


| Basic Information | |
|---|---|
| Family ID | F045334 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPL |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.82 % |
| % of genes near scaffold ends (potentially truncated) | 99.35 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.170 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.876 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.634 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF04343 | DUF488 | 5.23 |
| PF03401 | TctC | 2.61 |
| PF02798 | GST_N | 2.61 |
| PF04392 | ABC_sub_bind | 1.96 |
| PF01520 | Amidase_3 | 1.96 |
| PF01227 | GTP_cyclohydroI | 1.96 |
| PF00528 | BPD_transp_1 | 1.96 |
| PF00501 | AMP-binding | 1.31 |
| PF03734 | YkuD | 1.31 |
| PF06577 | EipA | 1.31 |
| PF05099 | TerB | 1.31 |
| PF00326 | Peptidase_S9 | 1.31 |
| PF01464 | SLT | 1.31 |
| PF14435 | SUKH-4 | 0.65 |
| PF02627 | CMD | 0.65 |
| PF00196 | GerE | 0.65 |
| PF12975 | DUF3859 | 0.65 |
| PF08666 | SAF | 0.65 |
| PF13792 | Obsolete Pfam Family | 0.65 |
| PF01042 | Ribonuc_L-PSP | 0.65 |
| PF14196 | ATC_hydrolase | 0.65 |
| PF01575 | MaoC_dehydratas | 0.65 |
| PF13545 | HTH_Crp_2 | 0.65 |
| PF09084 | NMT1 | 0.65 |
| PF02771 | Acyl-CoA_dh_N | 0.65 |
| PF10768 | FliX | 0.65 |
| PF13701 | DDE_Tnp_1_4 | 0.65 |
| PF01435 | Peptidase_M48 | 0.65 |
| PF02954 | HTH_8 | 0.65 |
| PF01717 | Meth_synt_2 | 0.65 |
| PF08327 | AHSA1 | 0.65 |
| PF00211 | Guanylate_cyc | 0.65 |
| PF00378 | ECH_1 | 0.65 |
| PF03992 | ABM | 0.65 |
| PF00144 | Beta-lactamase | 0.65 |
| PF14023 | DUF4239 | 0.65 |
| PF04828 | GFA | 0.65 |
| PF00484 | Pro_CA | 0.65 |
| PF01625 | PMSR | 0.65 |
| PF08241 | Methyltransf_11 | 0.65 |
| PF01548 | DEDD_Tnp_IS110 | 0.65 |
| PF08240 | ADH_N | 0.65 |
| PF07690 | MFS_1 | 0.65 |
| PF10397 | ADSL_C | 0.65 |
| PF08734 | GYD | 0.65 |
| PF00884 | Sulfatase | 0.65 |
| PF01841 | Transglut_core | 0.65 |
| PF12799 | LRR_4 | 0.65 |
| PF12244 | DUF3606 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 5.23 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.61 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.96 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 1.31 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.65 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.65 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.65 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.65 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.65 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.65 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.65 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.65 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.65 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.17 % |
| Unclassified | root | N/A | 41.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1001742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 3476 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10268623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300004152|Ga0062386_100638140 | Not Available | 872 | Open in IMG/M |
| 3300004633|Ga0066395_10122573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1285 | Open in IMG/M |
| 3300005332|Ga0066388_100374206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2071 | Open in IMG/M |
| 3300005332|Ga0066388_105325092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 652 | Open in IMG/M |
| 3300005332|Ga0066388_105906991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300005339|Ga0070660_100408041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
| 3300005347|Ga0070668_101960217 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| 3300005549|Ga0070704_100484495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae | 1071 | Open in IMG/M |
| 3300005577|Ga0068857_101030393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300005713|Ga0066905_100460025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1048 | Open in IMG/M |
| 3300005713|Ga0066905_101849760 | Not Available | 558 | Open in IMG/M |
| 3300005764|Ga0066903_100776125 | Not Available | 1708 | Open in IMG/M |
| 3300005764|Ga0066903_101186060 | Not Available | 1416 | Open in IMG/M |
| 3300005764|Ga0066903_102442377 | Not Available | 1011 | Open in IMG/M |
| 3300005764|Ga0066903_102722072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 959 | Open in IMG/M |
| 3300005764|Ga0066903_104161724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 774 | Open in IMG/M |
| 3300005764|Ga0066903_104933429 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia | 708 | Open in IMG/M |
| 3300006032|Ga0066696_11027439 | Not Available | 524 | Open in IMG/M |
| 3300006038|Ga0075365_10075730 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300006050|Ga0075028_101011182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300006059|Ga0075017_100169091 | Not Available | 1566 | Open in IMG/M |
| 3300006102|Ga0075015_100403147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300006172|Ga0075018_10441495 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006354|Ga0075021_10169630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1325 | Open in IMG/M |
| 3300006806|Ga0079220_11473556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 65-9 | 582 | Open in IMG/M |
| 3300006845|Ga0075421_101351525 | Not Available | 786 | Open in IMG/M |
| 3300006852|Ga0075433_10636365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 935 | Open in IMG/M |
| 3300006852|Ga0075433_11931194 | Not Available | 506 | Open in IMG/M |
| 3300006854|Ga0075425_100070418 | All Organisms → cellular organisms → Bacteria | 3938 | Open in IMG/M |
| 3300006880|Ga0075429_100625004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300009094|Ga0111539_13052666 | Not Available | 541 | Open in IMG/M |
| 3300009100|Ga0075418_11917675 | Not Available | 645 | Open in IMG/M |
| 3300009143|Ga0099792_11090956 | Not Available | 537 | Open in IMG/M |
| 3300009147|Ga0114129_10575423 | Not Available | 1462 | Open in IMG/M |
| 3300009147|Ga0114129_11350885 | Not Available | 881 | Open in IMG/M |
| 3300009522|Ga0116218_1177775 | Not Available | 964 | Open in IMG/M |
| 3300009545|Ga0105237_11753513 | Not Available | 628 | Open in IMG/M |
| 3300010043|Ga0126380_10014872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3597 | Open in IMG/M |
| 3300010047|Ga0126382_10013089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4064 | Open in IMG/M |
| 3300010047|Ga0126382_11509113 | Not Available | 618 | Open in IMG/M |
| 3300010048|Ga0126373_12188755 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010154|Ga0127503_10199046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300010359|Ga0126376_10078602 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300010359|Ga0126376_10504742 | Not Available | 1120 | Open in IMG/M |
| 3300010359|Ga0126376_12800395 | Not Available | 537 | Open in IMG/M |
| 3300010360|Ga0126372_10745952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 962 | Open in IMG/M |
| 3300010361|Ga0126378_10133424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2506 | Open in IMG/M |
| 3300010361|Ga0126378_10147688 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300010361|Ga0126378_10744319 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300010361|Ga0126378_13045278 | Not Available | 534 | Open in IMG/M |
| 3300010362|Ga0126377_10170662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → unclassified Tardiphaga → Tardiphaga sp. vice352 | 2061 | Open in IMG/M |
| 3300010373|Ga0134128_11478616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300010376|Ga0126381_100725217 | Not Available | 1423 | Open in IMG/M |
| 3300010376|Ga0126381_101095188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pseudoxanthobacteraceae → Pseudoxanthobacter | 1151 | Open in IMG/M |
| 3300010398|Ga0126383_12937265 | Not Available | 557 | Open in IMG/M |
| 3300010398|Ga0126383_13671361 | Not Available | 501 | Open in IMG/M |
| 3300011119|Ga0105246_10660746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
| 3300012677|Ga0153928_1090469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300012929|Ga0137404_12105898 | Not Available | 527 | Open in IMG/M |
| 3300012948|Ga0126375_12081747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300012971|Ga0126369_10896971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300012984|Ga0164309_11151219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300012988|Ga0164306_11687739 | Not Available | 549 | Open in IMG/M |
| 3300012989|Ga0164305_10333018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
| 3300014317|Ga0075343_1127085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300014968|Ga0157379_10692379 | Not Available | 956 | Open in IMG/M |
| 3300014969|Ga0157376_11816838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300015371|Ga0132258_12622691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1259 | Open in IMG/M |
| 3300015372|Ga0132256_102895325 | Not Available | 577 | Open in IMG/M |
| 3300016270|Ga0182036_11263283 | Not Available | 615 | Open in IMG/M |
| 3300016357|Ga0182032_11127259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300016371|Ga0182034_11093750 | Not Available | 691 | Open in IMG/M |
| 3300016387|Ga0182040_10825957 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300016404|Ga0182037_12091571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300016422|Ga0182039_11781712 | Not Available | 564 | Open in IMG/M |
| 3300016445|Ga0182038_10694429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 885 | Open in IMG/M |
| 3300017972|Ga0187781_10923834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300017974|Ga0187777_10135022 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300017974|Ga0187777_10184777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1401 | Open in IMG/M |
| 3300018085|Ga0187772_10868554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300020579|Ga0210407_10920743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300021168|Ga0210406_10395893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1107 | Open in IMG/M |
| 3300021168|Ga0210406_10416994 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300021171|Ga0210405_10496038 | Not Available | 957 | Open in IMG/M |
| 3300021404|Ga0210389_10951791 | Not Available | 667 | Open in IMG/M |
| 3300021420|Ga0210394_11202384 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300021478|Ga0210402_10608932 | Not Available | 1012 | Open in IMG/M |
| 3300021560|Ga0126371_10309795 | Not Available | 1708 | Open in IMG/M |
| 3300021560|Ga0126371_10635885 | Not Available | 1216 | Open in IMG/M |
| 3300022756|Ga0222622_10885326 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300025899|Ga0207642_10324096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium liaoningense | 901 | Open in IMG/M |
| 3300025915|Ga0207693_10110770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2152 | Open in IMG/M |
| 3300025918|Ga0207662_10849329 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300025935|Ga0207709_10884186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300025941|Ga0207711_11284266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 674 | Open in IMG/M |
| 3300026088|Ga0207641_11707898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300026475|Ga0257147_1020082 | Not Available | 931 | Open in IMG/M |
| 3300027003|Ga0207722_1012776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter similis | 964 | Open in IMG/M |
| 3300027568|Ga0208042_1063035 | Not Available | 944 | Open in IMG/M |
| 3300027604|Ga0208324_1099525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300027725|Ga0209178_1160014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
| 3300027738|Ga0208989_10012841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2866 | Open in IMG/M |
| 3300027880|Ga0209481_10357958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 745 | Open in IMG/M |
| 3300028047|Ga0209526_10423101 | Not Available | 880 | Open in IMG/M |
| 3300028814|Ga0307302_10040486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2159 | Open in IMG/M |
| 3300030580|Ga0311355_11063156 | Not Available | 723 | Open in IMG/M |
| 3300030916|Ga0075386_11630539 | Not Available | 533 | Open in IMG/M |
| 3300031096|Ga0308193_1026859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
| 3300031446|Ga0170820_14486452 | Not Available | 1096 | Open in IMG/M |
| 3300031446|Ga0170820_16586615 | Not Available | 1400 | Open in IMG/M |
| 3300031474|Ga0170818_113490885 | Not Available | 959 | Open in IMG/M |
| 3300031543|Ga0318516_10807772 | Not Available | 530 | Open in IMG/M |
| 3300031572|Ga0318515_10108922 | Not Available | 1458 | Open in IMG/M |
| 3300031573|Ga0310915_10374023 | Not Available | 1011 | Open in IMG/M |
| 3300031719|Ga0306917_10030899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3438 | Open in IMG/M |
| 3300031719|Ga0306917_11067052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 630 | Open in IMG/M |
| 3300031720|Ga0307469_11750256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300031744|Ga0306918_10316673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1205 | Open in IMG/M |
| 3300031747|Ga0318502_11021683 | Not Available | 504 | Open in IMG/M |
| 3300031748|Ga0318492_10442636 | Not Available | 686 | Open in IMG/M |
| 3300031751|Ga0318494_10360545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 841 | Open in IMG/M |
| 3300031764|Ga0318535_10461069 | Not Available | 566 | Open in IMG/M |
| 3300031768|Ga0318509_10259355 | Not Available | 971 | Open in IMG/M |
| 3300031779|Ga0318566_10657177 | Not Available | 509 | Open in IMG/M |
| 3300031782|Ga0318552_10231401 | Not Available | 937 | Open in IMG/M |
| 3300031782|Ga0318552_10258137 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031797|Ga0318550_10284204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 803 | Open in IMG/M |
| 3300031819|Ga0318568_10527696 | Not Available | 736 | Open in IMG/M |
| 3300031833|Ga0310917_11112897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 527 | Open in IMG/M |
| 3300031847|Ga0310907_10471761 | Not Available | 667 | Open in IMG/M |
| 3300031879|Ga0306919_11219165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300031896|Ga0318551_10089120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1627 | Open in IMG/M |
| 3300031910|Ga0306923_11260871 | Not Available | 786 | Open in IMG/M |
| 3300031941|Ga0310912_10051104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 2905 | Open in IMG/M |
| 3300031946|Ga0310910_10828033 | Not Available | 728 | Open in IMG/M |
| 3300031981|Ga0318531_10398445 | Not Available | 623 | Open in IMG/M |
| 3300032000|Ga0310903_10318714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300032010|Ga0318569_10569255 | Not Available | 528 | Open in IMG/M |
| 3300032025|Ga0318507_10439058 | Not Available | 568 | Open in IMG/M |
| 3300032043|Ga0318556_10131704 | Not Available | 1283 | Open in IMG/M |
| 3300032059|Ga0318533_10335744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1099 | Open in IMG/M |
| 3300032060|Ga0318505_10003895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4728 | Open in IMG/M |
| 3300032076|Ga0306924_12416340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300032261|Ga0306920_100872109 | Not Available | 1317 | Open in IMG/M |
| 3300032261|Ga0306920_103423934 | Not Available | 588 | Open in IMG/M |
| 3300033004|Ga0335084_10800747 | Not Available | 957 | Open in IMG/M |
| 3300033289|Ga0310914_10488193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300033289|Ga0310914_10970564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300033290|Ga0318519_10797396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300033433|Ga0326726_10468221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1202 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10017421 | 3300000580 | Forest Soil | MHAAARLLAALILAAAGSAVAQEKHLIDPTPPGSLNP |
| JGIcombinedJ51221_102686231 | 3300003505 | Forest Soil | MRAAARLVAVFLFALAGSAAAQEKHLIDPTPPGSLNPEPL |
| Ga0062386_1006381403 | 3300004152 | Bog Forest Soil | MRATVRLLAILILAAAGSAVAQEKHLIDPTPPGSLNPEPLPP |
| Ga0066395_101225732 | 3300004633 | Tropical Forest Soil | MRAVVCLLAALFLAAASSAVAQEKHLIDPMLPGSLDPKPLPPLKNPDAPS |
| Ga0066388_1003742063 | 3300005332 | Tropical Forest Soil | MRHRLIRWLLMRAAGRLLAVLLFAAAGSAVAQQKHLIDSTPPGSLNPEPL |
| Ga0066388_1053250921 | 3300005332 | Tropical Forest Soil | MRAAACLLAVLVFAAAGTAAAQEKPAIDRMRPGSLNPEPLP |
| Ga0066388_1059069911 | 3300005332 | Tropical Forest Soil | MRAVVCLLAVFFPAAASSAVAQEKHLIDPMLPGSLNPRPLPPLKNPDALST |
| Ga0070660_1004080413 | 3300005339 | Corn Rhizosphere | MRAAARLLAVLILAAAGSALAQEKHLIDPTPPGSLNRKPLPPLQNPDA |
| Ga0070668_1019602172 | 3300005347 | Switchgrass Rhizosphere | MVRMAARVLAIFMVAAAGPALAQKKHLIDPTPPGSLNPEPLPPLRNP |
| Ga0070704_1004844951 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAVVCLLAVLFSAATSSAVAQEKHLIDPMLPGSLNPRPLP |
| Ga0068857_1010303933 | 3300005577 | Corn Rhizosphere | MRFVLCLLAVLFLAAAGSAVAQEKHLIDPMLPGSLNPKPLPPL |
| Ga0066905_1004600251 | 3300005713 | Tropical Forest Soil | MRAVVCLLAVLFAAAASSAVAQEKHLIDPMLPGSLNPRPLPPLKNPDALST |
| Ga0066905_1018497602 | 3300005713 | Tropical Forest Soil | MRAVTCLLAALFLAAADSAAAQETHLIDPMLPGSLNPKPLPPLKN |
| Ga0066903_1007761254 | 3300005764 | Tropical Forest Soil | MRAVICLLAVLFLAAASSAVAQEKHLIDPMLPGSLN |
| Ga0066903_1011860601 | 3300005764 | Tropical Forest Soil | MRAVICLLAVVFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDAPS |
| Ga0066903_1024423773 | 3300005764 | Tropical Forest Soil | MRAAARLLAVLMLVAAGSAVAQEKHLIDRTRPGSLNP |
| Ga0066903_1027220721 | 3300005764 | Tropical Forest Soil | MRAVLCLLAVLFHAAANSAVAQEKHSIDPMLPGTLDPKPL |
| Ga0066903_1041617241 | 3300005764 | Tropical Forest Soil | MRPVLRLLAVLFLVAAGSAIAQEKHLIDPMLPGSLNPKP |
| Ga0066903_1049334292 | 3300005764 | Tropical Forest Soil | MRAALCLLAVLFLAAANSAVAQEKHLIDPMLPGSLNP |
| Ga0066696_110274391 | 3300006032 | Soil | MAAVVCLLAVLFLAAASSAVAQDKHLIDPMLPGSLDPKPLPPLKNPDAPS |
| Ga0075365_100757305 | 3300006038 | Populus Endosphere | MRAVVCLLAVLFPAAASSAVAQEKHLIDPMLPGSLNPRPLPPLKN |
| Ga0075028_1010111821 | 3300006050 | Watersheds | MRAAAHLLAVLLLAAVGSAFAREKHLIDPTPPGSLNPE |
| Ga0075017_1001690911 | 3300006059 | Watersheds | MRAAPRMLAILMLGAAVSATAQEKHLIDPTPPGSLN |
| Ga0075015_1004031471 | 3300006102 | Watersheds | MRGAACLLLLFLAAAGSAVAQEKNLIDPMLPGSLNPKP |
| Ga0075018_104414952 | 3300006172 | Watersheds | MRAVACLLTVLFLAGAGSAVAEEKHLIDPMLPGSLNPKPLPPLK |
| Ga0075021_101696303 | 3300006354 | Watersheds | MRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPL |
| Ga0079220_114735561 | 3300006806 | Agricultural Soil | MRAVICLVAVLVLAAVSSAVAQETHLIDPMLPGSLNPKPLPPLKN |
| Ga0075421_1013515252 | 3300006845 | Populus Rhizosphere | MRAVACLLALLFLAAAGSAVAQEKHLIDPMHPGSLNPEPLPPLQNPEAPS |
| Ga0075433_106363652 | 3300006852 | Populus Rhizosphere | MRAVVCLLAVLFSAATSSAVAQEKHLLDPMLPGSLDPKPLPPLKNPDAPS |
| Ga0075433_119311942 | 3300006852 | Populus Rhizosphere | MRQGIHKKLLLMRAAACLLAVLILAAADSAVAQEKHLIDPMHPGSLNPE |
| Ga0075425_10007041810 | 3300006854 | Populus Rhizosphere | MRQGIHKKLLLMRAAACLLAVLILAAADSAVAQEKHLIDPMHPGSLNPEPLPPLQNPEAPST |
| Ga0075429_1006250043 | 3300006880 | Populus Rhizosphere | MRAVVWLLALLFLAAAGTIAAQEKPAIDRIRPGSLNPEPLPPLQNPNAPSTP |
| Ga0111539_130526662 | 3300009094 | Populus Rhizosphere | MRAVVCLLAILFPAAASSAVAQEKHLIDPMLPGSLNPRPLPPLKNPDALS |
| Ga0075418_119176752 | 3300009100 | Populus Rhizosphere | MRAVACLLAVLFLAAAGSAVAQEKHLIDPMLPGSLNPEPLPPLQNPEAPSTPA |
| Ga0099792_110909561 | 3300009143 | Vadose Zone Soil | MRAVVCLLTVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDA |
| Ga0114129_105754231 | 3300009147 | Populus Rhizosphere | MRAVACLLALLFLAAAGSAVAQEKHLIDPMHPGSLNPEPLPPLQNPEAPST |
| Ga0114129_113508853 | 3300009147 | Populus Rhizosphere | MRAVACLLAVLFLAAAGSAVAQEKHLIDPMHPGSLNPEPLPPLQNPEAPST |
| Ga0116218_11777751 | 3300009522 | Peatlands Soil | MRAAARLLAVLMLAAASSAIAQEKHLIDPTPPGSLNPEP |
| Ga0105237_117535131 | 3300009545 | Corn Rhizosphere | MRAAARLLAVLILAAAGSALAQEKHLIDPTPPGSLNRKPLPPLQNP |
| Ga0126380_100148726 | 3300010043 | Tropical Forest Soil | MRAVACLLAALSLTAAGSALAQEKHLIDPMLPGSLNPKPLPQLEN |
| Ga0126382_100130898 | 3300010047 | Tropical Forest Soil | MRAVACLLAALSLTAAGSALAQEKHLIDPMLPGSLNPKPLPQLENPD |
| Ga0126382_115091132 | 3300010047 | Tropical Forest Soil | MRAVVCVLAVLFLAAASSAVAQERHLIDRMLPGSLNPRPLPPLKNPD |
| Ga0126373_121887551 | 3300010048 | Tropical Forest Soil | MRIAARLLAVLILAGTGSDVAQEKHLMDTTPPGLLD |
| Ga0127503_101990461 | 3300010154 | Soil | MRAAAHLLAVLLLAAAGSAFAREKHLIDPTPPGSLNPEPLPLLQNP |
| Ga0126376_100786024 | 3300010359 | Tropical Forest Soil | MRAVICLLAVLFLAAASSAVAQEKHLIDPMLPGSLNP |
| Ga0126376_105047423 | 3300010359 | Tropical Forest Soil | MRAVICLLAVVFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPD |
| Ga0126376_128003951 | 3300010359 | Tropical Forest Soil | MRAAVCLLAVLILAAAASAVAQEKHLIDPMLPGSLNPKPLPPLK |
| Ga0126372_107459522 | 3300010360 | Tropical Forest Soil | MRAVVCLLAALFLAAASSAVAQEKHLIDPMLPGSLDPKPLPPLKNP |
| Ga0126378_101334241 | 3300010361 | Tropical Forest Soil | MRPAARLIFILILAAAGSAAAQEKQSIDPTPPGSLNPEPLPP |
| Ga0126378_101476884 | 3300010361 | Tropical Forest Soil | MRAVICLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLK |
| Ga0126378_107443191 | 3300010361 | Tropical Forest Soil | MRDAARPLAVLILTAAFSAIAQEKHLIDPTPPGSLNPEPLPPLQNPD |
| Ga0126378_130452781 | 3300010361 | Tropical Forest Soil | VRADVRLFLILSLIFILAIAGSAVAQEKHLIDPTP |
| Ga0126377_101706624 | 3300010362 | Tropical Forest Soil | MRAVACLLAALSLTAAGSALAQEKHLIDPMLPGSLNPKPLPQLENP |
| Ga0134128_114786161 | 3300010373 | Terrestrial Soil | MRAAARLLAVLILAAAGSALAQEKHLIDPTPPGSLNRKPLPPL |
| Ga0126381_1007252173 | 3300010376 | Tropical Forest Soil | MRAVICLLAVVFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDAPSI |
| Ga0126381_1010951881 | 3300010376 | Tropical Forest Soil | MHAAARLLAALIFAAAGSVVAQEKHLIDPTLPGSLNPEPLPLL |
| Ga0126383_129372651 | 3300010398 | Tropical Forest Soil | VQSLMRAVVCLLAVLFLAAATAAVAQQKHVIDPMLPGSLDPKP |
| Ga0126383_136713611 | 3300010398 | Tropical Forest Soil | MRSAACLLALLILAAPAVAEEKHLIDRTRPGSLNPLPLPPLHNADAPS |
| Ga0105246_106607461 | 3300011119 | Miscanthus Rhizosphere | MHAAPRLLAVFILAAAGSAVAQEKHLIDPTPPGSLNPE |
| Ga0153928_10904692 | 3300012677 | Attine Ant Fungus Gardens | MRAAARLVAVFLFALAGPAAAQEKHLIDPTPPGSLNPEPLPPLEHP |
| Ga0137404_121058982 | 3300012929 | Vadose Zone Soil | MRAVLCLLTVLFLAAASSAVAQEKHLIDPMLPGSLNPKLLPPLKNPDAPSTP |
| Ga0126375_120817472 | 3300012948 | Tropical Forest Soil | MRAVACLLALLFFADADSAVGQEKNSIDPMLPGSLNPEPLPPLKNPEAPS |
| Ga0126369_108969711 | 3300012971 | Tropical Forest Soil | LVTRPAARLLAVLILAAASSAVAQEKHLIDPTPPGSLNPEP |
| Ga0164309_111512191 | 3300012984 | Soil | MRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLP |
| Ga0164306_116877391 | 3300012988 | Soil | MRAVVCLLAVLFVAAASSAVAQEKHLIDPMLPGSLNPRPLPPL |
| Ga0164305_103330183 | 3300012989 | Soil | MRAVVFLLAVLFLAAASSAVAQEKHLIDPMLPGSL |
| Ga0075343_11270851 | 3300014317 | Natural And Restored Wetlands | MRAVACLLAVFVLAAASSAVAQQKRAIDRMLPGSLDPKPL |
| Ga0157379_106923791 | 3300014968 | Switchgrass Rhizosphere | MRAIVCLVAVLFLAAASSALAQQKHLIDSMLPGSLNPKPLP |
| Ga0157376_118168382 | 3300014969 | Miscanthus Rhizosphere | MRVAARVLAIFMVAAAGPALAKKKHLIDPTPPGSLNPIALPPLQ |
| Ga0132258_126226911 | 3300015371 | Arabidopsis Rhizosphere | MRAAACLLAVFVLVAAGSAAAQEKHLIDPTPPGSLNPKP |
| Ga0132256_1028953252 | 3300015372 | Arabidopsis Rhizosphere | MRAVAFLLVLHFLAAAGSAVAQEKNLIAPMLPGSLNPKPLPPLKNPEGPS |
| Ga0182036_112632831 | 3300016270 | Soil | MPAVACLLAVLFLAAASSALAQKKHLIDPMLPGSLNPE |
| Ga0182032_111272592 | 3300016357 | Soil | MRAAAHLLAFLVLASAGSAVAQEKHLIDPTLPGSL |
| Ga0182034_110937502 | 3300016371 | Soil | MCAAARLLAILIFVATGPAVAQEKHLIDPTPPGSLNPEP |
| Ga0182040_108259571 | 3300016387 | Soil | MRAAVCLFAVLFLAGGIFAVAQERHLIDPMRPGSLNPKP |
| Ga0182037_120915711 | 3300016404 | Soil | MMRAAARLLAAFLVVAAGSAAAQEKHLIDPTPPGSLNPEPLPPL |
| Ga0182039_117817122 | 3300016422 | Soil | MRAVRCLLAVLFLAAANSAVAQEKHLIDPMLPGSLNPKPLPPLK |
| Ga0182038_106944291 | 3300016445 | Soil | MPAVACLLAVLFLAAASSALAQKKHLIDPMLPGSLN |
| Ga0187824_102254491 | 3300017927 | Freshwater Sediment | MYTAARLVAVLLFALAGSAAAQEKHLIDPTPPGSLNPEPL |
| Ga0187781_109238341 | 3300017972 | Tropical Peatland | MRTAARLLAVLILAVAGSAVAQEKHLIDRTRPGSLNPESL |
| Ga0187777_101350224 | 3300017974 | Tropical Peatland | MHAAACLLAVLILAAAGSAVAQEKHSIDPTPPGSLNPGPLP |
| Ga0187777_101847773 | 3300017974 | Tropical Peatland | MRAAARLLAVLILAAAGSAAAQEKHLIDPTPPGSLN |
| Ga0187772_108685542 | 3300018085 | Tropical Peatland | MRTAARLLAALILAVAGSAVAQEKHLIDRTRPGSLNPESL |
| Ga0210407_109207431 | 3300020579 | Soil | MRAAAHLLAVLLLAAAGSAVARAKHLIDPTPPGSLNPEPP |
| Ga0210406_103958931 | 3300021168 | Soil | MRAVVCLLAVLFVAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKN |
| Ga0210406_104169942 | 3300021168 | Soil | MRAAARLLALLMLAAAGSAVAQEKHLIDPTPPGSLNPEPLPRLQNPD |
| Ga0210405_104960381 | 3300021171 | Soil | MRAVLSLLAILFLAAAGSAIAQEKHLIDPMLPGSLNPKPLPPLTNP |
| Ga0210389_109517911 | 3300021404 | Soil | MRAVVCLLAVLFLAAASSAVAQEKHVLDPMLPGSL |
| Ga0210394_112023842 | 3300021420 | Soil | MRAVVCLLVVVFLAAASSAVAQEKHLIDPMLPGSLDPQ |
| Ga0210402_106089322 | 3300021478 | Soil | MRAAVRLLAVLILAAAGSAVAQEKHLIDPTPPGSLN |
| Ga0126371_103097954 | 3300021560 | Tropical Forest Soil | MRAVACLLAVLFLAAAGSSVAQEKHSIDPMLPGTLDPKPLPPL |
| Ga0126371_106358853 | 3300021560 | Tropical Forest Soil | MRSAACLLALLILAAPAVAEEKHLIDRTRPGSLNPL |
| Ga0222622_108853262 | 3300022756 | Groundwater Sediment | MRAAARLLAVLILAAAGSALAQEKHLIDPTPPGSLN |
| Ga0207642_103240961 | 3300025899 | Miscanthus Rhizosphere | MRAVVCLLAVLFLAAASSAVVAQEKHLIDPMLPGSLNPKPLPPLKNPDARS |
| Ga0207693_101107701 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAVICLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKN |
| Ga0207662_108493291 | 3300025918 | Switchgrass Rhizosphere | MPAVLCLLAVLFLAAASSVVVAQEKHVIDPMLPGSLD |
| Ga0207709_108841861 | 3300025935 | Miscanthus Rhizosphere | MRVAARVLAIFMVAAAGPALAQKKHLIDPTPPGSLNPKALPPLQNPD |
| Ga0207711_112842662 | 3300025941 | Switchgrass Rhizosphere | MRVAARVLAIFMVAAAGPALAQKKHLIDPTPPGSLNPIALPPLQNPD |
| Ga0207641_117078981 | 3300026088 | Switchgrass Rhizosphere | MPAVLCLLAVLFLAAASSVVVAQEKHVIDPMLSGSLDPKPLPPLKNPD |
| Ga0257147_10200822 | 3300026475 | Soil | MRAPTRLLAVLILTAVGSAVAQEKHLIDPTPPGSLNPKPLPPLQN |
| Ga0207722_10127761 | 3300027003 | Tropical Forest Soil | MRTAVRLLAVLLLAAAGSAGAQEKHMIDPTPPGSLNPEPLPPLENP |
| Ga0208042_10630352 | 3300027568 | Peatlands Soil | MRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPGSLDP |
| Ga0208324_10995252 | 3300027604 | Peatlands Soil | MRAAAHLLAVLLLAAAGSAVAREKHLIDPAPPGFLNPEPLPPLQNPD |
| Ga0209178_11600141 | 3300027725 | Agricultural Soil | MRAAARLLTVLILAAAGFAVAQEKHSIDPTPPGSLNLEPLPPL |
| Ga0208989_100128411 | 3300027738 | Forest Soil | MRAVICLLAVLFLAAASSAVAQEKHLIDPMLAGSLN |
| Ga0209481_103579581 | 3300027880 | Populus Rhizosphere | MRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNP |
| Ga0209526_104231012 | 3300028047 | Forest Soil | MRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPGSLNP |
| Ga0307302_100404865 | 3300028814 | Soil | MRAVVCLLAVLFPAAASSAVAQEKHLIDPMLPGSVNPRPCR |
| Ga0311355_110631561 | 3300030580 | Palsa | MRVVVCLVAILFLSAASSAVAQEKHLIDPMLPGSLDPEPLPPLKNPDAPS |
| Ga0075386_116305391 | 3300030916 | Soil | MRAPTRLLAVLILAAVGSAVAQEKHLIDPTPPGSLNPEPLPPLQNP |
| Ga0308193_10268592 | 3300031096 | Soil | LLMRAVVCLLAVLFPAAASSAVAQEKHLIDPMLPGSLNP |
| Ga0170820_144864521 | 3300031446 | Forest Soil | MRAVVCLLAVLSLAAASSAVAQEKHGIDPMLPGSLNPK |
| Ga0170820_165866151 | 3300031446 | Forest Soil | MRATVRLLAVLILAAAGSAVAQEKHLIDPTPPGSLNPEP |
| Ga0170818_1134908852 | 3300031474 | Forest Soil | MRAVLYLLAVFFLAAAGSAIAQEKHLIDPMLPGSLNPEPL |
| Ga0318516_108077721 | 3300031543 | Soil | MRAVVCLLAVLFLAVASSAVAQEKHLIDPMLPGSLNPK |
| Ga0318515_101089221 | 3300031572 | Soil | MRAAARLFAVLVLAAVGSAVAQEKHLIDPTPPGSLNPEPLPPLQ |
| Ga0310915_103740231 | 3300031573 | Soil | MRTVVCLLAILFLAAASSALAQQKHLLDPMLPGSLDPKPLPPLKNP |
| Ga0306917_100308991 | 3300031719 | Soil | MRAVVCLLAVLFLAVASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPAAPSTP |
| Ga0306917_110670521 | 3300031719 | Soil | MRTVVCLLAVLFLAAASSAVAQQKHLIDPMLPGSL |
| Ga0307469_117502562 | 3300031720 | Hardwood Forest Soil | MRAVVCLLAVLFVAAAGSAVAQEKHLIDPMLSGSLNPK |
| Ga0306918_103166731 | 3300031744 | Soil | MMRAAARLLAAFLVVAAGSAAAQEKHLIDPTPPGSL |
| Ga0318502_110216832 | 3300031747 | Soil | LLMRAVVCLLAVLFLAAASSAVAQEKHLIDPMLPG |
| Ga0318492_104426362 | 3300031748 | Soil | MRTAARLLAVLLLAAAGSAGAQEKHMIDPTPPGSLN |
| Ga0318494_103605451 | 3300031751 | Soil | MRAVAPLLAVFLLAAGSAGAQEKHLTDPTPPGSLNPEPLPALQHPDA |
| Ga0318535_104610692 | 3300031764 | Soil | MRAAARLLAVLMLVAAGSAVAQEKHLIDRTRPGSLNPEPLPPLQNP |
| Ga0318509_102593551 | 3300031768 | Soil | MRAVVCLLAVLFLAVASSAVAQEKHLIDPMLPGSLN |
| Ga0318566_106571771 | 3300031779 | Soil | MRAVLCLLVVLFLAATGSAIAQEKHSIDPMLPGSLNPKPLPPLKN |
| Ga0318552_102314011 | 3300031782 | Soil | MRAVVCLLAVLFLAVASSAVAQEKHLIDPMLPGSLNPKPLPPLK |
| Ga0318552_102581371 | 3300031782 | Soil | LLVRAVRCLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNP |
| Ga0318550_102842041 | 3300031797 | Soil | MHAAARFIAIALIALAGSAAAQQKPEIDPTPPGSLNPEPLPLLEYRDAK |
| Ga0318568_105276961 | 3300031819 | Soil | MRAVLCLLAALFLAAANSAVAQEKHLIDPMLPGSLNPKPLPPLKN |
| Ga0310917_111128971 | 3300031833 | Soil | MRAAARLLAVLMLVTTGSAAAQEKHLIDRTRPGSLDPKPLPPLQNPDAP |
| Ga0310907_104717612 | 3300031847 | Soil | MRAAARLLAVVILAAAGSAVAQEKHLIDPTPPGSLNPKPLPPLQN |
| Ga0306919_112191652 | 3300031879 | Soil | MCAVVCLVAGLFLTAASSAIAQEKHLIDPMLPGSLNPKPLPPLKNPDAA |
| Ga0318551_100891201 | 3300031896 | Soil | MRAVVCLVAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDAPS |
| Ga0306923_112608711 | 3300031910 | Soil | MRAVICLLAVLFLAAASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDAPSI |
| Ga0310912_100511045 | 3300031941 | Soil | MRAAARLLAVLMLVAAGSAVAQEKHLIDRTRPGSL |
| Ga0310910_108280332 | 3300031946 | Soil | MRAAARLLAVLMLVAAGSAVAQEKHLIDRTRPGSLNPEPLPPLQNPDA |
| Ga0318531_103984451 | 3300031981 | Soil | MRAVICLLAVLFPAIASSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDAQSIPAK |
| Ga0310903_103187142 | 3300032000 | Soil | MRAVVCLLAVLFSAATSSAVAQEKHLIDPMLPGSLNPRPLPPLKNPDALST |
| Ga0318569_105692551 | 3300032010 | Soil | MRAAARLFAVLVLAAVGSAVAQEKHLIDPTPPGSLNPE |
| Ga0318507_104390581 | 3300032025 | Soil | MRAVVCLLAVLFLAVASSAVAKEKHLIDPMLPGSLNPKPLPPLKNPA |
| Ga0318556_101317042 | 3300032043 | Soil | MRAAACLLTVFVFAAAGSAVAQEKHLIDPTPPGSLNPEPLPP |
| Ga0318533_103357442 | 3300032059 | Soil | MRAAPCLLAVLILAAAGSAVAQEKHLIDPTPPGSLN |
| Ga0318505_100038951 | 3300032060 | Soil | MRAAARLFAVLVLAAVGSAVAQEKHLIDPTPPGSLNPEPLPPLQN |
| Ga0306924_124163402 | 3300032076 | Soil | MRAVLCLLAVLFLAAANSAVAQEKHLIDPMLPGSLNPKPLPP |
| Ga0306920_1008721091 | 3300032261 | Soil | MRAAARLLAVLMLVAAGSAVAQEKHLIDRTRPGSLNPEPLPPLQNPDAAAD |
| Ga0306920_1034239341 | 3300032261 | Soil | MRTVVCLLAVLFLSAASSAVAQQKHLIDPMLPGSLTPKPLPSLKIPDAPATPAQE |
| Ga0335084_108007473 | 3300033004 | Soil | MRAAPCLLAVLLLAAAGSAVAQEKHLIDPILPGSLNPK |
| Ga0310914_104881931 | 3300033289 | Soil | MRTAARLLAALLLAAAGSAGAQEKHMIDPTPPGSLNP |
| Ga0310914_109705641 | 3300033289 | Soil | MHAAARFIAIALIALAGSAAAQQKPEIDPTPPGSLNPEPLPLLE |
| Ga0318519_107973961 | 3300033290 | Soil | MRAAARLLAILILAAASSAVAQQKHLIDPTPRGSLNPVPLP |
| Ga0326726_104682213 | 3300033433 | Peat Soil | MRAVACLLAVLFLAGSAVAQEKHLIDPMLPGSLNPKPLPPLKNPDAPST |
| ⦗Top⦘ |