


| Basic Information | |
|---|---|
| Family ID | F045329 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNKKFIIAWIVLFVAWFMGSFVVHGVLLHSDYMQLTSLFRAE |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.74 % |
| % of genes near scaffold ends (potentially truncated) | 85.62 % |
| % of genes from short scaffolds (< 2000 bps) | 79.74 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.856 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.686 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.680 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.294 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF04828 | GFA | 6.54 |
| PF10604 | Polyketide_cyc2 | 3.92 |
| PF12697 | Abhydrolase_6 | 2.61 |
| PF02900 | LigB | 1.96 |
| PF13207 | AAA_17 | 1.96 |
| PF12804 | NTP_transf_3 | 1.96 |
| PF09996 | DUF2237 | 1.96 |
| PF02687 | FtsX | 1.96 |
| PF00756 | Esterase | 1.31 |
| PF01569 | PAP2 | 1.31 |
| PF00903 | Glyoxalase | 1.31 |
| PF01850 | PIN | 1.31 |
| PF00563 | EAL | 1.31 |
| PF00990 | GGDEF | 1.31 |
| PF14534 | DUF4440 | 1.31 |
| PF13520 | AA_permease_2 | 1.31 |
| PF07298 | NnrU | 1.31 |
| PF07883 | Cupin_2 | 1.31 |
| PF13676 | TIR_2 | 1.31 |
| PF01425 | Amidase | 1.31 |
| PF03401 | TctC | 0.65 |
| PF13561 | adh_short_C2 | 0.65 |
| PF01979 | Amidohydro_1 | 0.65 |
| PF04273 | BLH_phosphatase | 0.65 |
| PF08281 | Sigma70_r4_2 | 0.65 |
| PF12695 | Abhydrolase_5 | 0.65 |
| PF12680 | SnoaL_2 | 0.65 |
| PF01596 | Methyltransf_3 | 0.65 |
| PF11578 | DUF3237 | 0.65 |
| PF00155 | Aminotran_1_2 | 0.65 |
| PF10370 | DUF2437 | 0.65 |
| PF01546 | Peptidase_M20 | 0.65 |
| PF01738 | DLH | 0.65 |
| PF00156 | Pribosyltran | 0.65 |
| PF03060 | NMO | 0.65 |
| PF02633 | Creatininase | 0.65 |
| PF13302 | Acetyltransf_3 | 0.65 |
| PF04972 | BON | 0.65 |
| PF08327 | AHSA1 | 0.65 |
| PF00208 | ELFV_dehydrog | 0.65 |
| PF02630 | SCO1-SenC | 0.65 |
| PF00589 | Phage_integrase | 0.65 |
| PF07969 | Amidohydro_3 | 0.65 |
| PF01594 | AI-2E_transport | 0.65 |
| PF13751 | DDE_Tnp_1_6 | 0.65 |
| PF01726 | LexA_DNA_bind | 0.65 |
| PF13469 | Sulfotransfer_3 | 0.65 |
| PF07804 | HipA_C | 0.65 |
| PF01625 | PMSR | 0.65 |
| PF02574 | S-methyl_trans | 0.65 |
| PF04116 | FA_hydroxylase | 0.65 |
| PF00361 | Proton_antipo_M | 0.65 |
| PF00724 | Oxidored_FMN | 0.65 |
| PF05960 | DUF885 | 0.65 |
| PF01592 | NifU_N | 0.65 |
| PF08530 | PepX_C | 0.65 |
| PF01810 | LysE | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 6.54 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.31 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.31 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.31 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 1.31 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.31 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.31 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.65 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.65 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.65 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.65 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.65 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.65 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.65 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.65 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.65 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.65 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.65 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.65 |
| COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.65 |
| COG3550 | Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin module | Signal transduction mechanisms [T] | 0.65 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.86 % |
| Unclassified | root | N/A | 26.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0747113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 37915 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104329974 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300000546|LJNas_1013674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 865 | Open in IMG/M |
| 3300003369|JGI24140J50213_10109567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300003885|Ga0063294_10869512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
| 3300005437|Ga0070710_10865196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 650 | Open in IMG/M |
| 3300005447|Ga0066689_10625613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300005454|Ga0066687_10623888 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005471|Ga0070698_100218107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1842 | Open in IMG/M |
| 3300005530|Ga0070679_100861398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300005543|Ga0070672_101973805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Luteimonas → Luteimonas mephitis | 525 | Open in IMG/M |
| 3300005554|Ga0066661_10261614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1070 | Open in IMG/M |
| 3300005556|Ga0066707_10539275 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005556|Ga0066707_10993139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
| 3300005564|Ga0070664_100917474 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005574|Ga0066694_10623187 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005598|Ga0066706_10356635 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300005598|Ga0066706_10371911 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300006050|Ga0075028_100761806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 587 | Open in IMG/M |
| 3300006903|Ga0075426_10805901 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300007076|Ga0075435_101122107 | Not Available | 687 | Open in IMG/M |
| 3300009029|Ga0066793_10066304 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300009789|Ga0126307_10774980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 774 | Open in IMG/M |
| 3300009804|Ga0105063_1045365 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300010333|Ga0134080_10377315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300010361|Ga0126378_12736569 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300010362|Ga0126377_12981758 | Not Available | 546 | Open in IMG/M |
| 3300010400|Ga0134122_11270689 | Not Available | 742 | Open in IMG/M |
| 3300011270|Ga0137391_10274833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1457 | Open in IMG/M |
| 3300011271|Ga0137393_11790581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300012185|Ga0136619_10332939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
| 3300012203|Ga0137399_11084766 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012204|Ga0137374_11304157 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012210|Ga0137378_10319756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1443 | Open in IMG/M |
| 3300012211|Ga0137377_10069166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3304 | Open in IMG/M |
| 3300012211|Ga0137377_10852074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300012350|Ga0137372_10281185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 288 | 1296 | Open in IMG/M |
| 3300012350|Ga0137372_10868640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300012363|Ga0137390_11285502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300012582|Ga0137358_10538864 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300012685|Ga0137397_10023805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4327 | Open in IMG/M |
| 3300012917|Ga0137395_10853938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300012922|Ga0137394_11583305 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012922|Ga0137394_11628787 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012927|Ga0137416_11816846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300012929|Ga0137404_10054513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3078 | Open in IMG/M |
| 3300012944|Ga0137410_11180499 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300013296|Ga0157374_10835573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300014166|Ga0134079_10446449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300014326|Ga0157380_10449664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Caldovatus → Caldovatus aquaticus | 1237 | Open in IMG/M |
| 3300014501|Ga0182024_11602803 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300014866|Ga0180090_1061873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter palustris | 656 | Open in IMG/M |
| 3300015264|Ga0137403_10479058 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300015357|Ga0134072_10318808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300015373|Ga0132257_103775663 | Not Available | 551 | Open in IMG/M |
| 3300015374|Ga0132255_104905946 | Not Available | 567 | Open in IMG/M |
| 3300017792|Ga0163161_10203101 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300017947|Ga0187785_10172757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300017975|Ga0187782_11163463 | Not Available | 603 | Open in IMG/M |
| 3300018079|Ga0184627_10146639 | Not Available | 1251 | Open in IMG/M |
| 3300020170|Ga0179594_10191553 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300020582|Ga0210395_11258979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300021180|Ga0210396_10300469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1421 | Open in IMG/M |
| 3300021181|Ga0210388_10568943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300021401|Ga0210393_10335301 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300021406|Ga0210386_10753570 | Not Available | 838 | Open in IMG/M |
| 3300021413|Ga0193750_1057923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300021432|Ga0210384_10086345 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300021478|Ga0210402_10952610 | Not Available | 785 | Open in IMG/M |
| 3300021560|Ga0126371_11960059 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300021560|Ga0126371_13471210 | Not Available | 532 | Open in IMG/M |
| 3300022553|Ga0212124_10262599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
| 3300023261|Ga0247796_1103684 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300025899|Ga0207642_11127639 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300025903|Ga0207680_10406938 | Not Available | 962 | Open in IMG/M |
| 3300025906|Ga0207699_10015781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3933 | Open in IMG/M |
| 3300025916|Ga0207663_10438292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
| 3300025926|Ga0207659_11216027 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025928|Ga0207700_10783732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 852 | Open in IMG/M |
| 3300025938|Ga0207704_10590366 | Not Available | 908 | Open in IMG/M |
| 3300025972|Ga0207668_10784906 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300026118|Ga0207675_100703608 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300026315|Ga0209686_1226451 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300026529|Ga0209806_1342868 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026538|Ga0209056_10413249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. A 288 | 815 | Open in IMG/M |
| 3300026557|Ga0179587_10920678 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300027548|Ga0209523_1071956 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300027648|Ga0209420_1030715 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300027667|Ga0209009_1152551 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027831|Ga0209797_10128606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
| 3300027846|Ga0209180_10312574 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300027879|Ga0209169_10609427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300027880|Ga0209481_10089629 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300028145|Ga0247663_1108558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → unclassified Gallionellaceae → Gallionellaceae bacterium | 511 | Open in IMG/M |
| 3300028536|Ga0137415_10282718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium GJ-E10 | 1464 | Open in IMG/M |
| 3300028600|Ga0265303_10627186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium | 873 | Open in IMG/M |
| 3300028747|Ga0302219_10328712 | Not Available | 596 | Open in IMG/M |
| 3300028775|Ga0302231_10032860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2224 | Open in IMG/M |
| 3300029910|Ga0311369_11522716 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300029951|Ga0311371_11014596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 985 | Open in IMG/M |
| 3300029997|Ga0302302_1150124 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300029999|Ga0311339_10814099 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300030740|Ga0265460_12469939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300030743|Ga0265461_12225096 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300030841|Ga0075384_11233044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300031128|Ga0170823_15365811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300031234|Ga0302325_10662283 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300031234|Ga0302325_12451480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300031236|Ga0302324_101340060 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031236|Ga0302324_102731368 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031344|Ga0265316_10770125 | Not Available | 676 | Open in IMG/M |
| 3300031712|Ga0265342_10655454 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031715|Ga0307476_10994543 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031716|Ga0310813_10173819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1749 | Open in IMG/M |
| 3300031719|Ga0306917_10117473 | Not Available | 1933 | Open in IMG/M |
| 3300031740|Ga0307468_100056619 | Not Available | 2088 | Open in IMG/M |
| 3300031769|Ga0318526_10420126 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300031772|Ga0315288_11229932 | Not Available | 643 | Open in IMG/M |
| 3300031823|Ga0307478_11442328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300031997|Ga0315278_10673364 | Not Available | 1054 | Open in IMG/M |
| 3300032001|Ga0306922_12298347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300032052|Ga0318506_10408057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300032174|Ga0307470_10002616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 6872 | Open in IMG/M |
| 3300032180|Ga0307471_100028520 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4250 | Open in IMG/M |
| 3300032180|Ga0307471_100597987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1262 | Open in IMG/M |
| 3300032180|Ga0307471_102367864 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300032205|Ga0307472_100711353 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300032205|Ga0307472_101247992 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300032261|Ga0306920_100881565 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300032828|Ga0335080_11288971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300032897|Ga0335071_10366558 | Not Available | 1394 | Open in IMG/M |
| 3300033480|Ga0316620_12604375 | Not Available | 503 | Open in IMG/M |
| 3300034163|Ga0370515_0095081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.19% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.19% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.31% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.31% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.31% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.65% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 0.65% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.65% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.65% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.65% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014866 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_074711317 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MSKRFFLAWLVLFIAWFIGSFVVHGVLLHADYAQLSNLFRKESE |
| INPhiseqgaiiFebDRAFT_1043299742 | 3300000364 | Soil | MNKRLFIAWLVIFVVWFAGSFVVHGTLLHDDYAKLTGLFRTERE |
| LJNas_10136741 | 3300000546 | Quercus Rhizosphere | MGKKFIIAWIVLFVTWFLGDFVVHAVLLRSDYMQLTNLFRTEGDEQK |
| P5cmW16_10468501 | 3300001664 | Permafrost | MSRKFFIAWIVIFIAWIDGSYVVHGFLLNDDYIKSSGLFRSEAEAHPYFPIMVLAHVI |
| JGI24140J50213_101095671 | 3300003369 | Arctic Peat Soil | MSKKFFIAWVVIFIVWFAGSFVVHGVLLHDDYAKSASLFRTEADSQSY |
| Ga0063294_108695121 | 3300003885 | Hydrothermal Vents | MNKKFFISWAIVFVAWMAGSFVVHGVLLADGYASLQNLFRSEENSQ |
| Ga0055466_101343562 | 3300003997 | Natural And Restored Wetlands | VNRKFFIAWIVVFIAYMAGGFVVHHALLSQDYMALPSLFRAEADAKPIFYLM |
| Ga0070682_1002956511 | 3300005337 | Corn Rhizosphere | MNKTFFIAWVVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMV |
| Ga0070710_108651962 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTNLFRPEAEAQHY |
| Ga0066689_106256132 | 3300005447 | Soil | MNKNLIIAWIVLFFAWFIGSFVVHGVLLHSDYLQLTSLFRA |
| Ga0066687_106238881 | 3300005454 | Soil | MNRSFVIAWVVLFVAWYIGSFVVHGVLLHADYARLARLFRSPEEAT |
| Ga0070698_1002181074 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTNLFRPEAE |
| Ga0070679_1008613982 | 3300005530 | Corn Rhizosphere | MDKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSGLFRPEA |
| Ga0070672_1019738051 | 3300005543 | Miscanthus Rhizosphere | MDKKFIIAWIVIFVACFLGGFIVHGLLLHSDYMQIANLFRPETDQA |
| Ga0066661_102616141 | 3300005554 | Soil | MNKKFFIAWIVLFIAWFIGSFVVHGVLLHDDYARLTNLFRPEAEAQHYF |
| Ga0066707_105392753 | 3300005556 | Soil | MNKKFFIAWIVIFIAWMAGSFVVHATLLHDDYAKLTNLFRSE |
| Ga0066707_109931392 | 3300005556 | Soil | MDKKFIIAWIVIFIVWFAGSFVVHGVLLHDDYSKLTNLFR |
| Ga0068855_1009737883 | 3300005563 | Corn Rhizosphere | MNKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSGLFRPEAEAQSYFPL |
| Ga0070664_1009174742 | 3300005564 | Corn Rhizosphere | MNKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSG |
| Ga0066694_106231872 | 3300005574 | Soil | MNKRFALAWLILFVAWFLGSFVVHGVLLHGDYMQLKNLFRTEAESQNFFP |
| Ga0066706_103566353 | 3300005598 | Soil | MDKKFIIAWIVIFIVWFAGSFVVHGVLLHDDYSKLTNLFRSEADAQKYMPL |
| Ga0066706_103719113 | 3300005598 | Soil | MNKRFALAWLVLFVAWFLGSFVVHGVLLHGDYMQLKNLFRT |
| Ga0075028_1007618061 | 3300006050 | Watersheds | MNKKFLIAWAVLFVAWFIGSFIVHGVLLRADYMQLTSLF |
| Ga0075018_107773462 | 3300006172 | Watersheds | MDRKTLFAWIAVFVLWMVGSFVVHGVVLHEDYMRLQNLFRPEAEAGKFFPLMI |
| Ga0075426_108059012 | 3300006903 | Populus Rhizosphere | MNKRFLLAWLVLFVAWFIGSFIVHGLLLHADYAQLSNLFRKEA |
| Ga0075435_1011221071 | 3300007076 | Populus Rhizosphere | MNKRFLIAWLVLFIAWFCGSFVVHDVLLHADYAAMPNLMRKEADMQYFFP |
| Ga0066710_1028756782 | 3300009012 | Grasslands Soil | MNKKLIIAWIVIFVACLCGSFVVHGVLLYDEFVRLSNLFRPVAVAQQYFPLLIIDVVIIAGDLDW |
| Ga0066793_100663041 | 3300009029 | Prmafrost Soil | MNKKFFIAWIVVFVAWMAGSFVVHGVLLHDDYLRLPN |
| Ga0105248_123593022 | 3300009177 | Switchgrass Rhizosphere | MNKTFFIAWIVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYF |
| Ga0105237_100181591 | 3300009545 | Corn Rhizosphere | MNKTFFIAWVVIFFAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMVLAHII |
| Ga0126307_107749802 | 3300009789 | Serpentine Soil | MSIQFFIAWASTFVAWMAGSFVVHGVLLQEDYAKLQNLFRSPEEAKHYFAF |
| Ga0105063_10453651 | 3300009804 | Groundwater Sand | MNKRFLAAWLIVFIAWMVGSFIVHGTLLHNDYAALPKLFRSEANAQRF |
| Ga0134080_103773152 | 3300010333 | Grasslands Soil | MNKKFIIAWIVLFVAWFVGSFVVHGVLLRSDYTQLTSLF |
| Ga0126378_127365691 | 3300010361 | Tropical Forest Soil | MSKKFFIAWIVIFVAWFAGSFVVHGQLLHDDYSKL |
| Ga0126377_129817581 | 3300010362 | Tropical Forest Soil | MNKKFVLAWVVVFLVWFFGSFVVHGLLLRADYMQLTSLF |
| Ga0134122_112706891 | 3300010400 | Terrestrial Soil | VNKKFFIAWIVMFIAYMAGGFIVHHVLLGQDYMALPNL |
| Ga0137391_102748331 | 3300011270 | Vadose Zone Soil | MNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTNLFRPEAEAQ |
| Ga0137393_117905811 | 3300011271 | Vadose Zone Soil | MNKKLIIAWIVLFVAWFMGSFVVHGVLLHSDYLQLTNLFRAEDDQRKYF |
| Ga0137437_10412694 | 3300011442 | Soil | MNKKFLIAWIVVFVAWMAGSFVVHGVLLHGDYAKLPGLFRPEAEAQAYF |
| Ga0136619_103329391 | 3300012185 | Polar Desert Sand | MNKKFLIAWVVLFIASMAGDFLVHGVLLKPDYLQL |
| Ga0137399_110847661 | 3300012203 | Vadose Zone Soil | MNKRFALAWLVIFVAWFLGSFLVHAVLLHADYLAARDL |
| Ga0137374_113041572 | 3300012204 | Vadose Zone Soil | MNKKFFIAWIVIFVAWMAGSFVVHAVLLHDDYAKLSGLFRSEADAQTY |
| Ga0137378_103197561 | 3300012210 | Vadose Zone Soil | MSLWKETMSKQFIIAWIVVFVVWFAGSYVVHGVLLHEDYAK |
| Ga0137377_100691664 | 3300012211 | Vadose Zone Soil | MNKKFIITWIVLFVAWFVGSFVVHGVLLRSDYMQLTKLFRAEGDQQK |
| Ga0137377_108520742 | 3300012211 | Vadose Zone Soil | MNKKFFIAWIVVFIAWMAGSFVVHGVLLHDDYLSLPNLFRTE |
| Ga0137372_102811854 | 3300012350 | Vadose Zone Soil | MNKKFVIAWIVIFIAWMAGSFVVHATLLHDDYAKLTNLFRS |
| Ga0137372_108686402 | 3300012350 | Vadose Zone Soil | MNKQYIIAWIVVFVVWFAGSYVVHGVLLHDDYSKLQGLFRPEAEARQ |
| Ga0137390_112855022 | 3300012363 | Vadose Zone Soil | MNKKFIIAWIAIFIVWFAGSFVVHGVLLHDDYAKLTNLF |
| Ga0150984_1189190431 | 3300012469 | Avena Fatua Rhizosphere | MNRRFLLTWIVVFVLWMAGSFLVHALLLHDDYAGLPNVFRPEAEAQKYF |
| Ga0137358_105388641 | 3300012582 | Vadose Zone Soil | MNKKLIIAWIVLFIAWFIGSFVVHGVLLHSDYMQLTSLFR |
| Ga0136614_112087421 | 3300012684 | Polar Desert Sand | MGKRFFINWIILFVLWMLGSFVVHGLLLHDDYARLPNLFR |
| Ga0137397_100238051 | 3300012685 | Vadose Zone Soil | MNKRFFLAWLVLFIAWFIGSFIVHGVLLHADYAALSNLFRKESEAQNF |
| Ga0137395_108539382 | 3300012917 | Vadose Zone Soil | MNKKFFIAWIVLFIAWFVGSFVVHGVLLHDDYARLTNLFRPEAEAQ |
| Ga0137394_115833052 | 3300012922 | Vadose Zone Soil | MNKRFLMAWLVVFIAWFIGSFVVHGVLLHDDYMAAK |
| Ga0137394_116287871 | 3300012922 | Vadose Zone Soil | MNKKLIIAWIVLFIAWFIGSFVVHGVLLHSDYMQLTNLFRAEGD |
| Ga0137416_118168461 | 3300012927 | Vadose Zone Soil | MNKKLIIAWIVLFFAWFIGSFVVHGVLLHSDYLQLTSLFRAEQDQQKY |
| Ga0137404_100545134 | 3300012929 | Vadose Zone Soil | MNKKFVIAWIVLLIAWFVGSFVVHGVLLRSYSMQLTN |
| Ga0137410_111804991 | 3300012944 | Vadose Zone Soil | MNKKLIIAWIVLFVAWFMGSFVVHGVLLHSGYMQLT |
| Ga0157374_108355733 | 3300013296 | Miscanthus Rhizosphere | MDKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSGLFRPEAEAQ |
| Ga0134079_104464492 | 3300014166 | Grasslands Soil | MNKRFIIAWMVLFVAWFVGSFVVHGVLLRSDYVQLTSLFRAAGDQQKYF |
| Ga0157380_104496641 | 3300014326 | Switchgrass Rhizosphere | MNKRFFIAWIVLFVAWFAGSFVVHGLLLGGDYKAL |
| Ga0157380_134168481 | 3300014326 | Switchgrass Rhizosphere | MNKTFFIAWIVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMVL |
| Ga0182024_116028032 | 3300014501 | Permafrost | MNRKLIVAWVVVFIAWFMGSFVVHGVLLHADYMQVPTLFRMNDDA |
| Ga0180090_10618731 | 3300014866 | Soil | MDRRFFIAWVVLFVAWMAGSFLVHGTLLHTDYSQL |
| Ga0137403_104790582 | 3300015264 | Vadose Zone Soil | MNKKFIIAWIGLFVAWLLGDFVVHAVLLHSDYMQLPNLYRT* |
| Ga0137403_114943301 | 3300015264 | Vadose Zone Soil | MNKKFIIAWIVIFVAWFAGSFVVHGVLLHDDYSKLSNLFRTEAESQQYFPLMV |
| Ga0134072_103188082 | 3300015357 | Grasslands Soil | MSKKFLVAWIVLFVAWFIGSFIVHGVLLHADYAQLSNLFRKE |
| Ga0132257_1037756632 | 3300015373 | Arabidopsis Rhizosphere | MNKRFLLAWLIVFVLWMIGSFLIHGLALHADYEAVQNLFRTPAE |
| Ga0132255_1049059462 | 3300015374 | Arabidopsis Rhizosphere | MNKRFFIGWLVIFIAWFIGSFVVHGLLLHNDYAALGNLF |
| Ga0163161_102031011 | 3300017792 | Switchgrass Rhizosphere | MNKTFFIAWIVIFVAWFAGSFVVHGTLLHDDYMKLFGLFRPA |
| Ga0187785_101727571 | 3300017947 | Tropical Peatland | MDKRFFIAWIVIFVAWFAGSFVVHGVLLHDDYAKLTSLFRSEAESQPF |
| Ga0187782_111634632 | 3300017975 | Tropical Peatland | MNKKFGIAWIVVFIVWFLGDFIVHGVLLSADYMQLSSLYRPASDAQR |
| Ga0184627_101466391 | 3300018079 | Groundwater Sediment | MNKKFIISWLVVFVAWMVGSFVVHGVLLHDDYAKLPGLFRPETEAQQ |
| Ga0193733_11524502 | 3300020022 | Soil | MNKKFFIAWIVVFVAWMAGSFVVHGVLLHDDYLRLSNLFRTEADAQRYF |
| Ga0179594_101915532 | 3300020170 | Vadose Zone Soil | MNKKFVIAWIVLLIAWFAGSFVVHGVLLRSDYMQLTNLFRV |
| Ga0210395_112589792 | 3300020582 | Soil | MNKKFIIAWIVLFVAWFMGSFVVHGVLLQPDYMQL |
| Ga0210396_103004692 | 3300021180 | Soil | MNKKFLIAWVVLFIAWFIGSFVVHGVLLSADYMQLTS |
| Ga0210388_105689432 | 3300021181 | Soil | MNKKFLIAWVVLFIAWFIGSFVVHGVLLSADYMQLTSL |
| Ga0210393_103353013 | 3300021401 | Soil | MNKKFLFAWIVLFVAWFLGSFVVHGVLLRSDYMQLTNLFR |
| Ga0210386_107535701 | 3300021406 | Soil | MNKKLIIAWIVLFVAWFMGSFVVHGVLLRPDYMQLTNLFRTEGDEQQH |
| Ga0193750_10579231 | 3300021413 | Soil | MNKKFFIAWIVLFIAWFLGSFVVHGVLLHDDYARLTN |
| Ga0210384_100863453 | 3300021432 | Soil | VNRKFFIAWIVLFVAWFIGSFIVHGVLLHSDYLQLTGLFRT |
| Ga0210402_109526101 | 3300021478 | Soil | MNKKFVIGWVVIFIAWFLGSFVVHGMLLHSDYMQVHT |
| Ga0126371_119600591 | 3300021560 | Tropical Forest Soil | MNKFLLAWIVIFICWFAGSYVVHGVLLHDDYAKLTNLFRAP |
| Ga0126371_134712101 | 3300021560 | Tropical Forest Soil | VNKQFFIAWVVLFIAWFLGSYVVHGVLLHDDYSRLNNLFRSESESQVFF |
| Ga0212124_102625993 | 3300022553 | Freshwater | MNKKFFIAWAVIFVAWMMGSFVVHATLLAADYAKLT |
| Ga0247796_11036842 | 3300023261 | Soil | MNRKFFIAWIVLFVAWFAGSFVVHGLLLGGDYKALQGT |
| (restricted) Ga0255056_102678432 | 3300024521 | Seawater | VNKKFLISWAVIFVAWMAGSFVVHGVLLQAGYAGLPNLFRPEEDAQKYFHLMLIAHVL |
| Ga0209584_101791141 | 3300025878 | Arctic Peat Soil | MSKKFFIAWVVIFIVWFAGSFVVHGVLLHDDYAKSASLFRTEADSQSYF |
| Ga0207642_111276391 | 3300025899 | Miscanthus Rhizosphere | MNKTFFIAWVVIFVAWFAGSFVVHGTLLHDDYMKLSGLFRP |
| Ga0207680_104069382 | 3300025903 | Switchgrass Rhizosphere | MDKKFIIAWIVIFVACFLGGFIVHGLLLHSDYMQI |
| Ga0207699_100157819 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKFFIAWVAIFVAWMAGSFVVHGMLLHDDYAKLSG |
| Ga0207663_104382921 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKKFVIAWIVLFVAWFMGSFIVHGLLLHSAYMQLTDLFRPE |
| Ga0207659_112160272 | 3300025926 | Miscanthus Rhizosphere | MNRRFFIAWIVLFVAWFAGSFVVHGLLLGGDYKALQGTLFRTEEDS |
| Ga0207700_107837323 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKKFFIAWVVIFVAWMAGSFVVHGVLLHDDYTKLSGLFR |
| Ga0207704_105903662 | 3300025938 | Miscanthus Rhizosphere | MNKKFLIAWLVMFVLYFAFGFIVHGVLLHDDYVAT |
| Ga0207668_107849063 | 3300025972 | Switchgrass Rhizosphere | MNRRFFIAWIVLFVAWFAGSFVVHGMLLGNDYKALQGQLFRTE |
| Ga0207675_1007036083 | 3300026118 | Switchgrass Rhizosphere | MNKRFFIAWIVLFVAWFAGSFVVHGLLLGGDYKPLQGTLFRTEAD |
| Ga0209686_12264511 | 3300026315 | Soil | MSKRFFLAWLVVFIAWFIGSFIVHGVLLHADYSQLSTLF |
| Ga0209806_13428682 | 3300026529 | Soil | MSKRFFLAWLVVFIAWFIGSFIVHGVLLHADYAQLSNLFRKE |
| Ga0209056_104132491 | 3300026538 | Soil | MNKKLIIAWIVIFVAWMCGSFVVHGVLLHDEYARLTNLFRPEADAQKY |
| Ga0179587_109206781 | 3300026557 | Vadose Zone Soil | MSKKFIIAWIVLFVAWLLGDFVVHGVLLRSDYMQLTNLF |
| Ga0209523_10719562 | 3300027548 | Forest Soil | VNKKLIIAWIVIFVAWFLGSFLVHGVLLNADYTRLGGTLFRTPA |
| Ga0209420_10307153 | 3300027648 | Forest Soil | MNKKLIIAWIVLFIAWFVGSFVVHGMLLRTDYMQL |
| Ga0209009_11525511 | 3300027667 | Forest Soil | MNKKFIVAWLVLFVAWFMGSFVVHGLLLRSDYMQLPNLFRAEGEE |
| Ga0209797_101286062 | 3300027831 | Wetland Sediment | MDKKFFIAWAVVFVTWMLGSFLVHGVLLHDDYAKLQ |
| Ga0209180_103125742 | 3300027846 | Vadose Zone Soil | MNKKLIIAWIVLFIAWFIGSFVVHGVLLHSDYMQLTNLFRAE |
| Ga0209169_106094272 | 3300027879 | Soil | VNRKFIIAWIVILVAWFLGSFLVHGVLLGADYKALGALFRT |
| Ga0209481_100896291 | 3300027880 | Populus Rhizosphere | MDRRFFIAWVVLFVAWMAGSFVVHELLLHADYTQLSSLFRPE |
| Ga0247663_11085581 | 3300028145 | Soil | MNKKLIIAWIVIFVAWLMGSFVIHGVLLRPDYMQLTGLFRSD |
| Ga0268264_102304571 | 3300028381 | Switchgrass Rhizosphere | MNKTFFIAWVVIFFAWFAGSFVVHGTLLHDDYMKLSGLFRPAAEAQPYFPLMVLA |
| Ga0137415_102827183 | 3300028536 | Vadose Zone Soil | MNNKLIVAWLVVFVAWFIGSFIVHGVLLHSDYLQLTSLFRTEADE |
| Ga0247820_100360027 | 3300028597 | Soil | MSRKFFIAWVVLFVAWMAGSVVVHGMLLHTDYAKLTATIMRPEA |
| Ga0265303_106271861 | 3300028600 | Sediment | MNKGFFLSWVVVFIVWMAGSFVVHGVWLNDAYAQLPDLFRTETETQEK |
| Ga0302219_103287121 | 3300028747 | Palsa | MNKKFILAWVVLFVAWFMGSFVVHGLLLHSDYMLLTSLFRTESDAHSYF |
| Ga0302231_100328601 | 3300028775 | Palsa | MNKKFVVAWIVLLVAWFLGSFVVHGVLLHSDYMQLPNLFRAEDVA |
| Ga0311369_115227161 | 3300029910 | Palsa | MNKKFIIAWIVLFVVWFLGSFVVHGVLLRSDYMQLTNLFRTEG |
| Ga0311371_110145961 | 3300029951 | Palsa | MNKKFIIAWIVVLVAWFLGSFVVHAVLLRADYMQLTTLFRAEGD |
| Ga0302302_11501242 | 3300029997 | Palsa | MNRKLIVAWVVVFIAWFMGSFVVHGVLLHADYMQVPTLF |
| Ga0311339_108140991 | 3300029999 | Palsa | MNKRFLFAWIGVFIVWFIGSFVVHGVLLHDDYMQLP |
| Ga0265460_124699392 | 3300030740 | Soil | MNKKFLIAWLVLFVAWFLGSFVVHGVLLHSDYMQMSQLFRPESDQT |
| Ga0265461_122250961 | 3300030743 | Soil | MNKKLIIAWAVLFVAWLMGSFVVHGVLLRSDYMQLTNLF |
| Ga0075384_112330441 | 3300030841 | Soil | MNKKFVMAWIVLFVAWFMGSFIVHGLLLRSAYMQLTDLFRPEGE |
| Ga0170823_153658111 | 3300031128 | Forest Soil | MNKKFVIAWIVLFVAWFMGSFIVHGLLLHSAYMQLTDLFR |
| Ga0302325_106622831 | 3300031234 | Palsa | MNKKFVVAWIVLFVAWFLGSFVVHGVLLHSDYMQLPNLFRAEDVARKYFP |
| Ga0302325_124514802 | 3300031234 | Palsa | MNKKFAVAWLVLFVAWFLGSFAVHGILLRSDYMQLTNLFR |
| Ga0302324_1013400602 | 3300031236 | Palsa | MNKKFIIAWVVLFVAWFVGSFVVHGVLLHGDYMQLTNLFRPESEQQTYFP |
| Ga0302324_1027313682 | 3300031236 | Palsa | MNKKFIIAWIVLFIAWFTGSFVVHGVLLSSDYMQLT |
| Ga0265316_107701251 | 3300031344 | Rhizosphere | MNKKFFLAWLVVFIVWFLGSFVVHGVLLDADYMKLTSLFRTKA |
| Ga0265342_106554541 | 3300031712 | Rhizosphere | MNKKLMIAWIVLFVAWFLGSFVVHGLLLRSDYMQLTS |
| Ga0307476_109945432 | 3300031715 | Hardwood Forest Soil | MNKKFLVAWVVLFVAWFIGSFVVHGVLLRADYMQLTNLF |
| Ga0310813_101738192 | 3300031716 | Soil | MNKTLGLAWLAVFVVWFIGSFVVHGLLLHADYMQLQGLFR |
| Ga0306917_101174731 | 3300031719 | Soil | MNKFLMAWIVIFICWFAGSYAVHGVLLQDDYAKLTN |
| Ga0307468_1000566191 | 3300031740 | Hardwood Forest Soil | MNKKFFIAWVVIFIVWFAGSFVVHGVLLHDDYAKLQATGLFRTEAESQQFFPI |
| Ga0318526_104201261 | 3300031769 | Soil | MSKKFLIAWIVIFVAWFAGSFVVHGQLLHDDYSRLTNLFR |
| Ga0315288_112299321 | 3300031772 | Sediment | MSKKFIVAWVITFVAWMFGSFVVHGLLLGADYARLSN |
| Ga0307478_114423281 | 3300031823 | Hardwood Forest Soil | LNKKFFIAWIVLFVAWFIGSFIVHGVLLGPDYMHLNNLFR |
| Ga0307479_108554792 | 3300031962 | Hardwood Forest Soil | MDRKMIIAWIVLFFAWFVGSFVVHGVLLHSDYSQLTNLFRPEAEAQQYFP |
| Ga0315278_106733641 | 3300031997 | Sediment | MKGKFFLGWVVVFVVWMAGSFVVHEKLLHADYAGLP |
| Ga0306922_122983472 | 3300032001 | Soil | MNKFLMAWIVIFICWFAGSYAVHGVLLQDDYAKLTNLFR |
| Ga0318506_104080571 | 3300032052 | Soil | MNKFLLAWIVVFVCWFAGSYVVHGVLLNDDYAKLTNLF |
| Ga0307470_100026161 | 3300032174 | Hardwood Forest Soil | MNKKFIIAWIVLFVAWFMGSFVVHGVLLHSDYMQLTSLFRAE |
| Ga0307471_1000285207 | 3300032180 | Hardwood Forest Soil | VNKKLIIAWIVIFVAWFLGSFVVHGVLLNADYTRLGGT |
| Ga0307471_1005979871 | 3300032180 | Hardwood Forest Soil | MNKRFALAWLAIFIAWFIGSYVVHQVLLHEDYMAAKTLFRPEAE |
| Ga0307471_1023678642 | 3300032180 | Hardwood Forest Soil | MNKKLIIAWIVIFIAWFAGSFVVHGVLLHDDYMKLPTLFRPEADAQ |
| Ga0307472_1006068613 | 3300032205 | Hardwood Forest Soil | MNRKFFVAWVVIFIVWFLGSYVVHGLLLHDDYMKLQSLFRPQDEAHQLFPLMILAHLLLSGSFV |
| Ga0307472_1007113531 | 3300032205 | Hardwood Forest Soil | MNRKFVIAWIVIFVAWFLGSFVVHGVLLSADYTRLGGLFRAPADS |
| Ga0307472_1012479921 | 3300032205 | Hardwood Forest Soil | MNKKFLIAWLVIFVLWMIGGFVVHGTLLSADYEAMGN |
| Ga0306920_1008815653 | 3300032261 | Soil | MSKKFLIAWIVIFVAWFAGSFVVHGQLLHDDYSRLTNLFRKEADSQQFFP |
| Ga0335080_112889711 | 3300032828 | Soil | MNTKFLAAWIVLFVAWFLGSFVVHGVLLGPDYARLSNLF |
| Ga0335071_103665583 | 3300032897 | Soil | MNRRFFTGWVVVFVAWMMGSFVVHGVLLREDYAQL |
| Ga0316620_126043751 | 3300033480 | Soil | MIRKFAIAWVLVFVVWMAGSFVVHATLLHDDYARLQTMFRT |
| Ga0370515_0095081_2_112 | 3300034163 | Untreated Peat Soil | MNKKFIIAWIVLFVAWFLGSFVVHGVLLQPDYMQLTN |
| ⦗Top⦘ |