


| Basic Information | |
|---|---|
| Family ID | F045399 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.39 % |
| % of genes from short scaffolds (< 2000 bps) | 94.12 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.353 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.379 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.523 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.477 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.63% β-sheet: 0.00% Coil/Unstructured: 94.37% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF07519 | Tannase | 2.61 |
| PF00756 | Esterase | 1.96 |
| PF01979 | Amidohydro_1 | 1.96 |
| PF13360 | PQQ_2 | 1.96 |
| PF05935 | Arylsulfotrans | 1.96 |
| PF00753 | Lactamase_B | 1.96 |
| PF13577 | SnoaL_4 | 1.96 |
| PF02627 | CMD | 1.31 |
| PF03544 | TonB_C | 1.31 |
| PF02687 | FtsX | 1.31 |
| PF00069 | Pkinase | 1.31 |
| PF02604 | PhdYeFM_antitox | 0.65 |
| PF06224 | HTH_42 | 0.65 |
| PF13847 | Methyltransf_31 | 0.65 |
| PF12732 | YtxH | 0.65 |
| PF00486 | Trans_reg_C | 0.65 |
| PF13620 | CarboxypepD_reg | 0.65 |
| PF08450 | SGL | 0.65 |
| PF12706 | Lactamase_B_2 | 0.65 |
| PF08031 | BBE | 0.65 |
| PF17158 | MASE4 | 0.65 |
| PF00691 | OmpA | 0.65 |
| PF13709 | DUF4159 | 0.65 |
| PF13683 | rve_3 | 0.65 |
| PF05448 | AXE1 | 0.65 |
| PF07470 | Glyco_hydro_88 | 0.65 |
| PF07883 | Cupin_2 | 0.65 |
| PF07730 | HisKA_3 | 0.65 |
| PF01432 | Peptidase_M3 | 0.65 |
| PF03315 | SDH_beta | 0.65 |
| PF13442 | Cytochrome_CBB3 | 0.65 |
| PF04734 | Ceramidase_alk | 0.65 |
| PF01170 | UPF0020 | 0.65 |
| PF08282 | Hydrolase_3 | 0.65 |
| PF07586 | HXXSHH | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.23 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.31 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.31 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.65 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.65 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.65 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.65 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.65 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.65 |
| COG1760 | L-serine deaminase | Amino acid transport and metabolism [E] | 0.65 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.65 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.65 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.65 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.65 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.65 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.65 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.65 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.65 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.65 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.65 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.65 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.65 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.35 % |
| Unclassified | root | N/A | 17.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886011|MRS1b_contig_724119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 921 | Open in IMG/M |
| 2199352025|deepsgr__Contig_149759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300000559|F14TC_100243836 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300000559|F14TC_101455648 | Not Available | 1229 | Open in IMG/M |
| 3300001661|JGI12053J15887_10163326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1160 | Open in IMG/M |
| 3300003152|Ga0052254_1143606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300004463|Ga0063356_105483072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300005331|Ga0070670_100988456 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005331|Ga0070670_101271995 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005331|Ga0070670_102067160 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005345|Ga0070692_10418616 | Not Available | 850 | Open in IMG/M |
| 3300005354|Ga0070675_101847965 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005355|Ga0070671_101311085 | Not Available | 639 | Open in IMG/M |
| 3300005364|Ga0070673_101943585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300005367|Ga0070667_102252377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 513 | Open in IMG/M |
| 3300005438|Ga0070701_10555466 | Not Available | 754 | Open in IMG/M |
| 3300005444|Ga0070694_101381175 | Not Available | 594 | Open in IMG/M |
| 3300005456|Ga0070678_101695788 | Not Available | 594 | Open in IMG/M |
| 3300005457|Ga0070662_100233914 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300005458|Ga0070681_11565365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300005459|Ga0068867_100113143 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300005543|Ga0070672_101512291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 601 | Open in IMG/M |
| 3300005545|Ga0070695_101708305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300005548|Ga0070665_100950761 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005615|Ga0070702_100580518 | Not Available | 837 | Open in IMG/M |
| 3300005617|Ga0068859_102069123 | Not Available | 629 | Open in IMG/M |
| 3300005719|Ga0068861_100775646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300005719|Ga0068861_101066767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005764|Ga0066903_100671677 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300005842|Ga0068858_100972851 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005844|Ga0068862_102720230 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005937|Ga0081455_10588805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300006163|Ga0070715_10438304 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006163|Ga0070715_10824754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 565 | Open in IMG/M |
| 3300006196|Ga0075422_10471962 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006237|Ga0097621_100276320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1477 | Open in IMG/M |
| 3300006358|Ga0068871_101301474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 684 | Open in IMG/M |
| 3300006358|Ga0068871_102164307 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006845|Ga0075421_102244746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300006852|Ga0075433_11483308 | Not Available | 586 | Open in IMG/M |
| 3300006876|Ga0079217_11725326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300006880|Ga0075429_100072592 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
| 3300006881|Ga0068865_102220705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300006894|Ga0079215_11536123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300006918|Ga0079216_10044876 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300009012|Ga0066710_103813773 | Not Available | 565 | Open in IMG/M |
| 3300009036|Ga0105244_10602523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300009098|Ga0105245_13246166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 504 | Open in IMG/M |
| 3300009100|Ga0075418_10560221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300009100|Ga0075418_11775589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300009137|Ga0066709_101224258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300009137|Ga0066709_101281233 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300009147|Ga0114129_11933683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 715 | Open in IMG/M |
| 3300009148|Ga0105243_11075127 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300009148|Ga0105243_11560194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 686 | Open in IMG/M |
| 3300009148|Ga0105243_12182715 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009156|Ga0111538_13194571 | Not Available | 571 | Open in IMG/M |
| 3300009174|Ga0105241_11601215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300009551|Ga0105238_11426234 | Not Available | 720 | Open in IMG/M |
| 3300009553|Ga0105249_10776804 | Not Available | 1021 | Open in IMG/M |
| 3300010337|Ga0134062_10694554 | Not Available | 534 | Open in IMG/M |
| 3300010366|Ga0126379_12130510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 662 | Open in IMG/M |
| 3300010366|Ga0126379_13177616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010400|Ga0134122_11006533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300010401|Ga0134121_10684074 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300010403|Ga0134123_12411599 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300011430|Ga0137423_1099080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300012212|Ga0150985_108502528 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012212|Ga0150985_112234841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300012212|Ga0150985_118524257 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012486|Ga0157331_1031172 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012903|Ga0157289_10003705 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300012907|Ga0157283_10355624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012955|Ga0164298_10627076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300012988|Ga0164306_10872315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300013297|Ga0157378_12753904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300014326|Ga0157380_10103143 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300014745|Ga0157377_10170693 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300015201|Ga0173478_10012378 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300015371|Ga0132258_10013539 | All Organisms → cellular organisms → Bacteria | 17286 | Open in IMG/M |
| 3300015372|Ga0132256_103313339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300015374|Ga0132255_100837359 | Not Available | 1373 | Open in IMG/M |
| 3300015374|Ga0132255_103598712 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300016270|Ga0182036_10323592 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300017792|Ga0163161_10403542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 1096 | Open in IMG/M |
| 3300018060|Ga0187765_10595973 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300018429|Ga0190272_11871370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio metschnikovii → Vibrio metschnikovii CIP 69.14 | 629 | Open in IMG/M |
| 3300018466|Ga0190268_10455313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300018466|Ga0190268_12413081 | Not Available | 500 | Open in IMG/M |
| 3300018469|Ga0190270_12311879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300018476|Ga0190274_13749175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 514 | Open in IMG/M |
| 3300018476|Ga0190274_13795090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300018481|Ga0190271_10165058 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
| 3300018481|Ga0190271_10422754 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300019228|Ga0180119_1269399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300019356|Ga0173481_10322625 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300019362|Ga0173479_10116263 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300021329|Ga0210362_1402962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300021384|Ga0213876_10355153 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300022724|Ga0242665_10233592 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300023168|Ga0247748_1037281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 716 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10334687 | Not Available | 578 | Open in IMG/M |
| 3300024317|Ga0247660_1081656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300025907|Ga0207645_10093943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1930 | Open in IMG/M |
| 3300025924|Ga0207694_10823004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300025930|Ga0207701_10150843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 2060 | Open in IMG/M |
| 3300025933|Ga0207706_10226848 | Not Available | 1635 | Open in IMG/M |
| 3300025937|Ga0207669_10636106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300025937|Ga0207669_11275128 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300025937|Ga0207669_11935471 | Not Available | 504 | Open in IMG/M |
| 3300025940|Ga0207691_10789172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 798 | Open in IMG/M |
| 3300025942|Ga0207689_11035200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300025945|Ga0207679_12155483 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025960|Ga0207651_11414174 | Not Available | 626 | Open in IMG/M |
| 3300025960|Ga0207651_11734019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300025961|Ga0207712_10741111 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300026075|Ga0207708_11130569 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300026095|Ga0207676_11196665 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300026118|Ga0207675_100821557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300026118|Ga0207675_102714098 | Not Available | 504 | Open in IMG/M |
| 3300026121|Ga0207683_11426381 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027682|Ga0209971_1008304 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300027691|Ga0209485_1217931 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300027886|Ga0209486_10761127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300028379|Ga0268266_10267528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1586 | Open in IMG/M |
| 3300028380|Ga0268265_10459384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300028380|Ga0268265_11303402 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300028380|Ga0268265_12294025 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300028878|Ga0307278_10271397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300031058|Ga0308189_10117886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300031226|Ga0307497_10066528 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300031226|Ga0307497_10174381 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031446|Ga0170820_17348237 | Not Available | 709 | Open in IMG/M |
| 3300031538|Ga0310888_10135722 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300031547|Ga0310887_11106104 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031768|Ga0318509_10581473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis | 624 | Open in IMG/M |
| 3300031847|Ga0310907_10493236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300031854|Ga0310904_11279874 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031858|Ga0310892_10695548 | Not Available | 697 | Open in IMG/M |
| 3300031908|Ga0310900_10086245 | All Organisms → cellular organisms → Bacteria | 1971 | Open in IMG/M |
| 3300031908|Ga0310900_10370672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300031908|Ga0310900_11909427 | Not Available | 507 | Open in IMG/M |
| 3300031911|Ga0307412_11607450 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031943|Ga0310885_10228154 | Not Available | 933 | Open in IMG/M |
| 3300031943|Ga0310885_10565452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300032004|Ga0307414_11297389 | Not Available | 675 | Open in IMG/M |
| 3300032122|Ga0310895_10397904 | Not Available | 674 | Open in IMG/M |
| 3300032157|Ga0315912_10288279 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300032157|Ga0315912_11423791 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032174|Ga0307470_11814269 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300033433|Ga0326726_11337512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300034148|Ga0364927_0174000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300034659|Ga0314780_071549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.31% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MRS1b_0177.00002800 | 2162886011 | Miscanthus Rhizosphere | TTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| deepsgr_02458390 | 2199352025 | Soil | VYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQFDF |
| F14TC_1002438361 | 3300000559 | Soil | TNVGLDVYNLFNRNTGTTYETVYDPATNGARWMQPTAVLLPRFMRLNVQVDF* |
| F14TC_1014556482 | 3300000559 | Soil | FNANPGTTFESVYDPATNGARWMQPTAVLNPRAARLNAQFDF* |
| JGI12053J15887_101633263 | 3300001661 | Forest Soil | NLFNSNTATTYETVYDPATNGAKWMTPTAVLLSRFMRFNVQFDF* |
| Ga0052254_11436061 | 3300003152 | Sediment | FNSNTPTTYESVYDPATNGARWLQPTAVLLPRFMRFNVQVDF* |
| Ga0063356_1054830721 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TNANTGTTFEASYDPATNGARWMRPTAVLQPRFVRFNVQFDF* |
| Ga0070670_1009884562 | 3300005331 | Switchgrass Rhizosphere | VGFDLYNLLNANTPTAYETVYDPATNGARWLQPTSVLNARAARFNVQFDF* |
| Ga0070670_1012719951 | 3300005331 | Switchgrass Rhizosphere | YNLFNSNTPTAYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0070670_1020671601 | 3300005331 | Switchgrass Rhizosphere | NSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF* |
| Ga0070692_104186162 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | NTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0070675_1018479651 | 3300005354 | Miscanthus Rhizosphere | LFNANTPTAYETVYDPATNGARWLQPTAVLNARAARFNVQFDF* |
| Ga0070671_1013110851 | 3300005355 | Switchgrass Rhizosphere | NLFNANPATTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF* |
| Ga0070673_1019435851 | 3300005364 | Switchgrass Rhizosphere | YNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF* |
| Ga0070667_1022523771 | 3300005367 | Switchgrass Rhizosphere | LYNLFNANSPTVYETVYDVATNGARWLQPTTVLTGRATRFNAQFEF* |
| Ga0070701_105554661 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NPPTTFETVFDVATVGARWLQPTAVLNPRAARLNVQFEF* |
| Ga0070694_1013811752 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0070678_1016957881 | 3300005456 | Miscanthus Rhizosphere | IYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0070662_1002339141 | 3300005457 | Corn Rhizosphere | RFFGKRTTVGMDGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF* |
| Ga0070681_115653652 | 3300005458 | Corn Rhizosphere | NSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF* |
| Ga0068867_1001131431 | 3300005459 | Miscanthus Rhizosphere | NLFNSNAGTAFETVYDPVTNGARWMQPTAVLNPRAARFNAQFEF* |
| Ga0070672_1015122911 | 3300005543 | Miscanthus Rhizosphere | TATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF* |
| Ga0070695_1017083052 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0070665_1009507611 | 3300005548 | Switchgrass Rhizosphere | TYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF* |
| Ga0070702_1005805181 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GKYRANVGLDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0068859_1020691231 | 3300005617 | Switchgrass Rhizosphere | NPATTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF* |
| Ga0068861_1007756463 | 3300005719 | Switchgrass Rhizosphere | YNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0068861_1010667671 | 3300005719 | Switchgrass Rhizosphere | YETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0066903_1006716774 | 3300005764 | Tropical Forest Soil | YETVYDPATNGARWMQPTAVLLPRFTRVNVQVDF* |
| Ga0068858_1009728511 | 3300005842 | Switchgrass Rhizosphere | TTYETVYDPDPTKNKWMNPTAVLLPRFMRFNVQVDF* |
| Ga0068862_1027202302 | 3300005844 | Switchgrass Rhizosphere | GYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF* |
| Ga0081455_105888051 | 3300005937 | Tabebuia Heterophylla Rhizosphere | YNLFNSNTATTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF* |
| Ga0070715_104383042 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DLYNLFNSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF* |
| Ga0070715_108247542 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LDLYNLFNANTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF* |
| Ga0075422_104719622 | 3300006196 | Populus Rhizosphere | PTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF* |
| Ga0097621_1002763201 | 3300006237 | Miscanthus Rhizosphere | NSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF* |
| Ga0068871_1013014742 | 3300006358 | Miscanthus Rhizosphere | AYETVFDPATAGARWLQPTAVLTARATRFNAQFEF* |
| Ga0068871_1021643072 | 3300006358 | Miscanthus Rhizosphere | PTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0075421_1022447461 | 3300006845 | Populus Rhizosphere | TTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0075433_114833082 | 3300006852 | Populus Rhizosphere | GRYKANVGMDVYNVLNSNTPTTYENVYDPDPTKNKWMNPTAVLLPRFMRFNVQVDF* |
| Ga0079217_117253262 | 3300006876 | Agricultural Soil | VDMRIAKVVRLGKYKANVGLDVYNLANSNTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0075429_1000725921 | 3300006880 | Populus Rhizosphere | DVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0068865_1022207052 | 3300006881 | Miscanthus Rhizosphere | TPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0079215_115361231 | 3300006894 | Agricultural Soil | TTVAMDGYNLFNANTPTAYETVYDVTTNGARWMSPTAVLNARAARFNVQFEF* |
| Ga0079216_100448762 | 3300006918 | Agricultural Soil | ANVGLDLYNMFNANTPTNYESVYDPATNGARWMQPTGVLSPRFLRVNMQLDF* |
| Ga0066710_1038137731 | 3300009012 | Grasslands Soil | TTYETVYDPATNGAKWMTPTAVLLSRFMRFNVQVDF |
| Ga0105244_106025232 | 3300009036 | Miscanthus Rhizosphere | AYETVFDFATVGARWMQPTTVLNPRALRFNAQFEF* |
| Ga0105245_132461662 | 3300009098 | Miscanthus Rhizosphere | YNLFNANTATTYETVFDVATSGARWMQPTAVLTPRATRFNVQFDF* |
| Ga0075418_105602213 | 3300009100 | Populus Rhizosphere | GRMKANVGMDVYNVLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFARFNVQVDF* |
| Ga0075418_117755892 | 3300009100 | Populus Rhizosphere | GRMKANVGMDVYNVLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0066709_1012242581 | 3300009137 | Grasslands Soil | NTATTYETVYEFVTNGAKWMQPTAVLLPRFIRLNVQFDF* |
| Ga0066709_1012812332 | 3300009137 | Grasslands Soil | YNLFNSNTATTYESVYDPGTNGARWLQPTAVLLPRFMRLNVQVDF* |
| Ga0114129_119336832 | 3300009147 | Populus Rhizosphere | FNANTPAEYEQVFDPATDGARWMQPTSVLLPRFARLNIQFDF* |
| Ga0105243_110751271 | 3300009148 | Miscanthus Rhizosphere | VDLYNLFNANPPTAYETVFDVATVGARWLQPTAVLNARAARFNVQFDF* |
| Ga0105243_115601941 | 3300009148 | Miscanthus Rhizosphere | TYETVYDVATNGARWLQPTAVLTGRATRFNAQFEF* |
| Ga0105243_121827151 | 3300009148 | Miscanthus Rhizosphere | MDLYNVLNANTPTAYETVYDPATNGAKWMQPTAVLLPRFARFNVQVDF* |
| Ga0111538_131945711 | 3300009156 | Populus Rhizosphere | YENVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0105241_116012152 | 3300009174 | Corn Rhizosphere | MDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0105238_114262341 | 3300009551 | Corn Rhizosphere | FEATYDPASAGARWLLPTAVVQPRFMRFNVQVDF* |
| Ga0105249_107768041 | 3300009553 | Switchgrass Rhizosphere | DIYHLMNANTATTYETVYDPATNGARWMKTTAVLLPRFMRFNVQVDF* |
| Ga0134062_106945542 | 3300010337 | Grasslands Soil | FNANTPTTYETVYDPEKNGAKWMTPTAVLLSRFMRFNVQVDF* |
| Ga0126379_121305101 | 3300010366 | Tropical Forest Soil | TAFETVYDPATNGSRWMNPTAVLNPRAARFNAQFDF* |
| Ga0126379_131776161 | 3300010366 | Tropical Forest Soil | LFNSNTATTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF* |
| Ga0134122_110065332 | 3300010400 | Terrestrial Soil | DVYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF* |
| Ga0134121_106840741 | 3300010401 | Terrestrial Soil | NSNTPTTYESVYDPATNGARWMQPTAVLLPRFIRFNVQVDF* |
| Ga0134123_124115992 | 3300010403 | Terrestrial Soil | LFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0137423_10990802 | 3300011430 | Soil | PTTYETVYDPATNGARWMQPTAVLPPRFMRVNVQFDF* |
| Ga0150985_1085025282 | 3300012212 | Avena Fatua Rhizosphere | DLYNLFNANNATTYETVFDPATVGAKWMQPTAVLTARATRFNAQFDF* |
| Ga0150985_1122348411 | 3300012212 | Avena Fatua Rhizosphere | TYETVYDPATNGARWLQPTAVLLPRFMRFNVQFDF* |
| Ga0150985_1185242572 | 3300012212 | Avena Fatua Rhizosphere | TPTAYETVYDPATNGARWLQPTAVLNARAARFNVQFDF* |
| Ga0157331_10311722 | 3300012486 | Soil | LTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF* |
| Ga0157289_100037054 | 3300012903 | Soil | YNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQFDF* |
| Ga0157283_103556242 | 3300012907 | Soil | TYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0164298_106270761 | 3300012955 | Soil | TPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQVDF* |
| Ga0164306_108723151 | 3300012988 | Soil | PTTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF* |
| Ga0157378_127539041 | 3300013297 | Miscanthus Rhizosphere | NVGLDVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVPFDF* |
| Ga0157380_101031431 | 3300014326 | Switchgrass Rhizosphere | LMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0157377_101706933 | 3300014745 | Miscanthus Rhizosphere | FNANTPTTYETVYDPATNGAKWMQPTAVLLPRFMRFNVQVDF* |
| Ga0173478_100123781 | 3300015201 | Soil | TPTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF* |
| Ga0132258_100135391 | 3300015371 | Arabidopsis Rhizosphere | TAYETVFDPATAGARWLQPTAVLNPRATRFNVQLDF* |
| Ga0132256_1033133392 | 3300015372 | Arabidopsis Rhizosphere | LFNSNTPTTYETVYDPATNGAKWLTPTAVLLPRFMRFNVQFDF* |
| Ga0132255_1008373591 | 3300015374 | Arabidopsis Rhizosphere | GLDIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF* |
| Ga0132255_1035987121 | 3300015374 | Arabidopsis Rhizosphere | NLFNANPATAYETVFDPATAGARWLQPTAVLNPRATRFNVQLDF* |
| Ga0182036_103235922 | 3300016270 | Soil | LDLYNLFSSNTATAYETVFDVATVGARWMQPSAVLTGRALRFNVQFDF |
| Ga0163161_104035421 | 3300017792 | Switchgrass Rhizosphere | LFNSNTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0187765_105959731 | 3300018060 | Tropical Peatland | NLFNANTATTYETVYDPATNGARWMQPTAVLLPRFTRLNVQVDF |
| Ga0190272_118713702 | 3300018429 | Soil | SKRATAGLDLYNMFNANTPTGYESVYDPATNGARWMQPTGVLSPRFVRVNMQLDF |
| Ga0190268_104553132 | 3300018466 | Soil | LNVNTPTTYETVYDPATNGARWMQPTAVLLPRFVRVNVQFDF |
| Ga0190268_124130812 | 3300018466 | Soil | FGKYRTNVGLDVYNLLNSNTPTAYENVYDPNPAVQKWLQPTTVLLPRFMRFNVQVDF |
| Ga0190270_123118791 | 3300018469 | Soil | GTTFEAAYDPATQGGRWLRPTAVLQPRFVRFNVQFDF |
| Ga0190274_137491752 | 3300018476 | Soil | YNLFNANPPTAYETVFDVATVGARWLQPTAVLSPRATRFNVQFEF |
| Ga0190274_137950901 | 3300018476 | Soil | NANAPTTFETVYDPATNGARWMQPTAVLNPRAARFNVQLDF |
| Ga0190271_101650583 | 3300018481 | Soil | DLYNLLNANTPTTYEAVFDPASNGARWMQPTAVLTPRAARFNVQFEF |
| Ga0190271_104227543 | 3300018481 | Soil | NTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0180119_12693991 | 3300019228 | Groundwater Sediment | TPTTYETVYDPATNGARWMQPTAVLLPRFMRINVQLDF |
| Ga0173481_103226251 | 3300019356 | Soil | TYETVYDPATNGAKWMQPTAVLLPRFMRFNIQVDF |
| Ga0173479_101162632 | 3300019362 | Soil | SNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNIQVDF |
| Ga0210362_14029621 | 3300021329 | Estuarine | LDVYNLFNRNTPTTYETVYDPATNGARWLQPTAVLLPRFMRVNVQLDF |
| Ga0213876_103551532 | 3300021384 | Plant Roots | SNAPSLFETVYDVATNGARWLQPSAVISPRALRLNVDLTF |
| Ga0242665_102335921 | 3300022724 | Soil | SNVPTTYETVYDPATNGAKWLTPTAVLQSRFMRFNVQVDF |
| Ga0247748_10372811 | 3300023168 | Soil | TAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF |
| (restricted) Ga0233424_103346871 | 3300023208 | Freshwater | YNLFNVNTPTTYETVYDPATNGARWLQPTAVLLPRFMRFNIQLDF |
| Ga0247660_10816561 | 3300024317 | Soil | NSNTPTTYETVYDPATNGAKWLTPTAVLLPRFMRFNVQFDF |
| Ga0207645_100939433 | 3300025907 | Miscanthus Rhizosphere | NLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0207694_108230042 | 3300025924 | Corn Rhizosphere | GKTKTNVGLDVYNLFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRFNVQVDF |
| Ga0207701_101508433 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF |
| Ga0207706_102268482 | 3300025933 | Corn Rhizosphere | AYETVFDVATAGARWLQPTAVLQPRASRFNVQFDF |
| Ga0207669_106361061 | 3300025937 | Miscanthus Rhizosphere | FNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0207669_112751281 | 3300025937 | Miscanthus Rhizosphere | YNLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQFDF |
| Ga0207669_119354711 | 3300025937 | Miscanthus Rhizosphere | LMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0207691_107891721 | 3300025940 | Miscanthus Rhizosphere | NTATTYETVFDPATVGARWMQPTAVLTARATRFNAQFDF |
| Ga0207689_110352001 | 3300025942 | Miscanthus Rhizosphere | LFNSNTATTYETVYDPATNGAKWLQPTAVLLPRFMRFNVQFDF |
| Ga0207679_121554832 | 3300025945 | Corn Rhizosphere | VRFGKYRTNVGMDIYNLMNANTATTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0207651_114141742 | 3300025960 | Switchgrass Rhizosphere | LNSNTPTAYENVYDPNPAVQKWLQPTSVLLPRFMRFNVQVDF |
| Ga0207651_117340192 | 3300025960 | Switchgrass Rhizosphere | DVYNLFNSNTATTYENVYDPATNGARWMQPTAVLLPRFMRFNIQVDF |
| Ga0207712_107411112 | 3300025961 | Switchgrass Rhizosphere | NSNAGTAFETVYDPATNGARWMQPTAVLNPRAARFNAQFEF |
| Ga0207708_111305692 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | NPATAYETVFDVATVGARWLQPTAVLNPRAARFNVQFDF |
| Ga0207676_111966651 | 3300026095 | Switchgrass Rhizosphere | RFGRYRTNVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF |
| Ga0207675_1008215572 | 3300026118 | Switchgrass Rhizosphere | PTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0207675_1027140982 | 3300026118 | Switchgrass Rhizosphere | KYRANVGLDVYNLMNSNTPTAYENVYDPNPAVQKWMQPTTVLLPRFMRFNVQVDF |
| Ga0207683_114263812 | 3300026121 | Miscanthus Rhizosphere | TFEATYDPASNGERWMRPTAVVQPRFLRFNVQFDF |
| Ga0209971_10083045 | 3300027682 | Arabidopsis Thaliana Rhizosphere | AYETVYDPATNGARWLQPTAVLLPRFMRFNVQVDF |
| Ga0209485_12179312 | 3300027691 | Agricultural Soil | VGLDLYNMFNANTPTNYESVYDPATNGARWMQPTSVLSPRFLRVNMQLDF |
| Ga0209486_107611271 | 3300027886 | Agricultural Soil | MFNANTPTGYESVYDPATNGERWMQPTGVLAPRFVRVNMQLDF |
| Ga0268266_102675281 | 3300028379 | Switchgrass Rhizosphere | TTYESVYDPASNGARWMQPTAVLNPRAQRLNAQFDF |
| Ga0268265_104593842 | 3300028380 | Switchgrass Rhizosphere | LYNLFNANTPTAYETVFDVATNGARWLQPTAVLAPRATRFNAQFDF |
| Ga0268265_113034021 | 3300028380 | Switchgrass Rhizosphere | ANSNTATTYETVYDPATNGARWMQPTAVLLPRFMRLNVQVDF |
| Ga0268265_122940252 | 3300028380 | Switchgrass Rhizosphere | FFGKRTTVGMDGYNLFNANTPTTYESVYDVVTNGAKWMTPTAVLNARAARFNVQFDF |
| Ga0307278_102713972 | 3300028878 | Soil | TPTTFESTYDPASRGERWMQPTALLQPRFVRFNVQFDF |
| Ga0308189_101178862 | 3300031058 | Soil | SNTPTNYESVYDPATSGARWMQPTSVLLPRFARVNVQLDF |
| Ga0307497_100665281 | 3300031226 | Soil | NPPTAYETVFDVATVGARWLQPTAVLNPRAARFNVQFDF |
| Ga0307497_101743812 | 3300031226 | Soil | VAAATLFETVYDPATNGARWMNPTAILNPRAARFNVQFDF |
| Ga0170820_173482372 | 3300031446 | Forest Soil | GLDIYNLFNVNTPTTYESVYDPATNGAKWLTPTAVLASRFMRFNVQVDF |
| Ga0310888_101357221 | 3300031538 | Soil | VLRFGRYRANVGMDVYNLLNANTPTTYETVYDPATNGARWMQPTAVLLARFMRFNVQVDF |
| Ga0310887_111061041 | 3300031547 | Soil | NLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF |
| Ga0318509_105814731 | 3300031768 | Soil | YNLFNSNTPTTYESVYDPATNGAKWLTPTAVLLPRFMRFNVQVDF |
| Ga0310907_104932361 | 3300031847 | Soil | NLFNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0310904_112798741 | 3300031854 | Soil | NVGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0310892_106955482 | 3300031858 | Soil | TPTAYENVYDPNPAVQKWMQPTAVLLPRFMRFNVQVDFQLSR |
| Ga0310900_100862454 | 3300031908 | Soil | NLLNANAPTTFETVYDPATNGARWMQPTAVLNTRAARFNVQLDF |
| Ga0310900_103706722 | 3300031908 | Soil | VGVDVYNLTNSNTPTTYETVYDPATNGARWMQPTAVLLPRFVRFNIQVDF |
| Ga0310900_119094272 | 3300031908 | Soil | RTNVGLDVYNLLNSNTPTAYENVYDPNPAVQKWLQPTSVLLPRFMRFNVQVDF |
| Ga0307412_116074501 | 3300031911 | Rhizosphere | NLLSANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0310885_102281542 | 3300031943 | Soil | GRYRTNVGMDVYNLLNVNTPTTYETVYDPDPTRQKWMQPTAVLLPRFMRFNVQVDF |
| Ga0310885_105654521 | 3300031943 | Soil | FGRSKVNVGLDIYNLLNSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQLDF |
| Ga0307414_112973891 | 3300032004 | Rhizosphere | NTPTNYETVFDPATSGARWMRPTGVLAPRFARVNMQLDF |
| Ga0310895_103979042 | 3300032122 | Soil | LRFGKYRTNIGMDVYNLANSNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0315912_102882793 | 3300032157 | Soil | TYENVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0315912_114237912 | 3300032157 | Soil | SNTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| Ga0307470_118142691 | 3300032174 | Hardwood Forest Soil | KTRTNVGLDMYNMFNSNTPTTYETVYDPATNGAKWMTPTAVLLPRFMRINVQVDF |
| Ga0326726_113375122 | 3300033433 | Peat Soil | NLFNSNTATVYNEVFDVATAGAKWMQPTAVLTARATRFNAQFDF |
| Ga0364927_0174000_1_120 | 3300034148 | Sediment | NTPTTYEAVFDPATNGARWMQPTAVLTPRAARFNVQFEF |
| Ga0314780_071549_583_729 | 3300034659 | Soil | MDIYNLFNANTPTTYETVYDPATNGARWMQPTAVLLPRFMRFNVQVDF |
| ⦗Top⦘ |