHNLVDAGSCPFTGKSYSACLRC |
| Ga0114981_1001163310 | 3300009160 | Freshwater Lake | MIKQIGMFFICKIKTHNLVDAGSCPFTGKNYSGCIRCGAIITK* |
| Ga0114981_104091982 | 3300009160 | Freshwater Lake | MHNKPIDLFNYFICKFKKHNLVDAGSCPFTGKSYVICLRCGATKTK* |
| Ga0114966_105222633 | 3300009161 | Freshwater Lake | MIKQIALFFVCKIKSHNLVDAGSCPFTGKNYVACLRCGATITK* |
| Ga0114975_101168203 | 3300009164 | Freshwater Lake | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYNACLRCGATITK* |
| Ga0114969_104570431 | 3300009181 | Freshwater Lake | NKMIKQIALFFICKIKSHNLVDAGSCPFTGKSYLACLRCGVTITK* |
| Ga0114974_100142738 | 3300009183 | Freshwater Lake | MIKQIALFFICKFKSHNLVDAGSCPFTGKNYAACLRCGATITK* |
| Ga0133913_129931473 | 3300010885 | Freshwater Lake | MRNKNNIEIIKFIYNYIVCKFKKHTLVSAGACPFTGKSYMACLRCGATIAK* |
| Ga0153800_10268583 | 3300011995 | Freshwater | MIKKILLLFICKFKKHTLVNAGSCPFTGKDYVACLRCGATIAK* |
| Ga0119951_100106811 | 3300012000 | Freshwater | MIKQISLFFICKIKSHNLINAGACPFTGKNYAACLRCGVTVTK* |
| Ga0153805_10282752 | 3300012013 | Surface Ice | MIKQIALFFVCKLKSHNLVDAGACPFTGKNYAACLRCGATIAK* |
| Ga0164293_108695732 | 3300013004 | Freshwater | MIKQIALFFICKIKSHNFVDAGSCPFTGKSYNGCLRCGATITK* |
| Ga0211736_100011991 | 3300020151 | Freshwater | RGSKMIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTTTK |
| Ga0211736_102303063 | 3300020151 | Freshwater | MIKQIVLFFICKFKSHSLVDAGSCPFTGKNYVACIRCGATITK |
| Ga0211736_103752973 | 3300020151 | Freshwater | MIKNIINYFICKIKSHNLFEAGECPFTGKSYMVCLRCEGTTTK |
| Ga0211734_100564622 | 3300020159 | Freshwater | MIRQIGLFFICKIKSHNLVDAGSCPFTGKSYNACLRCGVTITK |
| Ga0211734_102587844 | 3300020159 | Freshwater | MIKNIINYFICKIKSHNLVEAGECPFTGKGYMVCLRCEGTTTK |
| Ga0211734_105523233 | 3300020159 | Freshwater | MLKFFICKIKSHNLVDAGSCPFTGNSYLACLRCGATITK |
| Ga0211734_111770521 | 3300020159 | Freshwater | MIKQIALFFVCKFKSHNLVDAGSCPFTGKNYVACLRCGATITK |
| Ga0211733_100149311 | 3300020160 | Freshwater | MIKQLAMLFFCKIRSHNLVDAGACPFTGKNYAACLRCGVTITK |
| Ga0211733_107918563 | 3300020160 | Freshwater | QIGLFFICKIKSHNLVDAGSCPFTGKSYLACLRCGATITK |
| Ga0211726_104311604 | 3300020161 | Freshwater | MIKKIILFFICKLKNHSMIDGGSCPFTGKSYNTCLRCGNSIEK |
| Ga0211726_105594935 | 3300020161 | Freshwater | MIKQVGLFFICKIKSHNLVDAGACPFTGKNYAACIRCGVTVTK |
| Ga0211726_107452614 | 3300020161 | Freshwater | MIKKILLLLICKFKKHTLVSAGSCPFTGKDYVACLRCGATIAK |
| Ga0211726_107765132 | 3300020161 | Freshwater | MIKQIILFFICKIKSHNLVDAGSCPFTGKSYLACLRCGATITK |
| Ga0211735_101477183 | 3300020162 | Freshwater | GSKMIKQIGLFFICKIKSHNLIDAGSCPFTGKSYLACLRCGVTITK |
| Ga0211735_101481241 | 3300020162 | Freshwater | GSKMIKQIGLFFICKIKSHNLIDAGSCPFTGKNYVACLRCGATIAK |
| Ga0211735_116099659 | 3300020162 | Freshwater | MIKQLAMLFFCKIRSHNLVDAGSCPFTGKNYAACLRCGATIAK |
| Ga0211729_103655992 | 3300020172 | Freshwater | MIKQIYLFFICKIKSHNFIAAGACPFTGKNYEACLRCGVTIAK |
| Ga0211729_106053091 | 3300020172 | Freshwater | SYKRGSKMIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTTTK |
| Ga0211729_106786653 | 3300020172 | Freshwater | MIKQIALFFICKIKSHSLVDAGSCPFTGKNYVACLRCGATIAK |
| Ga0211729_111206793 | 3300020172 | Freshwater | MIKQVGLFFICKIKSHNLVDAGACPFTGKNYAACLRCGVTVTR |
| Ga0211729_112956121 | 3300020172 | Freshwater | MIKNIINYFICKIKSHNLVEAGECPFTGKSYIVCLRCEGTTTK |
| Ga0211729_114579483 | 3300020172 | Freshwater | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYLGCLRCGVTITK |
| Ga0211731_101766121 | 3300020205 | Freshwater | QIGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTATK |
| Ga0211731_112622537 | 3300020205 | Freshwater | MIKQICLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTTT |
| Ga0208232_10023543 | 3300020527 | Freshwater | MLNFFICKIKSHNLVDAGSCPFTGKSYLACLRCGATITK |
| Ga0208233_10053224 | 3300020529 | Freshwater | MIKQIILFFICKIKLHNLVDAGSCPFTGKNYAACLRCGVTIVK |
| Ga0208235_10277213 | 3300020530 | Freshwater | MIKQVGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTVTK |
| Ga0208364_10561761 | 3300020533 | Freshwater | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYAACLRCGATITK |
| Ga0214917_1000480718 | 3300022752 | Freshwater | MHNKSINLFNYFICKFKKHDLVNSGACPFTGKSYSACLRCGVMVAK |
| Ga0214921_1000374321 | 3300023174 | Freshwater | MIKLLICKIKKHNLFDAGSCPFTGKTYMGCLRCGGTIEK |
| Ga0214921_1000611130 | 3300023174 | Freshwater | MIKQITLFFICKIKSHDLVDAGSCPFTGKDYVACLRCGATITK |
| Ga0214921_100553405 | 3300023174 | Freshwater | MIKQIALFFICKIKSHNFIDAGSCPFTGKSYNVCTRCGATITK |
| Ga0214921_1006693211 | 3300023174 | Freshwater | MIKQISLFFICKIKSHNLINAGACPFTGKNYAACLRCGVTVTK |
| Ga0214923_1000026828 | 3300023179 | Freshwater | VIKQFIMFFICKIKTHNLVEAGACPFTGKNYNACLRCGITIVK |
| Ga0214923_100532525 | 3300023179 | Freshwater | MIKQIGLFFICKIKTHNLVDAGACPFTGKNYAACLRCGVTIAK |
| Ga0208966_10119021 | 3300027586 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKNYAACLRCGETITK |
| Ga0208966_10442996 | 3300027586 | Freshwater Lentic | VSYKRGSKMIKQIGLFFICKIKSHNLVDAGSCPFTGKNYAACLRCGETITK |
| Ga0208974_10103594 | 3300027608 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYNACLRCGVTITK |
| Ga0208974_10150507 | 3300027608 | Freshwater Lentic | MIKQIGLFFICKIKLHNLVDAGSCPFTGKNYAACLRCGATITK |
| Ga0208974_10187575 | 3300027608 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACTRCGATITK |
| Ga0208974_10621983 | 3300027608 | Freshwater Lentic | MIKQIVLFFICKLKSHNLVDAGACPFTGKNYAACLRCGATITK |
| Ga0208974_10755553 | 3300027608 | Freshwater Lentic | MIKQIALFFVCKLKSHNLIDAGSCPFTGKNYAGCIRCGATIAK |
| Ga0208960_10289966 | 3300027649 | Freshwater Lentic | MIKQIVLFFICKLKSHSLVDAGSCPFTGKNYVACLRCGATITK |
| Ga0208975_10064275 | 3300027659 | Freshwater Lentic | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGGTVTK |
| Ga0208975_10532053 | 3300027659 | Freshwater Lentic | MIKQIALFFVCKLKSHNLVDAGACPFTGKNYAACLRCGATITK |
| Ga0208975_11568103 | 3300027659 | Freshwater Lentic | IMIRKVLLLFICKFKKHTLVNAGSCPFTGKDYVACLRCGATITK |
| Ga0209553_12434361 | 3300027688 | Freshwater Lake | MIKQIALFFVCKLKSHNLVDAGACPFTGKNYAACLRCGAAIVK |
| (restricted) Ga0247836_10198295 | 3300027728 | Freshwater | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYLACLRCGGTITK |
| (restricted) Ga0247833_10187762 | 3300027730 | Freshwater | MIKQVGLFFICKIKSHSLVDAGACPFTGKNYAACTRCGAMITI |
| Ga0209442_100514310 | 3300027732 | Freshwater Lake | MIKQITLFFICKIKSHDLVDAGSCPFTGKNYVACLRCGATITK |
| Ga0209297_10050714 | 3300027733 | Freshwater Lake | MIKQIGMFFICKIKSHNFVDAGSCPFTGKSYLACLRCERTLSK |
| Ga0209297_10387181 | 3300027733 | Freshwater Lake | MIKQIGLFFICKIKSHNFVDAGSCPFTGKSYSACLRCGVTVTK |
| Ga0209087_100533117 | 3300027734 | Freshwater Lake | MIKQIGLFFICKIKSHNLVDAGSCPFTGKSYSACLRCGVTKTK |
| Ga0209190_100261419 | 3300027736 | Freshwater Lake | MIKQIGLFFICKIKSHSLVDAGSCPFTGKNYAACLRCGATITK |
| Ga0209190_13653023 | 3300027736 | Freshwater Lake | MIKQIALFFICKIKSHNLVDAGSCPFTGKDYVACLRCGATTAK |
| Ga0209355_13042143 | 3300027744 | Freshwater Lake | IALFFVCKLKSHNLVDAGACPFTGKNYAACLRCGATITK |
| Ga0209296_100013729 | 3300027759 | Freshwater Lake | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYNACLRCGATITK |
| Ga0209296_10141618 | 3300027759 | Freshwater Lake | MIKQIALFFICKFKSHNLVDAGSCPFTGKNYAACLRCGATITK |
| Ga0209086_103128632 | 3300027770 | Freshwater Lake | MIKQIALFFVCKIKSHNLVDAGSCPFTGKNYVACLRCGATITK |
| Ga0209768_100747352 | 3300027772 | Freshwater Lake | MIKQIGLFFICKIKSHSLVDAGSCPFTGKNYAACLRCGATISK |
| Ga0209500_100032399 | 3300027782 | Freshwater Lake | MIKQIALFFICKFKSHDLVDAGACPFTGKNYVACLRCGGTKTK |
| Ga0209500_100217418 | 3300027782 | Freshwater Lake | MIRQIGLFFICKIRSHNLVDAGSCPFTGKTYVACLRCGGTITK |
| Ga0209500_100299695 | 3300027782 | Freshwater Lake | MIKQIALFFVCKIKTHNFVDAGSCPFTGKSYNACLRCGVTITK |
| Ga0209353_102649761 | 3300027798 | Freshwater Lake | MIKQIGLFFICKIKSHSLVDAGSCPFTGKNYAACLRCGATIS |
| Ga0209550_102757625 | 3300027892 | Freshwater Lake | MIKQIALFFICKIKSHILVDAGSCPFTGKNYVACLRCGATITK |
| Ga0209400_10958693 | 3300027963 | Freshwater Lake | MIKQIALFLICKIKSHNLVDAGSCPFTGKSYNACLRCGATITK |
| Ga0209401_10597573 | 3300027971 | Freshwater Lake | MLKIFICKLKGHNFVDAGSCPFTGKSYSACLKCGATIAK |
| Ga0209298_100038238 | 3300027973 | Freshwater Lake | MIKQIGMFFICKIKTHNLVDAGSCPFTGKNYSGCIRCGAIITK |
| Ga0209298_100928743 | 3300027973 | Freshwater Lake | MIKQIALFFICRIKSHILVDAGSCPFTGKSYNACLRCGATITK |
| Ga0209299_12247682 | 3300027974 | Freshwater Lake | MHNKPIDLFNYFICKFKKHNLVDAGSCPFTGKSYVICLRCGATKTK |
| (restricted) Ga0247834_100923523 | 3300027977 | Freshwater | MIKQVGLFFICKIKSHSLVDAGACPFTGKNYAACTRCGAMIAI |
| (restricted) Ga0247834_10729974 | 3300027977 | Freshwater | MIKQVCLFFICKIKLHDLVDAGSCPFTGKSYLACLRCGVTITK |
| Ga0247723_100614912 | 3300028025 | Deep Subsurface Sediment | MIKQIALFFICKIKSHNLVDAGSCPFTGKNYNACLRCGVTITK |
| (restricted) Ga0247839_10377721 | 3300028553 | Freshwater | MIKQVGLFFICKIKSHSLVDAGACPFTGKNYAACTRCGAMI |
| (restricted) Ga0247839_12867181 | 3300028553 | Freshwater | LFFICKIKSHSLVDAGACPFTGKNYAACTRCGAMITI |
| Ga0315907_100079649 | 3300031758 | Freshwater | MIKNVINYFICKIKEHNLVDAGSCPFTGKNYIACLRCGGLQTK |
| Ga0315907_100618324 | 3300031758 | Freshwater | MLKFFICKIKSHNLVDAGSCPFTSKSYLACLRCGITIIK |
| Ga0315909_102839643 | 3300031857 | Freshwater | MIKSIIKYFICKIKQHDMVDAGSCPFTGKTYVECTRCGVNLEK |
| Ga0315909_102860673 | 3300031857 | Freshwater | MIKQIILFFICKIKSHNLVDAGSCPFTGKNYAACLRCGVTIVK |
| Ga0315909_105463901 | 3300031857 | Freshwater | MIKQIALFFICKIRSHNLVDAGSCPFTGKDYAACLRCGATTAK |
| Ga0315906_108258195 | 3300032050 | Freshwater | MIKQIILFFICKIKSHNLVDAGSCPFTGKNYAACLRCGV |
| Ga0334987_0002819_7180_7311 | 3300034061 | Freshwater | MIKQIALFFICKLKSHSLVDAGSCPFTGKNYVACLRCGATITK |
| Ga0334987_0060791_194_325 | 3300034061 | Freshwater | MIKQIIMFFVCKIKSHNLVEVGACPFTGKSYNACLRCGVTIAK |
| Ga0334995_0046955_2888_3019 | 3300034062 | Freshwater | MIKNIINYFICKIKEHNLVDAGSCPFTGKNYMACLRCGGLETK |
| Ga0334995_0054069_2109_2240 | 3300034062 | Freshwater | MIKQIALFFICKFKSHSLVDAGSCPFTGKNYVACLRCGATITK |
| Ga0335028_0086594_975_1106 | 3300034071 | Freshwater | MIKQIALFFICKIKSHNLVDAGSCPFTGKSYAACLRCGATRTK |
| Ga0335020_0039193_2_124 | 3300034082 | Freshwater | MIKQVALFFVCKLKSHNLVDAGACPFTGKNYVACLRCGATI |
| Ga0335020_0168006_857_976 | 3300034082 | Freshwater | MFKFFICKLKSHNLVDAGACPFTGKNYAACLRCGATIAK |
| Ga0335020_0443679_512_619 | 3300034082 | Freshwater | MIKNIINYFICKIKKHNMVNAGSCPFTGKNYIACLR |
| Ga0335029_0083408_1584_1715 | 3300034102 | Freshwater | MIKQIIMFFVCKIKSHSLVEAGACPFTGKSYTACLRCGVTIAK |
| Ga0335030_0019354_2139_2261 | 3300034103 | Freshwater | MIKGFICKIKEHNMIPAGSCPFTGKTYDVCSRCNKTIAKQ |
| Ga0335036_0701520_201_332 | 3300034106 | Freshwater | MIKNIINYFICKIKKHNMVNAGSCPFTGKNYIACLRCERMVEK |
| Ga0335007_0024937_1957_2076 | 3300034283 | Freshwater | MLKFFICKIKKHLLVDAGSCPFTRKNYNACLRCGVTIVK |
| Ga0335013_0521747_370_501 | 3300034284 | Freshwater | MIKQIALFFICKIKSHNFVDAGSCPFTGKSYNGCLRCGATITK |
| ⦗Top⦘ |