


| Basic Information | |
|---|---|
| Family ID | F045179 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.85 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.007 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.686 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.954 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.791 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 0.00% Coil/Unstructured: 88.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF04879 | Molybdop_Fe4S4 | 82.35 |
| PF10518 | TAT_signal | 4.58 |
| PF04216 | FdhE | 3.27 |
| PF00384 | Molybdopterin | 1.31 |
| PF12838 | Fer4_7 | 0.65 |
| PF13468 | Glyoxalase_3 | 0.65 |
| PF12704 | MacB_PCD | 0.65 |
| PF01638 | HxlR | 0.65 |
| PF01568 | Molydop_binding | 0.65 |
| PF04014 | MazE_antitoxin | 0.65 |
| PF13437 | HlyD_3 | 0.65 |
| PF13193 | AMP-binding_C | 0.65 |
| PF02274 | ADI | 0.65 |
| PF02634 | FdhD-NarQ | 0.65 |
| PF11999 | Ice_binding | 0.65 |
| PF13147 | Obsolete Pfam Family | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 3.27 |
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.65 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.65 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.65 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.65 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.01 % |
| Unclassified | root | N/A | 16.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309002|MiccSOB_contig38790 | Not Available | 1164 | Open in IMG/M |
| 3300004091|Ga0062387_101191685 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300004152|Ga0062386_100907942 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300004153|Ga0063455_101706903 | Not Available | 500 | Open in IMG/M |
| 3300004156|Ga0062589_101935816 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300004471|Ga0068965_1066269 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300004643|Ga0062591_101393589 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300004800|Ga0058861_10015509 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300004800|Ga0058861_10064204 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005294|Ga0065705_10394055 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005328|Ga0070676_10986043 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005332|Ga0066388_107783874 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005334|Ga0068869_101115861 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300005336|Ga0070680_100355901 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300005343|Ga0070687_100469060 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005444|Ga0070694_100281295 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300005444|Ga0070694_101103371 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005447|Ga0066689_10661446 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300005451|Ga0066681_10848414 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005455|Ga0070663_102079902 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005458|Ga0070681_10300043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1516 | Open in IMG/M |
| 3300005459|Ga0068867_100575900 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300005467|Ga0070706_101834785 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005533|Ga0070734_10250456 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005542|Ga0070732_10312611 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005544|Ga0070686_101177270 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005546|Ga0070696_100459203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1006 | Open in IMG/M |
| 3300005554|Ga0066661_10710810 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005577|Ga0068857_100768307 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005587|Ga0066654_10931319 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005602|Ga0070762_10111529 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300005618|Ga0068864_101100860 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005719|Ga0068861_100153557 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300005764|Ga0066903_101556604 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300005764|Ga0066903_104765000 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005843|Ga0068860_100977967 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005921|Ga0070766_11301799 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006034|Ga0066656_10527643 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300006224|Ga0079037_101902934 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300006755|Ga0079222_10955906 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006844|Ga0075428_100075663 | All Organisms → cellular organisms → Bacteria | 3676 | Open in IMG/M |
| 3300006844|Ga0075428_101732506 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006893|Ga0073928_10417954 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300006893|Ga0073928_10968057 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006904|Ga0075424_100773758 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300006931|Ga0097620_101809752 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300009137|Ga0066709_100986234 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300010339|Ga0074046_10003155 | All Organisms → cellular organisms → Bacteria | 13932 | Open in IMG/M |
| 3300010359|Ga0126376_10219873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1591 | Open in IMG/M |
| 3300010359|Ga0126376_10629834 | Not Available | 1020 | Open in IMG/M |
| 3300010376|Ga0126381_101802689 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300010379|Ga0136449_100599606 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300011036|Ga0138590_123906 | Not Available | 520 | Open in IMG/M |
| 3300011269|Ga0137392_11456820 | Not Available | 544 | Open in IMG/M |
| 3300015374|Ga0132255_105283254 | Not Available | 547 | Open in IMG/M |
| 3300016270|Ga0182036_10540874 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300017821|Ga0187812_1027777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1938 | Open in IMG/M |
| 3300017823|Ga0187818_10027310 | Not Available | 2443 | Open in IMG/M |
| 3300017823|Ga0187818_10044197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1913 | Open in IMG/M |
| 3300017955|Ga0187817_10579368 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300017959|Ga0187779_11173969 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300017961|Ga0187778_10490288 | Not Available | 815 | Open in IMG/M |
| 3300017995|Ga0187816_10167017 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300017999|Ga0187767_10083784 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300018008|Ga0187888_1123813 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300018034|Ga0187863_10146635 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300018034|Ga0187863_10392431 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300018085|Ga0187772_10162363 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300019208|Ga0180110_1276863 | Not Available | 674 | Open in IMG/M |
| 3300019248|Ga0180117_1016535 | Not Available | 668 | Open in IMG/M |
| 3300019360|Ga0187894_10019843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4812 | Open in IMG/M |
| 3300019487|Ga0187893_10501314 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300019487|Ga0187893_10928915 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300019767|Ga0190267_11490000 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300019787|Ga0182031_1111434 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300020078|Ga0206352_11354751 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300020580|Ga0210403_10615693 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300020581|Ga0210399_10045428 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300020582|Ga0210395_11223766 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300020583|Ga0210401_10627252 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300021170|Ga0210400_11136619 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021171|Ga0210405_10738783 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300021181|Ga0210388_11081125 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300021405|Ga0210387_10066010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2948 | Open in IMG/M |
| 3300021405|Ga0210387_10286396 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300021432|Ga0210384_11094160 | Not Available | 700 | Open in IMG/M |
| 3300021433|Ga0210391_10085734 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300021433|Ga0210391_10638103 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300021479|Ga0210410_10940950 | Not Available | 752 | Open in IMG/M |
| 3300021559|Ga0210409_10080510 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300022508|Ga0222728_1020887 | Not Available | 947 | Open in IMG/M |
| 3300022509|Ga0242649_1072666 | Not Available | 519 | Open in IMG/M |
| 3300022532|Ga0242655_10095306 | Not Available | 810 | Open in IMG/M |
| 3300022713|Ga0242677_1085987 | Not Available | 513 | Open in IMG/M |
| 3300022726|Ga0242654_10172901 | Not Available | 736 | Open in IMG/M |
| 3300022737|Ga0247747_1035801 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025414|Ga0208935_1024783 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300025904|Ga0207647_10336919 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025918|Ga0207662_11125634 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300025925|Ga0207650_10740206 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300025932|Ga0207690_10045564 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300025932|Ga0207690_10715914 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300025933|Ga0207706_10762598 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300025934|Ga0207686_10447381 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300026095|Ga0207676_10791509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 925 | Open in IMG/M |
| 3300026118|Ga0207675_100960149 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300026298|Ga0209236_1067255 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300026300|Ga0209027_1196359 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300026332|Ga0209803_1182910 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300027548|Ga0209523_1030401 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300027826|Ga0209060_10167657 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300027846|Ga0209180_10484386 | Not Available | 694 | Open in IMG/M |
| 3300027853|Ga0209274_10216029 | Not Available | 977 | Open in IMG/M |
| 3300027867|Ga0209167_10171168 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300027873|Ga0209814_10277825 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300027879|Ga0209169_10071531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1794 | Open in IMG/M |
| 3300027882|Ga0209590_10159476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1405 | Open in IMG/M |
| 3300027911|Ga0209698_10247627 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300028381|Ga0268264_10634667 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300028673|Ga0257175_1019117 | Not Available | 1121 | Open in IMG/M |
| 3300028776|Ga0302303_10178846 | Not Available | 741 | Open in IMG/M |
| 3300029910|Ga0311369_11047468 | Not Available | 641 | Open in IMG/M |
| 3300029944|Ga0311352_11120140 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300030580|Ga0311355_11452042 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300030730|Ga0307482_1125824 | Not Available | 727 | Open in IMG/M |
| 3300030993|Ga0308190_1077387 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031091|Ga0308201_10189889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 672 | Open in IMG/M |
| 3300031236|Ga0302324_100006389 | All Organisms → cellular organisms → Bacteria | 25410 | Open in IMG/M |
| 3300031261|Ga0302140_10734210 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300031421|Ga0308194_10170259 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031474|Ga0170818_103039102 | Not Available | 988 | Open in IMG/M |
| 3300031525|Ga0302326_10113718 | All Organisms → cellular organisms → Bacteria | 4790 | Open in IMG/M |
| 3300031682|Ga0318560_10035883 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300031708|Ga0310686_104623711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5217 | Open in IMG/M |
| 3300031740|Ga0307468_102312691 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031777|Ga0318543_10440560 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031858|Ga0310892_10527312 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031858|Ga0310892_10940800 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031893|Ga0318536_10274905 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031908|Ga0310900_10327088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1138 | Open in IMG/M |
| 3300031908|Ga0310900_10732595 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031938|Ga0308175_102907724 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032043|Ga0318556_10079890 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300032160|Ga0311301_11298205 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300032180|Ga0307471_101193225 | Not Available | 925 | Open in IMG/M |
| 3300032256|Ga0315271_10870304 | Not Available | 777 | Open in IMG/M |
| 3300032783|Ga0335079_10269225 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300032805|Ga0335078_10873372 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300032892|Ga0335081_10114163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3971 | Open in IMG/M |
| 3300032897|Ga0335071_10418724 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300032898|Ga0335072_11152924 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300032955|Ga0335076_11565661 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300034178|Ga0364934_0268839 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.27% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.96% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.31% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.31% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.31% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.65% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.65% |
| Concrete Drainage Pipe Biofilm | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm | 0.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.65% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309002 | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assembly | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011036 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 82 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019208 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MiccSOB_00249930 | 2070309002 | Concrete Drainage Pipe Biofilm | MIQMTSAFLMSVQLFVIAPRPNVGPKLATVGPCQILALVFDLQ |
| Ga0062387_1011916851 | 3300004091 | Bog Forest Soil | PPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA* |
| Ga0062386_1009079421 | 3300004152 | Bog Forest Soil | PPMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSR* |
| Ga0063455_1017069031 | 3300004153 | Soil | LPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA* |
| Ga0062589_1019358162 | 3300004156 | Soil | PPMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSM* |
| Ga0068965_10662692 | 3300004471 | Peatlands Soil | PMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR* |
| Ga0062591_1013935891 | 3300004643 | Soil | NIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0058861_100155091 | 3300004800 | Host-Associated | PMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0058861_100642041 | 3300004800 | Host-Associated | PMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSM* |
| Ga0065705_103940551 | 3300005294 | Switchgrass Rhizosphere | MINIMSVFLMSIQPFVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0070676_109860432 | 3300005328 | Miscanthus Rhizosphere | PPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWVSR* |
| Ga0066388_1077838742 | 3300005332 | Tropical Forest Soil | LPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0068869_1011158611 | 3300005334 | Miscanthus Rhizosphere | LPPMINIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0070680_1003559013 | 3300005336 | Corn Rhizosphere | PPITNIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0070687_1004690601 | 3300005343 | Switchgrass Rhizosphere | PMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWVSR* |
| Ga0070694_1002812951 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | INITSVFLMSIHPLVIAPRPNVGPKLETVGPCQTLAWFSR* |
| Ga0070694_1011033711 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ITNIMSVFLMSIQPVVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0066689_106614461 | 3300005447 | Soil | PPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTLAWFSM* |
| Ga0066681_108484141 | 3300005451 | Soil | PMINIMSVFLMSIQPFVIAPRPNVGPRLETVGPCQTRAWFSR* |
| Ga0070663_1020799021 | 3300005455 | Corn Rhizosphere | PMINIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0070681_103000433 | 3300005458 | Corn Rhizosphere | MINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSM* |
| Ga0068867_1005759003 | 3300005459 | Miscanthus Rhizosphere | NIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK* |
| Ga0070706_1018347852 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | INIMSVFLMSIHPLVMAPRPKVGPKLETVGPCQTRAWVS* |
| Ga0070734_102504563 | 3300005533 | Surface Soil | AGFPPMINIMSVFLMSTQPFVMAPRPNVGPKLETVGPCQTLA* |
| Ga0070732_103126111 | 3300005542 | Surface Soil | PPMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0070686_1011772702 | 3300005544 | Switchgrass Rhizosphere | PPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTLAWFSR* |
| Ga0070696_1004592031 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK* |
| Ga0066661_107108102 | 3300005554 | Soil | PMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0068857_1007683072 | 3300005577 | Corn Rhizosphere | LPPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0066654_109313191 | 3300005587 | Soil | PPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK* |
| Ga0070762_101115293 | 3300005602 | Soil | ISIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA* |
| Ga0068864_1011008601 | 3300005618 | Switchgrass Rhizosphere | LPPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0068861_1001535574 | 3300005719 | Switchgrass Rhizosphere | LPPMINIMSVFLMSIHPFVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0066903_1015566043 | 3300005764 | Tropical Forest Soil | LPPMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0066903_1047650001 | 3300005764 | Tropical Forest Soil | SVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0068860_1009779671 | 3300005843 | Switchgrass Rhizosphere | PMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTLA* |
| Ga0070766_113017992 | 3300005921 | Soil | IMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTLA* |
| Ga0066656_105276432 | 3300006034 | Soil | VFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0079037_1019029341 | 3300006224 | Freshwater Wetlands | PMTKTTSAFLMSTQPLVIAPRPNVAARLATVGECQTRAWESR* |
| Ga0079222_109559061 | 3300006755 | Agricultural Soil | MINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0075428_1000756636 | 3300006844 | Populus Rhizosphere | MSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0075428_1017325062 | 3300006844 | Populus Rhizosphere | INIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK* |
| Ga0073928_104179541 | 3300006893 | Iron-Sulfur Acid Spring | PMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSM* |
| Ga0073928_109680571 | 3300006893 | Iron-Sulfur Acid Spring | MINIMSVFLMSIQPLVMAPLPNVGPKLETVGPCQTLA* |
| Ga0075424_1007737581 | 3300006904 | Populus Rhizosphere | SVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0097620_1018097521 | 3300006931 | Switchgrass Rhizosphere | INIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK* |
| Ga0066709_1009862342 | 3300009137 | Grasslands Soil | MINIMSVFLMSIQPFVIAPLLNVDPNLEHVCPCQTRAWFS |
| Ga0074046_1000315517 | 3300010339 | Bog Forest Soil | PPMINIMSVFLMSTQPLVMAPRPNVGPKLETVGPCQTLA* |
| Ga0126376_102198733 | 3300010359 | Tropical Forest Soil | PPMINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR* |
| Ga0126376_106298343 | 3300010359 | Tropical Forest Soil | PMINIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTLA* |
| Ga0126381_1018026893 | 3300010376 | Tropical Forest Soil | PMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLA* |
| Ga0136449_1005996061 | 3300010379 | Peatlands Soil | IMSVFLMSIQPFVMAPRPKVGPKLETVGPCQTLA* |
| Ga0138590_1239061 | 3300011036 | Peatlands Soil | INIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR* |
| Ga0137392_114568202 | 3300011269 | Vadose Zone Soil | MMSIMSVFFMSTQPLVIAPRPNVGPKLETVGPCQTLA* |
| Ga0132255_1052832542 | 3300015374 | Arabidopsis Rhizosphere | PPITVITYACLMSIQRLVIAPRPKEGAKLATDGPCQTLA* |
| Ga0182036_105408741 | 3300016270 | Soil | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0187812_10277771 | 3300017821 | Freshwater Sediment | PPMINIMSVFLMSIQPLVMAPRPNVGPKLETVGPCQTLAWFSR |
| Ga0187818_100273101 | 3300017823 | Freshwater Sediment | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFS |
| Ga0187818_100441971 | 3300017823 | Freshwater Sediment | PPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0187817_105793681 | 3300017955 | Freshwater Sediment | PMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0187779_111739691 | 3300017959 | Tropical Peatland | PMINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSI |
| Ga0187778_104902881 | 3300017961 | Tropical Peatland | AFLMSTHPLVIAPRPNVAARLAPVGACQTRAWESR |
| Ga0187816_101670171 | 3300017995 | Freshwater Sediment | IMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0187767_100837843 | 3300017999 | Tropical Peatland | MINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0187888_11238131 | 3300018008 | Peatland | PPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0187863_101466351 | 3300018034 | Peatland | NIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0187863_103924311 | 3300018034 | Peatland | FPPMINIMSVFLMSTQPLVMAPRPKVGPKLETVGPCQTLAWFSM |
| Ga0187772_101623633 | 3300018085 | Tropical Peatland | SVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0180110_12768632 | 3300019208 | Groundwater Sediment | AFLMSTHPFVIAPRPNVAARLATVGACHTRAWESL |
| Ga0180117_10165352 | 3300019248 | Groundwater Sediment | SAFLMSTQPLVIAPRPNVAARLATVGECQTRAWESR |
| Ga0187894_100198431 | 3300019360 | Microbial Mat On Rocks | MSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0187893_105013141 | 3300019487 | Microbial Mat On Rocks | ISIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0187893_109289151 | 3300019487 | Microbial Mat On Rocks | MISIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0190267_114900002 | 3300019767 | Soil | INIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK |
| Ga0182031_11114342 | 3300019787 | Bog | PMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0206352_113547512 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRA |
| Ga0210403_106156931 | 3300020580 | Soil | MINIMSVFLMSTQPLVMAPRPNVGPKLETVGPCQTLA |
| Ga0210399_100454284 | 3300020581 | Soil | PMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTLAWFSI |
| Ga0210395_112237662 | 3300020582 | Soil | MINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0210401_106272523 | 3300020583 | Soil | NIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSI |
| Ga0210400_111366191 | 3300021170 | Soil | PMINIMSVFLMSIQPLVMAPLPNVGPKLETVGPCQTLA |
| Ga0210405_107387832 | 3300021171 | Soil | FPPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0210388_110811251 | 3300021181 | Soil | NIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0210387_100660101 | 3300021405 | Soil | MISIMSVFFISTQPFVIAPRPNVGPKLETVGPCQT |
| Ga0210387_102863964 | 3300021405 | Soil | ISIMSVFLISTQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0210384_110941602 | 3300021432 | Soil | MINIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0210391_100857344 | 3300021433 | Soil | MMSIMSVFFMSTQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0210391_106381031 | 3300021433 | Soil | PMINIMSVFLMSTQPLVMAPRPKVGPKLETVGPCQTLA |
| Ga0210410_109409502 | 3300021479 | Soil | NIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0210409_100805106 | 3300021559 | Soil | INIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRA |
| Ga0222728_10208871 | 3300022508 | Soil | INIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0242649_10726661 | 3300022509 | Soil | INIMSVFLMSIQPFVMAPLPNVGPKLETVGPCQTLA |
| Ga0242655_100953061 | 3300022532 | Soil | PIINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0242677_10859872 | 3300022713 | Soil | PMMSIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA |
| Ga0242654_101729011 | 3300022726 | Soil | INIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTRAWFSK |
| Ga0247747_10358012 | 3300022737 | Soil | MSVFLMSIHPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0208935_10247832 | 3300025414 | Peatland | INIMSVFLMSTQPLVMAPRPKVGPKLETVGPCQTLAWFSI |
| Ga0207647_103369192 | 3300025904 | Corn Rhizosphere | IMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0207662_111256341 | 3300025918 | Switchgrass Rhizosphere | MINITSVFLMSIHPLVIAPRPNVGPKLETVGPCQTR |
| Ga0207650_107402062 | 3300025925 | Switchgrass Rhizosphere | PMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0207690_100455644 | 3300025932 | Corn Rhizosphere | NITSLFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0207690_107159142 | 3300025932 | Corn Rhizosphere | INIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0207706_107625981 | 3300025933 | Corn Rhizosphere | PPMINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK |
| Ga0207686_104473811 | 3300025934 | Miscanthus Rhizosphere | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK |
| Ga0207676_107915091 | 3300026095 | Switchgrass Rhizosphere | MINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK |
| Ga0207675_1009601492 | 3300026118 | Switchgrass Rhizosphere | NIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSM |
| Ga0209236_10672554 | 3300026298 | Grasslands Soil | NIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSM |
| Ga0209027_11963592 | 3300026300 | Grasslands Soil | INIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRACVSK |
| Ga0209803_11829101 | 3300026332 | Soil | LPPMTRTTSAFRTSTHPLVIAPRPNVAARLATVGPCQTLA |
| Ga0209523_10304011 | 3300027548 | Forest Soil | IMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0209060_101676571 | 3300027826 | Surface Soil | AGFPPMINIMSVFLMSTQPFVMAPRPNVGPKLETVGPCQTLA |
| Ga0209180_104843862 | 3300027846 | Vadose Zone Soil | PPMMSIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0209274_102160292 | 3300027853 | Soil | PPMMSIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA |
| Ga0209167_101711683 | 3300027867 | Surface Soil | IMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTLAWFSR |
| Ga0209814_102778252 | 3300027873 | Populus Rhizosphere | MINITSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0209169_100715313 | 3300027879 | Soil | MSVFLVSTQPLVMAPRPKVGPKLETVGPCQTLAWFSM |
| Ga0209590_101594761 | 3300027882 | Vadose Zone Soil | PMINIMSVFFMSIQPLVIAPRPKVGPKLETVGACQTRACVSK |
| Ga0209698_102476271 | 3300027911 | Watersheds | NIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0268264_106346673 | 3300028381 | Switchgrass Rhizosphere | PMINITSVFLMSIHPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0257175_10191172 | 3300028673 | Soil | PPMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTLAWFSR |
| Ga0302303_101788461 | 3300028776 | Palsa | PMINIMSVFLMSTQPLVMAPLPNVGPKLETVGPCQTLA |
| Ga0311369_110474682 | 3300029910 | Palsa | INIMSVFLMSTQPFVMAPLPNVGPKLETVGPCQTLA |
| Ga0311352_111201401 | 3300029944 | Palsa | MINIMSVFLMSIQPFVMAPRPNVGPKLETVGPCQTRA |
| Ga0311355_114520422 | 3300030580 | Palsa | PMINIMSVFFMSIQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0307482_11258241 | 3300030730 | Hardwood Forest Soil | PPMINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSK |
| Ga0308190_10773871 | 3300030993 | Soil | PMARMTSAFLMSTQPLVIAPRPNVAAKLATVGPCQTLA |
| Ga0308201_101898891 | 3300031091 | Soil | VFLMSRQWFVMAPRPNEAAKLATVGPCQTLACCSR |
| Ga0302324_1000063891 | 3300031236 | Palsa | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSK |
| Ga0302140_107342101 | 3300031261 | Bog | MISIMSVLPMSTQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0308194_101702591 | 3300031421 | Soil | PPMINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0170818_1030391023 | 3300031474 | Forest Soil | PMTIIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLAWFSK |
| Ga0302326_101137188 | 3300031525 | Palsa | PPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0318560_100358835 | 3300031682 | Soil | INIKSVFLRSIQPFVIAPRPNVGPKLETVGACQVRA |
| Ga0310686_1046237111 | 3300031708 | Soil | SIMSVFFISTQPFVIAPRPNVGPKLETVGPCQTLA |
| Ga0307468_1023126911 | 3300031740 | Hardwood Forest Soil | PIINIMSVFLMSIQPLVIAPRPKVGPKLETVGPCQTRACVSK |
| Ga0318543_104405602 | 3300031777 | Soil | MSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0310892_105273123 | 3300031858 | Soil | VFLISIQPLVIAPRPKVGPKLETVGPCQTRAWFSR |
| Ga0310892_109408002 | 3300031858 | Soil | MINIMSVFLMSIQPLVIAPRPNVGPRLETVGPCQTRAWFSR |
| Ga0318536_102749051 | 3300031893 | Soil | INIMSVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0310900_103270883 | 3300031908 | Soil | MINIMSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0310900_107325952 | 3300031908 | Soil | PPMINIMSVFLMSIQPLVIAPRPNVGPRLETVGPCQTRAWFSR |
| Ga0308175_1029077241 | 3300031938 | Soil | NIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSM |
| Ga0318556_100798903 | 3300032043 | Soil | INIISVFLMSIQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0311301_112982051 | 3300032160 | Peatlands Soil | SVFFMSTQPLVIAPRPNDGPKLETVGPCQTLAWFSR |
| Ga0307471_1011932251 | 3300032180 | Hardwood Forest Soil | MINIMSVFLMSTQPFVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0315271_108703041 | 3300032256 | Sediment | RTTSAFLMSTHPFVIAPRPNVAAKLATVGACQTRAWESL |
| Ga0335079_102692254 | 3300032783 | Soil | SIMSVFFMSIQPLVMAPRPNVGPKLETVGPCQTLA |
| Ga0335078_108733721 | 3300032805 | Soil | PPMINIMSVFLMSTQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0335081_101141631 | 3300032892 | Soil | MTNAMSVFRMSVQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0335071_104187243 | 3300032897 | Soil | LPPMINIKSVFLMSIQPLVIAPRPNVGPKLETVGPCQTRAWFSR |
| Ga0335072_111529242 | 3300032898 | Soil | PITKIMSVFLMSIHPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0335076_115656611 | 3300032955 | Soil | MTKAMSVFRMSVQPLVIAPRPNVGPKLETVGPCQTLA |
| Ga0364934_0268839_2_139 | 3300034178 | Sediment | GFPPMQRMTSAFLMSTHPFVIAPRPNVAARLATVGACQTRAWESR |
| ⦗Top⦘ |