


| Basic Information | |
|---|---|
| Family ID | F045229 |
| Family Type | Metagenome |
| Number of Sequences | 153 |
| Average Sequence Length | 44 residues |
| Representative Sequence | HDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 94.12 % |
| % of genes from short scaffolds (< 2000 bps) | 89.54 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.346 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.072 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.608 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.170 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF02567 | PhzC-PhzF | 9.15 |
| PF04073 | tRNA_edit | 5.23 |
| PF11199 | DUF2891 | 3.92 |
| PF02558 | ApbA | 3.27 |
| PF12802 | MarR_2 | 1.96 |
| PF08546 | ApbA_C | 1.96 |
| PF05163 | DinB | 1.96 |
| PF00589 | Phage_integrase | 1.96 |
| PF08240 | ADH_N | 1.96 |
| PF13561 | adh_short_C2 | 1.31 |
| PF14833 | NAD_binding_11 | 1.31 |
| PF00266 | Aminotran_5 | 1.31 |
| PF03446 | NAD_binding_2 | 1.31 |
| PF12704 | MacB_PCD | 1.31 |
| PF07883 | Cupin_2 | 1.31 |
| PF01557 | FAA_hydrolase | 0.65 |
| PF04851 | ResIII | 0.65 |
| PF05016 | ParE_toxin | 0.65 |
| PF03781 | FGE-sulfatase | 0.65 |
| PF00156 | Pribosyltran | 0.65 |
| PF02633 | Creatininase | 0.65 |
| PF00595 | PDZ | 0.65 |
| PF01361 | Tautomerase | 0.65 |
| PF01850 | PIN | 0.65 |
| PF06580 | His_kinase | 0.65 |
| PF14329 | DUF4386 | 0.65 |
| PF00709 | Adenylsucc_synt | 0.65 |
| PF14707 | Sulfatase_C | 0.65 |
| PF12867 | DinB_2 | 0.65 |
| PF00326 | Peptidase_S9 | 0.65 |
| PF04397 | LytTR | 0.65 |
| PF00126 | HTH_1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 9.15 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.96 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.96 |
| COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.65 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.65 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.65 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.35 % |
| Unclassified | root | N/A | 0.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10000416 | All Organisms → cellular organisms → Bacteria | 10845 | Open in IMG/M |
| 3300001593|JGI12635J15846_10650243 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100048083 | All Organisms → cellular organisms → Bacteria | 3873 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100834331 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300002917|JGI25616J43925_10146914 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300004479|Ga0062595_101244828 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300004635|Ga0062388_101777349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300005175|Ga0066673_10118914 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300005332|Ga0066388_105077291 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005332|Ga0066388_106263032 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005332|Ga0066388_106517902 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005355|Ga0070671_100631747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
| 3300005440|Ga0070705_101629804 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005468|Ga0070707_101708366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300005535|Ga0070684_101467128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300005542|Ga0070732_10919445 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005549|Ga0070704_100764967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
| 3300005553|Ga0066695_10412754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300005557|Ga0066704_10335726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300005576|Ga0066708_10153955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1414 | Open in IMG/M |
| 3300005591|Ga0070761_10379832 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005602|Ga0070762_10427615 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005610|Ga0070763_10100086 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300006050|Ga0075028_100100576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1474 | Open in IMG/M |
| 3300006176|Ga0070765_100219422 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300006178|Ga0075367_10421220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
| 3300006755|Ga0079222_10565796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300006794|Ga0066658_10096933 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300006854|Ga0075425_100068960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3979 | Open in IMG/M |
| 3300009088|Ga0099830_11583399 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009137|Ga0066709_102829574 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300009177|Ga0105248_10547469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1305 | Open in IMG/M |
| 3300009551|Ga0105238_11450871 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300010046|Ga0126384_11809793 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010048|Ga0126373_11590587 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300010048|Ga0126373_11926195 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300010322|Ga0134084_10096057 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300010360|Ga0126372_11746169 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300010361|Ga0126378_12594695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 579 | Open in IMG/M |
| 3300010371|Ga0134125_10980186 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300012199|Ga0137383_10881278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300012202|Ga0137363_11167353 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012357|Ga0137384_10690465 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012917|Ga0137395_10713271 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012924|Ga0137413_11776369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. PAMC 26617 | 509 | Open in IMG/M |
| 3300012929|Ga0137404_10151883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1927 | Open in IMG/M |
| 3300012929|Ga0137404_10816647 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012929|Ga0137404_11700298 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012929|Ga0137404_12149365 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012930|Ga0137407_12129862 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012930|Ga0137407_12419290 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012944|Ga0137410_11072735 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300012948|Ga0126375_11060813 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012957|Ga0164303_10027036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2303 | Open in IMG/M |
| 3300012960|Ga0164301_11787904 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012986|Ga0164304_11112882 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300014495|Ga0182015_10870474 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300014501|Ga0182024_10167057 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300015054|Ga0137420_1412810 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300016341|Ga0182035_11457266 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300016387|Ga0182040_11745901 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300016404|Ga0182037_11211334 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300016404|Ga0182037_11260357 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300016445|Ga0182038_10720892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300016445|Ga0182038_10734655 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300017822|Ga0187802_10017690 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300017930|Ga0187825_10227129 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300017955|Ga0187817_10882752 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300017975|Ga0187782_10078336 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300017975|Ga0187782_10422453 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300017975|Ga0187782_11068601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300018009|Ga0187884_10341376 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300018032|Ga0187788_10032117 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300018058|Ga0187766_11082861 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018062|Ga0187784_10025032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4814 | Open in IMG/M |
| 3300018062|Ga0187784_10177383 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300018064|Ga0187773_11001525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. PAMC 26617 | 548 | Open in IMG/M |
| 3300020170|Ga0179594_10371640 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300020199|Ga0179592_10133426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300021168|Ga0210406_10581399 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300021170|Ga0210400_11470659 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300021180|Ga0210396_10508998 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300021181|Ga0210388_10065831 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
| 3300021402|Ga0210385_10368555 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300021407|Ga0210383_10372914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1231 | Open in IMG/M |
| 3300021433|Ga0210391_10090982 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300021560|Ga0126371_12697252 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021560|Ga0126371_13352627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 541 | Open in IMG/M |
| 3300022515|Ga0224546_1009047 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300022557|Ga0212123_10211516 | Not Available | 1427 | Open in IMG/M |
| 3300024225|Ga0224572_1011186 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300024330|Ga0137417_1023111 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300025905|Ga0207685_10152789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
| 3300025905|Ga0207685_10569034 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025916|Ga0207663_10162412 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300025922|Ga0207646_11927355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300025928|Ga0207700_11107198 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300025941|Ga0207711_10430023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OK091 | 1228 | Open in IMG/M |
| 3300026304|Ga0209240_1077989 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300026304|Ga0209240_1239649 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300026555|Ga0179593_1081607 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300026555|Ga0179593_1199349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4084 | Open in IMG/M |
| 3300026555|Ga0179593_1207592 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
| 3300027648|Ga0209420_1032169 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300027652|Ga0209007_1036177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1264 | Open in IMG/M |
| 3300027676|Ga0209333_1214030 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027745|Ga0209908_10182265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300027829|Ga0209773_10461619 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300027842|Ga0209580_10374519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300027857|Ga0209166_10520661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L60 | 610 | Open in IMG/M |
| 3300027867|Ga0209167_10786392 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300027879|Ga0209169_10043171 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
| 3300027884|Ga0209275_10303693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 886 | Open in IMG/M |
| 3300027884|Ga0209275_10306065 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 883 | Open in IMG/M |
| 3300028759|Ga0302224_10339305 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300028773|Ga0302234_10350822 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300028785|Ga0302201_10067007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1710 | Open in IMG/M |
| 3300028906|Ga0308309_10266861 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1437 | Open in IMG/M |
| 3300029882|Ga0311368_10220044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1489 | Open in IMG/M |
| 3300029910|Ga0311369_10339524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1325 | Open in IMG/M |
| 3300029911|Ga0311361_10400628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300029913|Ga0311362_10409410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300029944|Ga0311352_11158025 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300029951|Ga0311371_10917327 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300029993|Ga0302304_10175201 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300029999|Ga0311339_10539667 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300030580|Ga0311355_10835498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. PAMC 26617 | 842 | Open in IMG/M |
| 3300030617|Ga0311356_10361341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300030739|Ga0302311_10605776 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300030746|Ga0302312_10157782 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300031233|Ga0302307_10261580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300031234|Ga0302325_11413027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300031236|Ga0302324_103433976 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1016789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1747 | Open in IMG/M |
| 3300031545|Ga0318541_10867480 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031680|Ga0318574_10701478 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031708|Ga0310686_100510024 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300031708|Ga0310686_112500675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1105 | Open in IMG/M |
| 3300031747|Ga0318502_10142637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1362 | Open in IMG/M |
| 3300031747|Ga0318502_10628097 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031754|Ga0307475_11209088 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031771|Ga0318546_10196124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1378 | Open in IMG/M |
| 3300031823|Ga0307478_10265505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300031823|Ga0307478_11064881 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031890|Ga0306925_10470159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
| 3300031910|Ga0306923_12544863 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031912|Ga0306921_10114074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3143 | Open in IMG/M |
| 3300031942|Ga0310916_10486870 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300032074|Ga0308173_10436444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1160 | Open in IMG/M |
| 3300032076|Ga0306924_11939628 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032180|Ga0307471_100002957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9969 | Open in IMG/M |
| 3300032205|Ga0307472_101152887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300032898|Ga0335072_10988466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 774 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.07% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.65% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_100004168 | 3300001305 | Soil | MIPSEIHDMARYSSWMLLFNATDLYFDRQLNKRSAPSP* |
| JGI12635J15846_106502431 | 3300001593 | Forest Soil | EDLRSHNIDHDVIMIPNEIHEMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| JGIcombinedJ26739_1000480831 | 3300002245 | Forest Soil | XXIMIPNEIHVMARYSSWMILFNAADVYFDRHLDKRSAPAP* |
| JGIcombinedJ26739_1008343311 | 3300002245 | Forest Soil | VIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| JGI25616J43925_101469141 | 3300002917 | Grasslands Soil | DVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP* |
| Ga0062595_1012448281 | 3300004479 | Soil | HDVIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRSVPAP* |
| Ga0062388_1017773491 | 3300004635 | Bog Forest Soil | RSHNIDHDVIMIPNEIHVMVRYSSWMTLFNAADVYFDRHLDKRIAPTP* |
| Ga0066673_101189143 | 3300005175 | Soil | IMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP* |
| Ga0066388_1050772912 | 3300005332 | Tropical Forest Soil | EGLRSHNIDHDVIMIPNEIHDMARYSSWMLLFNAADLYFARHLDKRNAPAP* |
| Ga0066388_1062630321 | 3300005332 | Tropical Forest Soil | GLRSHNIDHDVIMIPNEIHDMARYASWMMLFNAADVYFDRHLNKRSAPGAP* |
| Ga0066388_1065179022 | 3300005332 | Tropical Forest Soil | EHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSASLRL* |
| Ga0070671_1006317471 | 3300005355 | Switchgrass Rhizosphere | VIMIPNEIHDMARYSSWMLLFNAADGYFDRHLDKRSVPAP* |
| Ga0070705_1016298041 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0070707_1017083662 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRNAPSPQADP* |
| Ga0070684_1014671281 | 3300005535 | Corn Rhizosphere | EGLRSHGVDHDVIMIPNEIHDMARYSSWMTLFDAAAAYFDRQLNR* |
| Ga0070732_109194452 | 3300005542 | Surface Soil | NEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP* |
| Ga0070704_1007649671 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRNVPAP* |
| Ga0066695_104127543 | 3300005553 | Soil | HDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP* |
| Ga0066704_103357261 | 3300005557 | Soil | IPNEIHDMARYSSWMMLFKAADAYFDRQLNKRSAPAP* |
| Ga0066708_101539551 | 3300005576 | Soil | HNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP* |
| Ga0070761_103798322 | 3300005591 | Soil | MIPNEIHVMARYASWMILFNATDVYFDRHLDKRSAPNP* |
| Ga0070762_104276152 | 3300005602 | Soil | NIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0070763_101000863 | 3300005610 | Soil | NEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP* |
| Ga0075028_1001005762 | 3300006050 | Watersheds | SHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0070765_1002194225 | 3300006176 | Soil | MIPNEIHEMARYSSWMTLFNAADVYFDRHLDKRSA |
| Ga0075367_104212202 | 3300006178 | Populus Endosphere | GSPLNIHDMARYSSSLFDAADVYFDRHLDKRSAPAL* |
| Ga0079222_105657962 | 3300006755 | Agricultural Soil | IMIPNEIHDMARYSSWMMLFNAADVYFDRQLNRRSAPSP* |
| Ga0066658_100969331 | 3300006794 | Soil | IDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0075425_1000689602 | 3300006854 | Populus Rhizosphere | MGSPLNIHDMARYSSSLFDAADVYFDRHLDKRSAPAL* |
| Ga0099830_115833991 | 3300009088 | Vadose Zone Soil | IDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPSP* |
| Ga0066709_1028295742 | 3300009137 | Grasslands Soil | HNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSASSP* |
| Ga0105248_105474693 | 3300009177 | Switchgrass Rhizosphere | HNIDHDVIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRNVPAP* |
| Ga0105238_114508712 | 3300009551 | Corn Rhizosphere | LEGLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0126384_118097931 | 3300010046 | Tropical Forest Soil | ELIEGLRSHDIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRRLNKRGAPSPQAGPSSRL* |
| Ga0126373_115905871 | 3300010048 | Tropical Forest Soil | IMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0126373_119261951 | 3300010048 | Tropical Forest Soil | IDHGVIMIPNEIHDLARYSSWLMLFNAAAVYFDQHLDKRTAPAP* |
| Ga0134084_100960572 | 3300010322 | Grasslands Soil | NEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0126372_117461691 | 3300010360 | Tropical Forest Soil | IMIPNEIHDMARYSSWMMLFNAADAYFDRHLDKRSAPAP* |
| Ga0126378_125946951 | 3300010361 | Tropical Forest Soil | IMIPNEIHDMARYSSWMLLFNAADVYFDRQLNKRSALAP* |
| Ga0134125_109801862 | 3300010371 | Terrestrial Soil | HDVIMIPNEIHDMARYSSWMMLFSAADVYFDRHLDQRSAPAP* |
| Ga0137383_108812781 | 3300012199 | Vadose Zone Soil | ELIEGLRSRRIDHDVIVIPNEIHDPARYSSWMMLFKAADAYFDRQLNKRSAPAP* |
| Ga0137363_111673531 | 3300012202 | Vadose Zone Soil | IMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPAP* |
| Ga0137384_106904651 | 3300012357 | Vadose Zone Soil | IDYDVIMIPNEIHVMARYSSWMTSFNATDAYFDRHLGKQTVPTP* |
| Ga0137395_107132711 | 3300012917 | Vadose Zone Soil | EIHDMARYSSWMMLFNAADVYFDQHLDKRSAPAP* |
| Ga0137413_117763691 | 3300012924 | Vadose Zone Soil | DHDVILIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP* |
| Ga0137404_101518831 | 3300012929 | Vadose Zone Soil | IMIPNEIHDLARYSSWMILFNAADVYFDRHLDKRSAPAP* |
| Ga0137404_108166472 | 3300012929 | Vadose Zone Soil | LRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0137404_117002981 | 3300012929 | Vadose Zone Soil | LIEGLRSHNIEHDVIMIPNEIHDMARYSSWMMLFNEADMYFDRHLDKRSAPSP* |
| Ga0137404_121493651 | 3300012929 | Vadose Zone Soil | VIMIPNEIHDMARYSSWMMLFNAADVYFDRQLDKRSTPAR* |
| Ga0137407_121298621 | 3300012930 | Vadose Zone Soil | IMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRRAPAP* |
| Ga0137407_124192902 | 3300012930 | Vadose Zone Soil | DVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0137410_110727351 | 3300012944 | Vadose Zone Soil | HDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0126375_110608131 | 3300012948 | Tropical Forest Soil | AELIEGLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFGRQLNKRSAPSP* |
| Ga0164303_100270364 | 3300012957 | Soil | HNIDHDVIMIPNEIHDMARYSSWMMLFRAADVYFDRHLDKRSVPAP* |
| Ga0164301_117879042 | 3300012960 | Soil | SHNIDHDVIMIPNEIHDMARYSSWMMLFNAADAYFDRHLDKRSAPAP* |
| Ga0164304_111128821 | 3300012986 | Soil | HNIDHDVIMIPNEIHDMARYSSWMMLFSAADVYFDRHLDQRSAPAP* |
| Ga0182015_108704741 | 3300014495 | Palsa | IPNEIHVMARYSSWMILFNAANVYFDRHLDKRSAPTP* |
| Ga0182024_101670576 | 3300014501 | Permafrost | SHNIDHDVIMIPNEIHDLARYSSWMTLFNAADVYFDRHLDKRSAPAP* |
| Ga0137420_14128101 | 3300015054 | Vadose Zone Soil | IEGLRSHNIDHDVIMIPNEIHDMARYSSWMMLLSWMMLFNAADVYFDRHLDKRSAPAP* |
| Ga0182035_114572662 | 3300016341 | Soil | ILIPNEIHDLARYSSWMMLFNAADVYFDRQLNRQNAPSL |
| Ga0182040_117459011 | 3300016387 | Soil | DLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL |
| Ga0182037_112113341 | 3300016404 | Soil | IPNEIHDLARYSSWMMLFNAADVYFDRQLNRQNAPSL |
| Ga0182037_112603573 | 3300016404 | Soil | HNIEHDVIMIPNEIHDLARYSSWMMLFDAADVYFGRQLNRRSAPSP |
| Ga0182038_107208922 | 3300016445 | Soil | IEGLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0182038_107346553 | 3300016445 | Soil | LARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL |
| Ga0187802_100176901 | 3300017822 | Freshwater Sediment | GLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0187825_102271292 | 3300017930 | Freshwater Sediment | LRSHNIDHDVIMIPNEIHDMARYSSWMMLFSAADVYFDRHLDQRSAPAP |
| Ga0187817_108827522 | 3300017955 | Freshwater Sediment | SHNIEHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSALSP |
| Ga0187782_100783365 | 3300017975 | Tropical Peatland | MIPNEIHDLARYSSWMMLFNAAAVYFDRHLDQRSVPAR |
| Ga0187782_104224531 | 3300017975 | Tropical Peatland | LIEDLRSHNIDHDVIVIPNEIHVMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0187782_110686011 | 3300017975 | Tropical Peatland | NEIHVMVRYSSWMMLFNAADVYFDRHLDKRSAPTP |
| Ga0187884_103413761 | 3300018009 | Peatland | QATELIEDLRSHNIDHDVIMIPNEIHVMARCSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0187788_100321171 | 3300018032 | Tropical Peatland | RNIEHDVIMIPNEIHDLARYSSWMTLFAAADVYFDRQLQQRSAPFP |
| Ga0187766_110828611 | 3300018058 | Tropical Peatland | NIDHDVIMIPNEIHIMARYSSWMMLFNAADVYFDRHLDKRSAPTP |
| Ga0187784_100250323 | 3300018062 | Tropical Peatland | MIPNEIHDLARYSSWMMLFNAAAVYFDRHLDQRSVPAP |
| Ga0187784_101773831 | 3300018062 | Tropical Peatland | IPNEIHVMARYSSWMMLFNAADVYFDRHLDKRSAPTP |
| Ga0187773_110015251 | 3300018064 | Tropical Peatland | RSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0179594_103716402 | 3300020170 | Vadose Zone Soil | NEIHDMARYSSWMMLFNAADVYFDRHLGKRSAPAP |
| Ga0179592_101334263 | 3300020199 | Vadose Zone Soil | MIPNEIHDLARYSSWMILFNAADVYFDRHLDKRSAPAP |
| Ga0210406_105813992 | 3300021168 | Soil | EGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0210400_114706592 | 3300021170 | Soil | EHDVVMIPNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP |
| Ga0210396_105089982 | 3300021180 | Soil | GLRSHNIDHDVILIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPTP |
| Ga0210388_100658316 | 3300021181 | Soil | NIDHDVIMIPNEIHVMARCSSWMTLFNAADVYFDRHLDKRSAPTP |
| Ga0210385_103685552 | 3300021402 | Soil | MIPNEIHVMARYASWMILFNATDVYFDRHLDKRSAPNP |
| Ga0210383_103729142 | 3300021407 | Soil | IEHDVVMIPNEIHAMSRYSYWMTLFNAADVYFDRHLEKRSALTP |
| Ga0210391_100909824 | 3300021433 | Soil | DVIMIPNEIHDMARYSSWMILFNAADVYFDRHLDKRSPAP |
| Ga0126371_126972521 | 3300021560 | Tropical Forest Soil | HNIEHDVIMIPNEIHDLARYSAWLMLFTAAAVYFDRHLDKRTAPAP |
| Ga0126371_133526271 | 3300021560 | Tropical Forest Soil | IPNEIHDMARYSSWMLLFNAADVYFDRQLNKRSALAP |
| Ga0224546_10090471 | 3300022515 | Soil | EVIMIPNEIHVMVRYASWMTLFHAADVYFDRHLDKRSAPAP |
| Ga0212123_102115161 | 3300022557 | Iron-Sulfur Acid Spring | MIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0224572_10111863 | 3300024225 | Rhizosphere | DVIMIPNEIHVMARYSSWMILFNAADVYLDRHLDKRSAPTP |
| Ga0137417_10231111 | 3300024330 | Vadose Zone Soil | GRRTHRRLAVARSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0207685_101527891 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AELLEGLRSHHIDHDVIMIPNEIHDMARYASWMLLFNAADVYFDRQLDKRSAPAP |
| Ga0207685_105690341 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | IPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0207663_101624124 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0207646_119273551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IEGLRSHNIDHDVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRNAPSPQADP |
| Ga0207700_111071981 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPLP |
| Ga0207711_104300231 | 3300025941 | Switchgrass Rhizosphere | LRSHNIDHDVIMIPNEIHDMARYSSWMLLFNAADVYFDRHLDKRNVPAP |
| Ga0209240_10779891 | 3300026304 | Grasslands Soil | DHDVIMIPNEIHDMARYSSWMALFNAAAVYFDRQLNKRSGP |
| Ga0209240_12396492 | 3300026304 | Grasslands Soil | MIPNEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0179593_10816072 | 3300026555 | Vadose Zone Soil | MIPNEIHVMARYSSWMMLFNAADVYFDRHLDKRSAPNIPSASQGER |
| Ga0179593_11993491 | 3300026555 | Vadose Zone Soil | EGLRLHNIDHDVIMIPNEIHDLARYSSWMILFNAADVYFDRHLDKRSAPAP |
| Ga0179593_12075926 | 3300026555 | Vadose Zone Soil | MIPNEIHDMARYSSWMMLFNAADMYFDRHLDKRRAPAP |
| Ga0209420_10321691 | 3300027648 | Forest Soil | IDHDVIMIPNEIHEMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0209007_10361773 | 3300027652 | Forest Soil | NEIHDMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0209333_12140302 | 3300027676 | Forest Soil | SDHDVIMIPNEIHEMARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0209908_101822652 | 3300027745 | Thawing Permafrost | LDVYKRQGLRSHNVDHDVIMIPNEIHDLARYSSWMMLFNAAYVYFDRHLDKWSAPAP |
| Ga0209773_104616192 | 3300027829 | Bog Forest Soil | QATALIEDLRSHNIDHDVIMIPNEIHVMARYSSWMILFNAADVYFDRHLDKRSAPTP |
| Ga0209580_103745192 | 3300027842 | Surface Soil | GLRSHNIEHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSAPSP |
| Ga0209166_105206611 | 3300027857 | Surface Soil | MIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSAPSP |
| Ga0209167_107863922 | 3300027867 | Surface Soil | LRSHNIDHDVIMIPNEIHDFARYSSWMMLFNAADMYFDRQLDKR |
| Ga0209169_100431713 | 3300027879 | Soil | NEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP |
| Ga0209275_103036932 | 3300027884 | Soil | NIDHDVIMIPNEIHVMARCSSWMTLFNAADVYFDRHLDKRSVPTP |
| Ga0209275_103060651 | 3300027884 | Soil | HDVVMIPNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP |
| Ga0302224_103393052 | 3300028759 | Palsa | AAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP |
| Ga0302234_103508221 | 3300028773 | Palsa | AELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP |
| Ga0302201_100670071 | 3300028785 | Bog | LIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP |
| Ga0308309_102668613 | 3300028906 | Soil | IIEHDVVMIPNEIHAMSRYSSWMTLFNAADVYFDRHLEKRSALTP |
| Ga0311368_102200441 | 3300029882 | Palsa | HDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP |
| Ga0311369_103395241 | 3300029910 | Palsa | MEGLRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLGKQSAPAP |
| Ga0311361_104006283 | 3300029911 | Bog | AAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP |
| Ga0311362_104094103 | 3300029913 | Bog | VPSQQAAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPV |
| Ga0311352_111580252 | 3300029944 | Palsa | DVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP |
| Ga0311371_109173271 | 3300029951 | Palsa | MIPNEIHDLARYSSWMMLFNAADAYFDRHLDKRSAPTP |
| Ga0302304_101752011 | 3300029993 | Palsa | ADGVVPSQQAAELIEGLRSHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP |
| Ga0311339_105396671 | 3300029999 | Palsa | DVIMIPNEMHDLARYSSWMMLFNAANMYFDRHLDKRSAPVP |
| Ga0311355_108354981 | 3300030580 | Palsa | SRNIDHDVIMIPNEIHVMVRYSSWMTLFNATDMYLDRHLDKRSVPTP |
| Ga0311356_103613413 | 3300030617 | Palsa | SHNIDHDVIMIPNEMHDLARYSSWMMLFNAANVYFDRHLDKRSAPVP |
| Ga0302311_106057762 | 3300030739 | Palsa | NEMHDLARYSSWMMLFNAADVYFDRHLDKRSAPVP |
| Ga0302312_101577823 | 3300030746 | Palsa | MIPNEIHDLARYSSWMTLFNAADVYFDRHLDKRSAPAP |
| Ga0302307_102615802 | 3300031233 | Palsa | IEDLRSRNIDHDVIMIPNEIHVMARYSSWMILFNATDVYFDRHLDKRSAPAP |
| Ga0302325_114130271 | 3300031234 | Palsa | EDLRSRNIDHDVIMIPNEIHVMARYSSWMILFNATDVYFDRHLDKRSAPAP |
| Ga0302324_1034339762 | 3300031236 | Palsa | RSHNIDHDVIIIPNEIHDLARYSSWMILFDAADVYFDRHLVKRSAPAP |
| (restricted) Ga0255312_10167893 | 3300031248 | Sandy Soil | IDHDVIMLPNEIHDMARYASWMLLFNAADVYFDRQLNKRSAPAP |
| Ga0318541_108674802 | 3300031545 | Soil | LRSHNIDHDVIMIPNEIHDLARYSSWMMLFNAADVYFERQLNKRSAPAPQAFPLPRF |
| Ga0318574_107014781 | 3300031680 | Soil | MIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL |
| Ga0310686_1005100243 | 3300031708 | Soil | LRSHNIDHDVIMIPNEIHEMARYSSWMILFNAADVYFDRHLDKRSAPTP |
| Ga0310686_1125006753 | 3300031708 | Soil | DVIMIPNEIHDMARYSSWMMLFNAADVYFDRHLGKRSAPAP |
| Ga0318502_101426371 | 3300031747 | Soil | NEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0318502_106280971 | 3300031747 | Soil | IPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL |
| Ga0307475_112090881 | 3300031754 | Hardwood Forest Soil | DVIMIPNEIHDMARYSSWMMLFNAADVYFDRQLNKRSAPSP |
| Ga0318546_101961241 | 3300031771 | Soil | DIEHDVIMIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPAPLAGPSLRF |
| Ga0307478_102655052 | 3300031823 | Hardwood Forest Soil | VIMIPNEIHDMARYSSWMLLFKAADVYFDRHLDKRSVPAP |
| Ga0307478_110648812 | 3300031823 | Hardwood Forest Soil | NEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPTP |
| Ga0306925_104701591 | 3300031890 | Soil | DVIMIPNEIHDMARYSSWMLLFNAAAVYFDRHLDQRSVPAR |
| Ga0306923_125448631 | 3300031910 | Soil | HDVIMIPNEIHDLARYSSWMMLFNAADVYFERQLNKRSAPAPQAFPLPRF |
| Ga0306921_101140746 | 3300031912 | Soil | LRSHDIEHDVIMIPNEIHDLARYSSWMMLFTAADVYFNRHLNKQTAPSPLAGSSL |
| Ga0310916_104868702 | 3300031942 | Soil | LRSHNIEHDVIMIPNEIHDLARYSSWMMLFNAADVYFDRQLNKRSAPFL |
| Ga0308173_104364441 | 3300032074 | Soil | EHDVVMIPNEIHDLARYSSWMTLFNAADAYFDRQLNKLSTPTR |
| Ga0306924_119396282 | 3300032076 | Soil | MIPNEIHDMARYSSWMLLFNAADLYFARHLDKRNAPAP |
| Ga0307471_1000029571 | 3300032180 | Hardwood Forest Soil | NEIHDMARYSSWMLLFNAADVYFDRHLDKRSVPAP |
| Ga0307472_1011528872 | 3300032205 | Hardwood Forest Soil | HDVIMIPNEIHDLARYSSWMMLFNAADVYFDRHLDKRSAPAP |
| Ga0335072_109884662 | 3300032898 | Soil | ALIEDLRSHNIDHDLIVIPNEIHVMTRYSSWMMLFNAADVYLDRHLGKRSAPTP |
| ⦗Top⦘ |