


| Basic Information | |
|---|---|
| Family ID | F045268 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 40 residues |
| Representative Sequence | THVKVTHSGLADLPIARKDYSGGWPGVVEMLKKFVEK |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.61 % |
| % of genes near scaffold ends (potentially truncated) | 86.93 % |
| % of genes from short scaffolds (< 2000 bps) | 90.85 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.850 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.876 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.980 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF08327 | AHSA1 | 64.71 |
| PF01174 | SNO | 7.84 |
| PF00919 | UPF0004 | 5.88 |
| PF07238 | PilZ | 3.27 |
| PF04055 | Radical_SAM | 1.31 |
| PF02604 | PhdYeFM_antitox | 0.65 |
| PF01734 | Patatin | 0.65 |
| PF01242 | PTPS | 0.65 |
| PF11645 | PDDEXK_5 | 0.65 |
| PF00383 | dCMP_cyt_deam_1 | 0.65 |
| PF01938 | TRAM | 0.65 |
| PF04168 | Alpha-E | 0.65 |
| PF00392 | GntR | 0.65 |
| PF02463 | SMC_N | 0.65 |
| PF13744 | HTH_37 | 0.65 |
| PF01850 | PIN | 0.65 |
| PF13414 | TPR_11 | 0.65 |
| PF05988 | DUF899 | 0.65 |
| PF00677 | Lum_binding | 0.65 |
| PF01613 | Flavin_Reduct | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 7.84 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 7.84 |
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 5.88 |
| COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 0.65 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.65 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.65 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.65 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.65 |
| COG2307 | Uncharacterized conserved protein, Alpha-E superfamily | Function unknown [S] | 0.65 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.65 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.65 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.65 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.85 % |
| Unclassified | root | N/A | 9.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100941843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100438051 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101011003 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300004152|Ga0062386_100350112 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300004152|Ga0062386_100737473 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300005166|Ga0066674_10531983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300005184|Ga0066671_10780224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 612 | Open in IMG/M |
| 3300005436|Ga0070713_100188779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1856 | Open in IMG/M |
| 3300005444|Ga0070694_101940275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005541|Ga0070733_10699101 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300005542|Ga0070732_10766789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005542|Ga0070732_11039390 | Not Available | 501 | Open in IMG/M |
| 3300005555|Ga0066692_10657016 | Not Available | 653 | Open in IMG/M |
| 3300005586|Ga0066691_10953310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300005843|Ga0068860_100319096 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
| 3300005995|Ga0066790_10137726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1046 | Open in IMG/M |
| 3300006028|Ga0070717_10186209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1812 | Open in IMG/M |
| 3300006031|Ga0066651_10181003 | Not Available | 1112 | Open in IMG/M |
| 3300006031|Ga0066651_10230776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 981 | Open in IMG/M |
| 3300006032|Ga0066696_10283534 | Not Available | 1074 | Open in IMG/M |
| 3300006059|Ga0075017_100720201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300006102|Ga0075015_100629734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300006162|Ga0075030_101048088 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006174|Ga0075014_100807043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300006354|Ga0075021_10086938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1844 | Open in IMG/M |
| 3300006354|Ga0075021_10760069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300009029|Ga0066793_10865365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009090|Ga0099827_10519259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
| 3300009520|Ga0116214_1120469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300009520|Ga0116214_1259304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 661 | Open in IMG/M |
| 3300009635|Ga0116117_1029101 | Not Available | 1373 | Open in IMG/M |
| 3300009700|Ga0116217_10524994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300009824|Ga0116219_10518639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300009826|Ga0123355_11541575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300009839|Ga0116223_10045244 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
| 3300010043|Ga0126380_11023300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300010048|Ga0126373_11210367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300010048|Ga0126373_12735931 | Not Available | 550 | Open in IMG/M |
| 3300010323|Ga0134086_10010815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2810 | Open in IMG/M |
| 3300010361|Ga0126378_11444185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300010366|Ga0126379_11896170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300010375|Ga0105239_10585440 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300010376|Ga0126381_104698546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300011119|Ga0105246_12343102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300012201|Ga0137365_10760635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300012205|Ga0137362_11277836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300012209|Ga0137379_11175168 | Not Available | 674 | Open in IMG/M |
| 3300012359|Ga0137385_11256254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300012363|Ga0137390_10208202 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300012917|Ga0137395_10553700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300012944|Ga0137410_11684459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300013307|Ga0157372_13057201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300014150|Ga0134081_10087776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 967 | Open in IMG/M |
| 3300014153|Ga0181527_1291576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 646 | Open in IMG/M |
| 3300014638|Ga0181536_10284827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. Ant17 | 775 | Open in IMG/M |
| 3300015241|Ga0137418_10560005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300017822|Ga0187802_10346351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300017823|Ga0187818_10340407 | Not Available | 661 | Open in IMG/M |
| 3300017930|Ga0187825_10107733 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300017932|Ga0187814_10362133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300017934|Ga0187803_10414789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300017936|Ga0187821_10278156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300017938|Ga0187854_10196422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300017948|Ga0187847_10504784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300017955|Ga0187817_10991916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300017972|Ga0187781_11062095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 593 | Open in IMG/M |
| 3300017975|Ga0187782_10568741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300017975|Ga0187782_11241880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300017975|Ga0187782_11417938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300017995|Ga0187816_10519308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300018042|Ga0187871_10089394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1786 | Open in IMG/M |
| 3300018062|Ga0187784_11157222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 614 | Open in IMG/M |
| 3300018090|Ga0187770_10972589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300019887|Ga0193729_1056121 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300020021|Ga0193726_1009448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5334 | Open in IMG/M |
| 3300020199|Ga0179592_10177895 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300020581|Ga0210399_10015394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6034 | Open in IMG/M |
| 3300021171|Ga0210405_11165211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300021171|Ga0210405_11214730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300021171|Ga0210405_11356142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300021178|Ga0210408_11025142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300021404|Ga0210389_11003418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300021405|Ga0210387_10521238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300021406|Ga0210386_11358985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300021407|Ga0210383_10284287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
| 3300021407|Ga0210383_10785485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300021420|Ga0210394_10422060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
| 3300021420|Ga0210394_11443421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300021433|Ga0210391_10244876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
| 3300021559|Ga0210409_10736785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300022557|Ga0212123_10103418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
| 3300023090|Ga0224558_1053913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1619 | Open in IMG/M |
| 3300024251|Ga0247679_1072491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300025507|Ga0208188_1126740 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025911|Ga0207654_11098951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300025927|Ga0207687_11305195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300025949|Ga0207667_11250745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300026088|Ga0207641_11427893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300026095|Ga0207676_10548889 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300026277|Ga0209350_1034241 | Not Available | 1507 | Open in IMG/M |
| 3300026314|Ga0209268_1071641 | Not Available | 1038 | Open in IMG/M |
| 3300026318|Ga0209471_1028283 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
| 3300026324|Ga0209470_1048166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2068 | Open in IMG/M |
| 3300026326|Ga0209801_1129224 | Not Available | 1079 | Open in IMG/M |
| 3300026330|Ga0209473_1204463 | Not Available | 744 | Open in IMG/M |
| 3300027625|Ga0208044_1194550 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027641|Ga0208827_1175170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300027652|Ga0209007_1162762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027729|Ga0209248_10167036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027738|Ga0208989_10004903 | All Organisms → cellular organisms → Bacteria | 4487 | Open in IMG/M |
| 3300027812|Ga0209656_10044374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2552 | Open in IMG/M |
| 3300027824|Ga0209040_10476505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300027853|Ga0209274_10479583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300027854|Ga0209517_10511002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300027879|Ga0209169_10357180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300027882|Ga0209590_10362310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300027894|Ga0209068_10051722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2086 | Open in IMG/M |
| 3300027894|Ga0209068_10358812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300027911|Ga0209698_10190529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
| 3300028381|Ga0268264_11312511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300028747|Ga0302219_10417052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300028882|Ga0302154_10194261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300028882|Ga0302154_10414261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300029636|Ga0222749_10467771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300029636|Ga0222749_10526626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300029907|Ga0311329_10312879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1135 | Open in IMG/M |
| 3300029990|Ga0311336_11280754 | Not Available | 641 | Open in IMG/M |
| 3300030007|Ga0311338_11699701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300030707|Ga0310038_10153850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum | 1140 | Open in IMG/M |
| 3300030940|Ga0265740_1015349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300031128|Ga0170823_15884708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300031231|Ga0170824_116182386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300031474|Ga0170818_100794133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300031715|Ga0307476_10264749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300031720|Ga0307469_12299811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031753|Ga0307477_10396816 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300031781|Ga0318547_10364548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300031954|Ga0306926_11347735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300032001|Ga0306922_11594412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300032180|Ga0307471_102908091 | Not Available | 608 | Open in IMG/M |
| 3300032783|Ga0335079_10036137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5672 | Open in IMG/M |
| 3300032783|Ga0335079_10120307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2964 | Open in IMG/M |
| 3300032783|Ga0335079_11003515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300032805|Ga0335078_11434298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300032828|Ga0335080_10104146 | All Organisms → cellular organisms → Bacteria | 3149 | Open in IMG/M |
| 3300032828|Ga0335080_11235673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300032954|Ga0335083_10685843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300032955|Ga0335076_10045453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4371 | Open in IMG/M |
| 3300032955|Ga0335076_10406426 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300033402|Ga0326728_10239059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1751 | Open in IMG/M |
| 3300033412|Ga0310810_11216913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300033433|Ga0326726_10688210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300033475|Ga0310811_11051298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.31% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.65% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1009418432 | 3300000955 | Soil | GSGTHVRVTHSGLTNLPVARKDYTGGWPEVVEMLKKFVEVKH* |
| JGIcombinedJ26739_1004380511 | 3300002245 | Forest Soil | KSTGTLVKVTHSGLTQLPIARRDYTGGWPGVLEMLKKFAEDKNS* |
| JGIcombinedJ26739_1010110031 | 3300002245 | Forest Soil | TEDGTHVKVIHSGLAEEPLARKGYSGGWPGVVELLKKFVEK* |
| Ga0062386_1003501123 | 3300004152 | Bog Forest Soil | LSPQRGGTHVKVTHSGLASLPVARKDYSSGWPGVVEQLKKFVEG* |
| Ga0062386_1007374732 | 3300004152 | Bog Forest Soil | TASGTHVKVTHSGLSSEPAARKDYSGGWPGVVESLKNFVETGKAAV* |
| Ga0066674_105319831 | 3300005166 | Soil | WELNRTQSGTVVKVTHSGLAQEDVARKDYTGGWTGVLELLRRHVEK* |
| Ga0066671_107802241 | 3300005184 | Soil | AQEQGTHVKVTHSGLSNLPIARKDYSGGWPGVVEMLKKFIEQ* |
| Ga0070713_1001887792 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPFGDKTRLKITHSGLTADLETRKDYIGGWPGVVQYLKNFVER* |
| Ga0070694_1019402752 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | KTGTRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE* |
| Ga0070733_106991012 | 3300005541 | Surface Soil | LTSVPGGTHVRVTHSGLTALPIARKDYAGGWPGVVEQLKKFVEAGM* |
| Ga0070732_107667891 | 3300005542 | Surface Soil | TKGGTHVKVTHSGLASLPIARKDYAGGWPEVVEQLKKFLEK* |
| Ga0070732_110393902 | 3300005542 | Surface Soil | LSAESGGTHVKVTHSGLANEAVARKDYSSGWTGVMQYLKKFVEK* |
| Ga0066692_106570162 | 3300005555 | Soil | VKVTHSGLSEQPIARKDYSGDWPGVLELLQKYCEQK* |
| Ga0066691_109533102 | 3300005586 | Soil | VKVTHSGLSEQPIARKDYRGDWPGVLELLQKYCEQK* |
| Ga0068860_1003190963 | 3300005843 | Switchgrass Rhizosphere | RVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE* |
| Ga0066790_101377261 | 3300005995 | Soil | TKTGTRVKVTHSGLSEENAARKDYSNGWPGVMEMLKKFVEK* |
| Ga0070717_101862091 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GGTRVKVTHSGLATLPVAGKDYSGGWVGVVEQLKNFVERK* |
| Ga0066651_101810032 | 3300006031 | Soil | VKVTHSGLSEQPIARKDYSGGWPGVLDLLQKYCEQK* |
| Ga0066651_102307761 | 3300006031 | Soil | VKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEQK* |
| Ga0066696_102835342 | 3300006032 | Soil | VKVTHSDLSEQPIARKDYSGGWPGVLELLQKYCEQK* |
| Ga0075017_1007202011 | 3300006059 | Watersheds | LVRVTHSGLTDLPVSRKDYSGGWPGVVEQLKKFIEG* |
| Ga0075015_1006297342 | 3300006102 | Watersheds | ANGTHVKVTHSGLADEPAARKDYSGGWVGVVKALKQFVEQGSTEH* |
| Ga0075030_1010480882 | 3300006162 | Watersheds | LTPSEGGTMVRVTHSGLADLAVAREDYSGGWPGVLNYLKNFSER* |
| Ga0075014_1008070431 | 3300006174 | Watersheds | THVKVTHSGLSSEPESRKAYAGGWPGVLESLKSFTEGAKA* |
| Ga0075021_100869382 | 3300006354 | Watersheds | VKVTHSGLAQEAVCRKDYSGGWPGVMELLKKFVEQ* |
| Ga0075021_107600691 | 3300006354 | Watersheds | LTPVANGTRVKVTHSGLVQDPVSRKDYSGGWPGVVEKLKEFVEHTFLADRKD* |
| Ga0066793_108653651 | 3300009029 | Prmafrost Soil | TPKAGGTLVKVTHSGLTHLPIARKDYTGGWPGVVEMLKKFVES* |
| Ga0099827_105192591 | 3300009090 | Vadose Zone Soil | VKVTHSGLSDQPIARKDYSVGWPGVLDLLQKYCEQK* |
| Ga0116214_11204693 | 3300009520 | Peatlands Soil | QVKVHPSRLAQEAVARKDYRGGWAGVVELLKKFVENK* |
| Ga0116214_12593042 | 3300009520 | Peatlands Soil | HSGLAQEPEARKDYSGGWPGVVGKLKQFAETGKA* |
| Ga0116117_10291011 | 3300009635 | Peatland | KVIHSGLAQESVAREGYSGGWPGVLERLKHFTEK* |
| Ga0116217_105249941 | 3300009700 | Peatlands Soil | SGGTHVKVTHSGLATMPVARKDYSGGWPGVVEMLKTFVEKK* |
| Ga0116219_105186391 | 3300009824 | Peatlands Soil | TKDGTHVKVTHSGLAQEAVARKDYSGGWPGVVESLKKFVEK* |
| Ga0123355_115415752 | 3300009826 | Termite Gut | TPNSEGTHVRVTHSGLGTLPIARQDYSQGWPGVVVMLKEFVEK* |
| Ga0116223_100452445 | 3300009839 | Peatlands Soil | PAGAGTHVKVTHSGLVSEPAARKDYSGGWPGALDSLKKFVENKVEQ* |
| Ga0126380_110233002 | 3300010043 | Tropical Forest Soil | LAASKGGTLVRVTHSGLADLPVARKDYSGGWPGVLRDLKKFVEK* |
| Ga0126373_112103671 | 3300010048 | Tropical Forest Soil | KGGTLLRITHSGLAELTISRKDYAGGWPGVVAQLKAFIEDGLGV* |
| Ga0126373_127359311 | 3300010048 | Tropical Forest Soil | ASRGGTLVRVTHSGLADLPVARKDYSSGWPGVVEQLKKFVEK* |
| Ga0134086_100108151 | 3300010323 | Grasslands Soil | HVKVTHSGLSEQPIARKDYSGDWPGVLELLQKYCEQK* |
| Ga0126378_114441851 | 3300010361 | Tropical Forest Soil | GTHVKVTHSGLADLPAARKDYSGGWTGVVEKLKQFVEV* |
| Ga0126379_118961701 | 3300010366 | Tropical Forest Soil | ANGTHVRVTHSGLSSLPVARKDYTGGWPGVVEQLKKFVEK* |
| Ga0105239_105854401 | 3300010375 | Corn Rhizosphere | GTRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE* |
| Ga0126381_1046985462 | 3300010376 | Tropical Forest Soil | THVKVTHSGLADLPIARKDYSGGWPGVVEMLKKFVEK* |
| Ga0105246_123431021 | 3300011119 | Miscanthus Rhizosphere | TVTHSGLAQEDVARKDYQGGWPGVVEQLKAYIEK* |
| Ga0137365_107606351 | 3300012201 | Vadose Zone Soil | HVKVTHSGLSDQPIARKDYSVGWPGVLDLLQKYCEQK* |
| Ga0137362_112778363 | 3300012205 | Vadose Zone Soil | KSTRVKVTHSGLAEEPTARKDYSGGWPGVVEYLKNFVEK* |
| Ga0137379_111751681 | 3300012209 | Vadose Zone Soil | VKVTHSGLSEQPIPRKDYSGGWPGVLELLQKYCEHK* |
| Ga0137385_112562542 | 3300012359 | Vadose Zone Soil | KVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEHK* |
| Ga0137390_102082021 | 3300012363 | Vadose Zone Soil | VKVTHSGLAEENVARKDYSGGWPGVLENLKTFAEK* |
| Ga0137395_105537001 | 3300012917 | Vadose Zone Soil | TGNPVKVTHSGLADQPIARKDYAGGWPGLLELLRKYCE* |
| Ga0137410_116844592 | 3300012944 | Vadose Zone Soil | GGTLVKVTHSGLAQEDVARKDYAGGWPGVMEQLKTYIEK* |
| Ga0157372_130572011 | 3300013307 | Corn Rhizosphere | GTRVKVTHSGLAKEAIVRKDYAGGWPGVLDKLRKHCE* |
| Ga0134081_100877761 | 3300014150 | Grasslands Soil | VKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEHK* |
| Ga0181527_12915761 | 3300014153 | Bog | THVKVTHSGLANLPIARKDYSSGWVGVLEMLKKFTEKGSG* |
| Ga0181536_102848271 | 3300014638 | Bog | LTPTASGTHVKVTHSGLAQEPEARKDYSGGWIGVVEKLRQFAETERCK* |
| Ga0137418_105600053 | 3300015241 | Vadose Zone Soil | RVTHSGLADLPVSRKDYSGGWPGVVEAIKKLVEGAQTT* |
| Ga0187802_103463511 | 3300017822 | Freshwater Sediment | PKSSGTHVKITHSGLATLPVARKDYSSGWPGVVEMLKKFVEN |
| Ga0187818_103404071 | 3300017823 | Freshwater Sediment | GTKLKVTHSGLAQESVARKDYSGGWVGVLQTLKKFVENK |
| Ga0187825_101077331 | 3300017930 | Freshwater Sediment | LKVTHSGLADLPVSRKDYADGWPGVLRSLKQFVETDPNSK |
| Ga0187814_103621331 | 3300017932 | Freshwater Sediment | TASGTHVKVTHSGLAQEATAREDYRGGWPGVVEQLKRFAEQRSAE |
| Ga0187803_104147892 | 3300017934 | Freshwater Sediment | TPAGAGTHVKVTHSGLAQEAVAREDYRGGWPGVVEKLKGFVEK |
| Ga0187821_102781561 | 3300017936 | Freshwater Sediment | RWELAASKGGTLVRVTQSGLSDLPVSRKDYSGGWPGVVEQLKKFIEG |
| Ga0187854_101964221 | 3300017938 | Peatland | HVKVTHSGLAKEAAARKDYSGGWLGVLENLKKFTES |
| Ga0187847_105047841 | 3300017948 | Peatland | PTATGTHVKVTHSGLATMPAARKDYSGGWTGVVAMLKKFVEN |
| Ga0187817_109919161 | 3300017955 | Freshwater Sediment | VKVTHTGLANLPVARKDYSGGWTGVVEKLKQFVEV |
| Ga0187781_110620951 | 3300017972 | Tropical Peatland | KAGGTHVKVTHSGLASLPIARKDYTGGWPGVVDMLKKFAEK |
| Ga0187782_105687411 | 3300017975 | Tropical Peatland | GSTHLKVTHSGLAKLPVARKDYSGGWPGVVAQLKNFVETQ |
| Ga0187782_112418802 | 3300017975 | Tropical Peatland | VKVTHSGLASLPVARKDYTGGWPGVLAMLKKFAEKQ |
| Ga0187782_114179381 | 3300017975 | Tropical Peatland | NGTHVKVTHNGLAQEPAAREDYRGGWVGVVEKLKKIAEKGRE |
| Ga0187816_105193082 | 3300017995 | Freshwater Sediment | ELTPEAGGTQVKVTHSGLGNLPIARKDYSGGWVGVLDMLKKHAEARS |
| Ga0187871_100893941 | 3300018042 | Peatland | VKVTHSGLATLPIARKDYSGGWTSVVEMLKKFIER |
| Ga0187784_111572221 | 3300018062 | Tropical Peatland | RVKVTHSGLAQENLARKDYSGGWPGVLEQLKQFVEGK |
| Ga0187770_109725891 | 3300018090 | Tropical Peatland | VTHSGLAGEPDAAKDYAGGWPGVLAELKKHFEVSG |
| Ga0193729_10561212 | 3300019887 | Soil | VKVTHSGLAQEPVARQDYSGGWPGVVEYLKNFVEK |
| Ga0193726_10094481 | 3300020021 | Soil | AGVTHVRVIHGGLAEQSVARKDYSGGWIGVLANLKKFAEW |
| Ga0179592_101778951 | 3300020199 | Vadose Zone Soil | LLRVTHSGLGDLPASRKDYSGGWPGVVEQIKKFIEG |
| Ga0210399_100153947 | 3300020581 | Soil | GGTLLRVTHSGLTGLPASRKDYAGGWPGVLEALKKFIERNSEV |
| Ga0210405_111652111 | 3300021171 | Soil | LATTKNGTHVKVTHSGLAQEAAARKDYNGGWPGVVEALKKFVEK |
| Ga0210405_112147301 | 3300021171 | Soil | SATRTGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRSHCE |
| Ga0210405_113561422 | 3300021171 | Soil | KAGGTHVKVTHSGLATLPIARKDYSGGWVGVVEQLKNFVEKK |
| Ga0210408_110251421 | 3300021178 | Soil | CVTGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRNHCA |
| Ga0210389_110034181 | 3300021404 | Soil | KSTGTLVKVTHSGLTQLPIARSDYTGGWPGVLEMLKKFAEDKNS |
| Ga0210387_105212381 | 3300021405 | Soil | GKNTHVKITHSGLAKLPAARKDYSGGWTGVMQSLKQFVETR |
| Ga0210386_113589852 | 3300021406 | Soil | PTPTGTHIKVTHSGLATEEVCRNDYANGWPGVLSSLKTFVEKSKS |
| Ga0210383_102842873 | 3300021407 | Soil | THVKVTHSGLAQESAARKDYSGGWPGVVQQLKKFVEK |
| Ga0210383_107854851 | 3300021407 | Soil | TPTKTGTQVKVKHSGLAQEEAARKDYSGGWPGVLEMLKNFAER |
| Ga0210394_104220603 | 3300021420 | Soil | HVKVTHSGLAQEAVARKDYSGGWPGVVEMLKKFVETK |
| Ga0210394_114434211 | 3300021420 | Soil | GTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRNHCE |
| Ga0210391_102448763 | 3300021433 | Soil | LGGTHVKVTFSGLKNLPIARKDYSGGWPGVLKMLKEFAEQ |
| Ga0210409_107367851 | 3300021559 | Soil | SKGGTLVRVTHSGLAELPVARKDYASGWPGILDQLKKFVED |
| Ga0212123_101034184 | 3300022557 | Iron-Sulfur Acid Spring | TPKSTGTLVKVTHSGLTQLPIARRDYTGGWPGVLEMLKKFAEDKNS |
| Ga0224558_10539132 | 3300023090 | Soil | LTPTASGTHVKVTHSGLAQEPEARKDYSGGWIGVVEKLKQFVETGKG |
| Ga0247679_10724911 | 3300024251 | Soil | ELTPTKSGTHVKVTHSGLTAEPVAFKDYAGGWPGVLQEIKIFAES |
| Ga0208188_11267401 | 3300025507 | Peatland | TASGTHVKVTHSCLAQEPAARADYSGGWPGVVEKLKLFAEKGTATLNPL |
| Ga0207654_110989512 | 3300025911 | Corn Rhizosphere | RVTVTHSGLRNQPKARADYSGGWPGVVHELKSYVET |
| Ga0207687_113051951 | 3300025927 | Miscanthus Rhizosphere | GTRVTVTHSGLRNQPKARADYSGGWPGVVHELKSYVET |
| Ga0207667_112507451 | 3300025949 | Corn Rhizosphere | IPGGTRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE |
| Ga0207641_114278932 | 3300026088 | Switchgrass Rhizosphere | LSATKTGTRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE |
| Ga0207676_105488891 | 3300026095 | Switchgrass Rhizosphere | TRVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE |
| Ga0209350_10342413 | 3300026277 | Grasslands Soil | VKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEQK |
| Ga0209268_10716413 | 3300026314 | Soil | VKVTHSGLSDQPIARKDYSGGWPGVLDLLQKYCEQK |
| Ga0209471_10282834 | 3300026318 | Soil | VKVTHSGLSEQPIARKDYSGGWPGVLELLQKYYEQK |
| Ga0209470_10481663 | 3300026324 | Soil | VKVTHSGLSEQPIARKDYSGGWPGVLELLQKYCEHK |
| Ga0209801_11292243 | 3300026326 | Soil | VKVTHSGRSEQPIARKDYSGGWPGVLELLQKYCEQK |
| Ga0209473_12044631 | 3300026330 | Soil | VKVTHSGLSEQPIARKDYSGDWPGVLELLQKYCEQK |
| Ga0208044_11945502 | 3300027625 | Peatlands Soil | GSGTKVKVTHSGLTKLPIARKDYSGGWPGVVQSLKKFVEKN |
| Ga0208827_11751702 | 3300027641 | Peatlands Soil | GTHVKVTHSGLAQEAVARKDYSGGWPGVVESLKKFVEK |
| Ga0209007_11627622 | 3300027652 | Forest Soil | TEDGTHVKVIHSGLAEEPLARKGYSGGWPGVVELLKKFVEK |
| Ga0209248_101670362 | 3300027729 | Bog Forest Soil | PTNDGTHVKVTHSGLAQEPVARKDYSGGWPGVVKLLKQFVEK |
| Ga0208989_100049037 | 3300027738 | Forest Soil | VKMTHIGLADLPIARKDYSGGWPGLIEQLKAHIEK |
| Ga0209656_100443741 | 3300027812 | Bog Forest Soil | VTHSGLSSEPVARKDYSGGWPGVVESLKNFVETGKAAV |
| Ga0209040_104765051 | 3300027824 | Bog Forest Soil | LSPQRGGTHVKVTHSGLASLPVARKDYSSGWPGVVEQLKKFVEG |
| Ga0209274_104795831 | 3300027853 | Soil | EGGTRVKVTHSGLAQESAARKDYSGGWPGVVELLKKFVEK |
| Ga0209517_105110021 | 3300027854 | Peatlands Soil | THSGLVSEPAARKDYSGGWPGALDSLKKFVENKVEQ |
| Ga0209169_103571801 | 3300027879 | Soil | SSTAAGTRVKVTHSGLATLPVARKDYSGGWTGVLDMLKQFTEKL |
| Ga0209590_103623101 | 3300027882 | Vadose Zone Soil | SSRAAGTGTHVKVTHSGLSDQPIARKDYSVGWPGVLDLLQKYCEQK |
| Ga0209068_100517221 | 3300027894 | Watersheds | PIAGTRVKVTHSGLADQPVARKDYVGGWPGLLILLRKYCE |
| Ga0209068_103588121 | 3300027894 | Watersheds | VKVTHSGLAQEAVCRKDYSGGWPGVMELLKKFVEQ |
| Ga0209698_101905294 | 3300027911 | Watersheds | GTHVRVTHSGLSNLPVARKDYSGGWPGVVEMLKKFVEGRA |
| Ga0268264_113125112 | 3300028381 | Switchgrass Rhizosphere | SATSNGTRVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE |
| Ga0302219_104170522 | 3300028747 | Palsa | PSGSGTHVRVTHSGLASEPAARSDYAGGWPGVLEEIKIFAEK |
| Ga0302154_101942611 | 3300028882 | Bog | ATASGTRVTVTHSGLAEEPESRKDYSGGWVGVMENLKKFVEDNLKDNF |
| Ga0302154_104142611 | 3300028882 | Bog | AAGTNVKVTHSGLAQENVARKDYSGGWPGVLEMLKQFAEK |
| Ga0222749_104677712 | 3300029636 | Soil | TGTRVKVTHSGLANEPIVRKNYAGGWPGVLEKLRNHCE |
| Ga0222749_105266261 | 3300029636 | Soil | VTHSGLTQLPIARRDYTGGWPGVLEMLKKFAEDRNS |
| Ga0311329_103128791 | 3300029907 | Bog | TRVKVIHSGLELEDAARKDYSSGWPGVMELLKKFVEA |
| Ga0311336_112807541 | 3300029990 | Fen | GTRVKVTHSGLATENVAREDYSGGWVGVLDMLKKHFQS |
| Ga0311338_116997011 | 3300030007 | Palsa | VKVTHRGLAREDVARKDYSGGWLGVLEMLRKFVET |
| Ga0310038_101538501 | 3300030707 | Peatlands Soil | TKVKVTHSGLTKLPIARKDYSGGWPGVVQSLKKFVEKN |
| Ga0265740_10153492 | 3300030940 | Soil | THVKVTHSGLAQEAVARKDYSGGWPGVVEMLKKFVETK |
| Ga0170823_158847081 | 3300031128 | Forest Soil | GTRVKVTHSGLSEENVARKDYSNGWPGVMEMLKKFVEK |
| Ga0170824_1161823862 | 3300031231 | Forest Soil | VKVTHSGLSQENAARKDYSNGWPGVVEMLKKFVER |
| Ga0170818_1007941331 | 3300031474 | Forest Soil | HVRVTHSGLGNLPVARKDYTGGWPEVVEMLKKFVEGRD |
| Ga0307476_102647493 | 3300031715 | Hardwood Forest Soil | HVRVTHSGLGSLPVARKDYAGGWPGVVEHLKKFIEQ |
| Ga0307469_122998111 | 3300031720 | Hardwood Forest Soil | QVKVKHSGLRNIPVARKDYSGGWIGVLDGLKAFVEK |
| Ga0307477_103968163 | 3300031753 | Hardwood Forest Soil | AASQGGTLVRVTHSGLTDLPVSRKDYSGGWPGVIEQLKKFVEQ |
| Ga0318547_103645481 | 3300031781 | Soil | KVTHSGLATEEVSRNDYANGWPGVLSCLQTFVEKSTS |
| Ga0306926_113477352 | 3300031954 | Soil | VKVTHSGLGDEEAARKDYGSGWPGAVKMLKSFVEANRGR |
| Ga0306922_115944122 | 3300032001 | Soil | THIKVTHSGLATEEVSRNDYANGWPGVLSCLQTFVEKSTS |
| Ga0307471_1029080911 | 3300032180 | Hardwood Forest Soil | AFKVTHSGLAQENVARKDYAGGWPGMLDQLKAFTEKG |
| Ga0335079_100361371 | 3300032783 | Soil | GTGTRVKVTHSGLASEGLARQDYIGGWPGVLDMLKKFTEK |
| Ga0335079_101203071 | 3300032783 | Soil | NGTHVKVTHSGLTNLPIARKDYSGGWPGVVEMLKKFAENN |
| Ga0335079_110035152 | 3300032783 | Soil | LTPKGSGTHVKVTHSGLTNLPIARKDYGGGWTGVVEMLKKFVEQ |
| Ga0335078_114342982 | 3300032805 | Soil | GGTHVKVTHSGLANESVARKDYSGGWVGVLDSLKKFVES |
| Ga0335080_101041464 | 3300032828 | Soil | GTHVKVTHSGLTNLPIARKDYSGGWPGVVEMLKKFAENN |
| Ga0335080_112356732 | 3300032828 | Soil | PTVAGTHVKVTHSGLAQEPVARKDYSGGWVGVLESLQKFSEETSIR |
| Ga0335083_106858432 | 3300032954 | Soil | EQGGTHVKVTHSGLASLPVARKDYSGGWLGVVEQLKKFVEQ |
| Ga0335076_100454539 | 3300032955 | Soil | SPRGTTVKVTHSGLTRLPVSRKDYSGGWPGVVESLKKFVEQLSR |
| Ga0335076_104064261 | 3300032955 | Soil | SAGGTQVKVTHSGLTHEPAACKDYSNGWPGVLSGLKAFIEK |
| Ga0326728_102390592 | 3300033402 | Peat Soil | THSGLANLPIARKDYSGGWVGVLDMLKKHAESSGQ |
| Ga0310810_112169132 | 3300033412 | Soil | RVKVTHSGLSNQPVVRDAYRGGWPGVISNLKKFVEE |
| Ga0326726_106882102 | 3300033433 | Peat Soil | VKVTHSGLAGEQVAREDYRSGWPGVVEKLKQFAETGKA |
| Ga0310811_110512981 | 3300033475 | Soil | RVKVTHSGLANEPIVRKDYAGGWPGVLEKLRKHCE |
| ⦗Top⦘ |