


| Basic Information | |
|---|---|
| Family ID | F045168 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 40 residues |
| Representative Sequence | IQDYIRRYNTNPQPFQWVASASKIIRKVNKYKETLETGD |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.31 % |
| % of genes near scaffold ends (potentially truncated) | 98.69 % |
| % of genes from short scaffolds (< 2000 bps) | 71.24 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.856 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.647 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.405 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 0.00% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF13304 | AAA_21 | 3.27 |
| PF13565 | HTH_32 | 2.61 |
| PF13358 | DDE_3 | 2.61 |
| PF02146 | SIR2 | 2.61 |
| PF00005 | ABC_tran | 1.31 |
| PF01382 | Avidin | 1.31 |
| PF00072 | Response_reg | 1.31 |
| PF13620 | CarboxypepD_reg | 1.31 |
| PF13360 | PQQ_2 | 1.31 |
| PF06739 | SBBP | 1.31 |
| PF02687 | FtsX | 1.31 |
| PF05402 | PqqD | 1.31 |
| PF04191 | PEMT | 1.31 |
| PF03929 | PepSY_TM | 1.31 |
| PF02627 | CMD | 0.65 |
| PF07635 | PSCyt1 | 0.65 |
| PF00122 | E1-E2_ATPase | 0.65 |
| PF01979 | Amidohydro_1 | 0.65 |
| PF07275 | ArdA | 0.65 |
| PF02371 | Transposase_20 | 0.65 |
| PF13604 | AAA_30 | 0.65 |
| PF14559 | TPR_19 | 0.65 |
| PF01850 | PIN | 0.65 |
| PF02321 | OEP | 0.65 |
| PF02310 | B12-binding | 0.65 |
| PF07335 | Glyco_hydro_75 | 0.65 |
| PF02518 | HATPase_c | 0.65 |
| PF08241 | Methyltransf_11 | 0.65 |
| PF01068 | DNA_ligase_A_M | 0.65 |
| PF00561 | Abhydrolase_1 | 0.65 |
| PF00550 | PP-binding | 0.65 |
| PF08281 | Sigma70_r4_2 | 0.65 |
| PF03050 | DDE_Tnp_IS66 | 0.65 |
| PF13579 | Glyco_trans_4_4 | 0.65 |
| PF00596 | Aldolase_II | 0.65 |
| PF03544 | TonB_C | 0.65 |
| PF01229 | Glyco_hydro_39 | 0.65 |
| PF10531 | SLBB | 0.65 |
| PF13393 | tRNA-synt_His | 0.65 |
| PF04794 | YdjC | 0.65 |
| PF03412 | Peptidase_C39 | 0.65 |
| PF10137 | TIR-like | 0.65 |
| PF13683 | rve_3 | 0.65 |
| PF12704 | MacB_PCD | 0.65 |
| PF04977 | DivIC | 0.65 |
| PF02899 | Phage_int_SAM_1 | 0.65 |
| PF03200 | Glyco_hydro_63 | 0.65 |
| PF00903 | Glyoxalase | 0.65 |
| PF00486 | Trans_reg_C | 0.65 |
| PF07992 | Pyr_redox_2 | 0.65 |
| PF14849 | YidC_periplas | 0.65 |
| PF04972 | BON | 0.65 |
| PF03992 | ABM | 0.65 |
| PF00563 | EAL | 0.65 |
| PF13204 | DUF4038 | 0.65 |
| PF08681 | DUF1778 | 0.65 |
| PF01058 | Oxidored_q6 | 0.65 |
| PF12969 | DUF3857 | 0.65 |
| PF01610 | DDE_Tnp_ISL3 | 0.65 |
| PF00753 | Lactamase_B | 0.65 |
| PF00450 | Peptidase_S10 | 0.65 |
| PF13442 | Cytochrome_CBB3 | 0.65 |
| PF00884 | Sulfatase | 0.65 |
| PF07519 | Tannase | 0.65 |
| PF00923 | TAL_FSA | 0.65 |
| PF05016 | ParE_toxin | 0.65 |
| PF05598 | DUF772 | 0.65 |
| PF06742 | DUF1214 | 0.65 |
| PF01243 | Putative_PNPOx | 0.65 |
| PF01966 | HD | 0.65 |
| PF00665 | rve | 0.65 |
| PF00589 | Phage_integrase | 0.65 |
| PF01578 | Cytochrom_C_asm | 0.65 |
| PF13551 | HTH_29 | 0.65 |
| PF01261 | AP_endonuc_2 | 0.65 |
| PF13240 | zinc_ribbon_2 | 0.65 |
| PF03109 | ABC1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 2.61 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 1.31 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 1.31 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.65 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.65 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.65 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.65 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.65 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.65 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.65 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.65 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.65 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.65 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.65 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.65 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.65 |
| COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 0.65 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 0.65 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.65 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.65 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.65 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.65 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.65 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.65 |
| COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 0.65 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.65 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.65 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.65 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.65 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.65 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.51 % |
| Unclassified | root | N/A | 25.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12968961 | Not Available | 1096 | Open in IMG/M |
| 3300005332|Ga0066388_103218452 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005366|Ga0070659_101427729 | Not Available | 616 | Open in IMG/M |
| 3300005524|Ga0070737_10001655 | All Organisms → cellular organisms → Bacteria | 30508 | Open in IMG/M |
| 3300005524|Ga0070737_10001815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 28396 | Open in IMG/M |
| 3300005524|Ga0070737_10008627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8684 | Open in IMG/M |
| 3300005524|Ga0070737_10009434 | All Organisms → cellular organisms → Bacteria | 8131 | Open in IMG/M |
| 3300005524|Ga0070737_10016948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5280 | Open in IMG/M |
| 3300005524|Ga0070737_10029277 | All Organisms → cellular organisms → Bacteria | 3477 | Open in IMG/M |
| 3300005524|Ga0070737_10060090 | Not Available | 1976 | Open in IMG/M |
| 3300005534|Ga0070735_10118508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
| 3300005534|Ga0070735_10867087 | Not Available | 530 | Open in IMG/M |
| 3300005537|Ga0070730_10009811 | All Organisms → cellular organisms → Bacteria | 7911 | Open in IMG/M |
| 3300005541|Ga0070733_10227841 | Not Available | 1222 | Open in IMG/M |
| 3300005541|Ga0070733_10317451 | Not Available | 1030 | Open in IMG/M |
| 3300005563|Ga0068855_100127932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2903 | Open in IMG/M |
| 3300005563|Ga0068855_100515716 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300005563|Ga0068855_100528974 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300005564|Ga0070664_100333530 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300005614|Ga0068856_100637314 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300005764|Ga0066903_102487257 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005764|Ga0066903_102768852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 951 | Open in IMG/M |
| 3300006028|Ga0070717_10296585 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300006028|Ga0070717_10701435 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300006028|Ga0070717_10829239 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006052|Ga0075029_100088728 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300006059|Ga0075017_100261122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1269 | Open in IMG/M |
| 3300006059|Ga0075017_101292024 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006237|Ga0097621_100662676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 958 | Open in IMG/M |
| 3300006800|Ga0066660_10742954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
| 3300006806|Ga0079220_10271257 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300006806|Ga0079220_10716310 | Not Available | 739 | Open in IMG/M |
| 3300006806|Ga0079220_11610862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300006854|Ga0075425_102431115 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006893|Ga0073928_10032443 | All Organisms → cellular organisms → Bacteria | 4991 | Open in IMG/M |
| 3300006893|Ga0073928_10052658 | All Organisms → cellular organisms → Bacteria | 3658 | Open in IMG/M |
| 3300006893|Ga0073928_10159549 | Not Available | 1810 | Open in IMG/M |
| 3300006893|Ga0073928_10390381 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300006893|Ga0073928_10975092 | Not Available | 578 | Open in IMG/M |
| 3300009038|Ga0099829_11203080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300009137|Ga0066709_104204081 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009518|Ga0116128_1000677 | All Organisms → cellular organisms → Bacteria | 16739 | Open in IMG/M |
| 3300009549|Ga0116137_1072538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300009646|Ga0116132_1001521 | All Organisms → cellular organisms → Bacteria | 16733 | Open in IMG/M |
| 3300009824|Ga0116219_10386801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300009839|Ga0116223_10420375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300010046|Ga0126384_10604557 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300010361|Ga0126378_10002234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14318 | Open in IMG/M |
| 3300010366|Ga0126379_10949026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300010366|Ga0126379_10973904 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300010373|Ga0134128_10103003 | All Organisms → cellular organisms → Bacteria | 3246 | Open in IMG/M |
| 3300010373|Ga0134128_10537301 | Not Available | 1303 | Open in IMG/M |
| 3300010373|Ga0134128_10892032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300010373|Ga0134128_11200559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea | 837 | Open in IMG/M |
| 3300010376|Ga0126381_101576031 | Not Available | 949 | Open in IMG/M |
| 3300010376|Ga0126381_102574531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300010376|Ga0126381_103277955 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010376|Ga0126381_103749742 | Not Available | 594 | Open in IMG/M |
| 3300010379|Ga0136449_101632703 | Not Available | 977 | Open in IMG/M |
| 3300011269|Ga0137392_11580837 | Not Available | 514 | Open in IMG/M |
| 3300011271|Ga0137393_10326107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1310 | Open in IMG/M |
| 3300011271|Ga0137393_11122958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 668 | Open in IMG/M |
| 3300012582|Ga0137358_10279181 | Not Available | 1135 | Open in IMG/M |
| 3300012912|Ga0157306_10021273 | Not Available | 1395 | Open in IMG/M |
| 3300012923|Ga0137359_11773411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 504 | Open in IMG/M |
| 3300012971|Ga0126369_10081824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2867 | Open in IMG/M |
| 3300012971|Ga0126369_10976985 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300012971|Ga0126369_11398949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
| 3300014155|Ga0181524_10033085 | All Organisms → cellular organisms → Bacteria | 3533 | Open in IMG/M |
| 3300014162|Ga0181538_10242239 | Not Available | 996 | Open in IMG/M |
| 3300014489|Ga0182018_10547439 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300014501|Ga0182024_10048160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 6816 | Open in IMG/M |
| 3300014501|Ga0182024_12877572 | Not Available | 510 | Open in IMG/M |
| 3300015371|Ga0132258_10983618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 2132 | Open in IMG/M |
| 3300016387|Ga0182040_10123587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1800 | Open in IMG/M |
| 3300016445|Ga0182038_10025606 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300017925|Ga0187856_1001763 | All Organisms → cellular organisms → Bacteria | 16739 | Open in IMG/M |
| 3300017943|Ga0187819_10001903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10885 | Open in IMG/M |
| 3300017955|Ga0187817_10027105 | All Organisms → cellular organisms → Bacteria | 3452 | Open in IMG/M |
| 3300017955|Ga0187817_10414853 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300018001|Ga0187815_10069021 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300018001|Ga0187815_10287317 | Not Available | 697 | Open in IMG/M |
| 3300018058|Ga0187766_11196490 | Not Available | 550 | Open in IMG/M |
| 3300018090|Ga0187770_10557531 | Not Available | 909 | Open in IMG/M |
| 3300018432|Ga0190275_10016829 | All Organisms → cellular organisms → Bacteria | 5573 | Open in IMG/M |
| 3300018432|Ga0190275_10057666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3273 | Open in IMG/M |
| 3300018469|Ga0190270_11144948 | Not Available | 813 | Open in IMG/M |
| 3300020580|Ga0210403_10786629 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300020583|Ga0210401_10693184 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300021171|Ga0210405_10064746 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 2884 | Open in IMG/M |
| 3300021362|Ga0213882_10266253 | Not Available | 712 | Open in IMG/M |
| 3300021374|Ga0213881_10062584 | Not Available | 1584 | Open in IMG/M |
| 3300021407|Ga0210383_11395780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300021478|Ga0210402_11770625 | Not Available | 544 | Open in IMG/M |
| 3300022557|Ga0212123_10000963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 85335 | Open in IMG/M |
| 3300022557|Ga0212123_10453777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300023250|Ga0224544_1003913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1998 | Open in IMG/M |
| 3300025432|Ga0208821_1001093 | All Organisms → cellular organisms → Bacteria | 16748 | Open in IMG/M |
| 3300025501|Ga0208563_1001360 | All Organisms → cellular organisms → Bacteria | 16739 | Open in IMG/M |
| 3300025898|Ga0207692_10478398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300025916|Ga0207663_11156903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300025919|Ga0207657_10769036 | Not Available | 746 | Open in IMG/M |
| 3300025921|Ga0207652_10378788 | Not Available | 1277 | Open in IMG/M |
| 3300025945|Ga0207679_10976644 | Not Available | 776 | Open in IMG/M |
| 3300025949|Ga0207667_10155926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2349 | Open in IMG/M |
| 3300026041|Ga0207639_10375523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300026078|Ga0207702_10173768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1978 | Open in IMG/M |
| 3300027660|Ga0209736_1205597 | Not Available | 510 | Open in IMG/M |
| 3300027842|Ga0209580_10531263 | Not Available | 585 | Open in IMG/M |
| 3300027879|Ga0209169_10082531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1661 | Open in IMG/M |
| 3300027889|Ga0209380_10010989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5252 | Open in IMG/M |
| 3300027895|Ga0209624_10415648 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027968|Ga0209061_1001490 | All Organisms → cellular organisms → Bacteria | 38300 | Open in IMG/M |
| 3300027968|Ga0209061_1002185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 26274 | Open in IMG/M |
| 3300027968|Ga0209061_1025371 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300027968|Ga0209061_1042706 | Not Available | 1955 | Open in IMG/M |
| 3300027968|Ga0209061_1100693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 1015 | Open in IMG/M |
| 3300028016|Ga0265354_1025894 | Not Available | 563 | Open in IMG/M |
| 3300028379|Ga0268266_11979305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300028906|Ga0308309_10556248 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300029913|Ga0311362_10324762 | Not Available | 1579 | Open in IMG/M |
| 3300030007|Ga0311338_10243919 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300030523|Ga0272436_1082555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300030523|Ga0272436_1106213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300030523|Ga0272436_1121770 | Not Available | 850 | Open in IMG/M |
| 3300030523|Ga0272436_1166299 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300030706|Ga0310039_10316355 | Not Available | 588 | Open in IMG/M |
| 3300030716|Ga0307920_103653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1419 | Open in IMG/M |
| 3300031452|Ga0272422_1014881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 6025 | Open in IMG/M |
| 3300031452|Ga0272422_1030690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3334 | Open in IMG/M |
| 3300031452|Ga0272422_1194294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300031520|Ga0272428_1003931 | All Organisms → cellular organisms → Bacteria | 26196 | Open in IMG/M |
| 3300031520|Ga0272428_1017398 | All Organisms → cellular organisms → Bacteria | 7984 | Open in IMG/M |
| 3300031520|Ga0272428_1024162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6079 | Open in IMG/M |
| 3300031670|Ga0307374_10001130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 50169 | Open in IMG/M |
| 3300031670|Ga0307374_10494348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300031681|Ga0318572_10777191 | Not Available | 570 | Open in IMG/M |
| 3300031708|Ga0310686_101468934 | Not Available | 3083 | Open in IMG/M |
| 3300031736|Ga0318501_10540966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 637 | Open in IMG/M |
| 3300031754|Ga0307475_11289193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300031939|Ga0308174_11187987 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031941|Ga0310912_10078312 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300031954|Ga0306926_11606557 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031962|Ga0307479_10083769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3087 | Open in IMG/M |
| 3300032059|Ga0318533_10983474 | Not Available | 619 | Open in IMG/M |
| 3300032076|Ga0306924_10186259 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300032160|Ga0311301_12414997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300032205|Ga0307472_102141275 | Not Available | 563 | Open in IMG/M |
| 3300032805|Ga0335078_11387206 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300033289|Ga0310914_10211164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1736 | Open in IMG/M |
| 3300034268|Ga0372943_0247430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1119 | Open in IMG/M |
| 3300034268|Ga0372943_0587592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 730 | Open in IMG/M |
| 3300034268|Ga0372943_1234067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.19% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 6.54% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 4.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.31% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.31% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.65% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.65% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005524 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027968 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030716 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031452 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_129689611 | 3300000789 | Soil | AIQEYIRENNKSPRPFQWVASANTIVRKVRKYKWTLETGD* |
| Ga0066388_1032184521 | 3300005332 | Tropical Forest Soil | IQDYIRRYNTNPQPFQWVASASKIIRKVNKYKETLETGD* |
| Ga0070659_1014277291 | 3300005366 | Corn Rhizosphere | LVKVIRDYIRHYNSDPRPFHWVASTSRILQKVRKYKRTLETGD* |
| Ga0070737_1000165531 | 3300005524 | Surface Soil | IHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD* |
| Ga0070737_100018151 | 3300005524 | Surface Soil | HDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD* |
| Ga0070737_1000862712 | 3300005524 | Surface Soil | IHDYLKDYNENPRPFRWIASASRIICKVNKYKAISETAD* |
| Ga0070737_100094341 | 3300005524 | Surface Soil | AIHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAG* |
| Ga0070737_100169481 | 3300005524 | Surface Soil | KDYNENPRPFRWIASASRIIRKVNKYKAISETAD* |
| Ga0070737_100292771 | 3300005524 | Surface Soil | LKDYNENPRPFRWIASASRIIRKVNKYKAISETAD* |
| Ga0070737_100600901 | 3300005524 | Surface Soil | DYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD* |
| Ga0070735_101185084 | 3300005534 | Surface Soil | HDYIRHYNKTPRPFHWVASASRIIRKVSKYKGTSETGD* |
| Ga0070735_108670871 | 3300005534 | Surface Soil | IHDYIRHYNKTPRPFHWVASASRIIRKVSKYKGTSETGD* |
| Ga0070730_100098111 | 3300005537 | Surface Soil | IQDYIRLYNKNPRPFQWVASASRIIRKVYKYKGTSETGD* |
| Ga0070733_102278411 | 3300005541 | Surface Soil | IQDYLRQYNKNPQPFQWVASASRIIRKVNKYKEISETGD* |
| Ga0070733_103174512 | 3300005541 | Surface Soil | LRQYNKNPQPFQWVASASRIIRKVNKYKEISETGD* |
| Ga0068855_1001279324 | 3300005563 | Corn Rhizosphere | IRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0068855_1005157161 | 3300005563 | Corn Rhizosphere | RHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0068855_1005289741 | 3300005563 | Corn Rhizosphere | RDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0070664_1003335301 | 3300005564 | Corn Rhizosphere | DYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0068856_1006373142 | 3300005614 | Corn Rhizosphere | AAIGDYIRTYNENPRPFQWIASASKIIRKVRKYKEISDA* |
| Ga0066903_1024872573 | 3300005764 | Tropical Forest Soil | QDYIRRYNRNPQPFRWVASASKIIRKVNKYKETLETED* |
| Ga0066903_1027688523 | 3300005764 | Tropical Forest Soil | DLTQAIQDYIQRYNRNPQPFRWVASASKIIRKVNKYKETLETED* |
| Ga0070717_102965853 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IQDYVRHYNKKPQPFRWVASAAKIIRKVNKYKRTLETGD* |
| Ga0070717_107014352 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LIKAISDYVRQYNRNPQPFQWIASASKIIRKVNKYKETLKTGD* |
| Ga0070717_108292392 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QDYVRHYNKKPQPFRWVASAAKIIRKVNKYKRTLETGD* |
| Ga0075029_1000887282 | 3300006052 | Watersheds | VRDLVKAIQEYIRENNKSPRPFQWVASANTIVRKVRKYKWSLQTGG* |
| Ga0075017_1002611224 | 3300006059 | Watersheds | YIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD* |
| Ga0075017_1012920242 | 3300006059 | Watersheds | IQEYIRENNKSPRPFQWVASANTIVRKVRKYKWTLETGD* |
| Ga0097621_1006626761 | 3300006237 | Miscanthus Rhizosphere | IRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0066660_107429542 | 3300006800 | Soil | KDYVRQYNNHPQPFQWIASASKIIRKVNKYKETLETGD* |
| Ga0079220_102712572 | 3300006806 | Agricultural Soil | RDLIKAIRDYVRQYNKNPQPFQWIASASKIIRKVNKYKET* |
| Ga0079220_107163101 | 3300006806 | Agricultural Soil | YVRQYNKNPQPFQWIASASKIIRKVNKYKETLETGD* |
| Ga0079220_116108621 | 3300006806 | Agricultural Soil | AIRDYVRQYNKNPQPFQWIASASKIIRKVNKYKETLETGD* |
| Ga0075425_1024311152 | 3300006854 | Populus Rhizosphere | DLIKTIHDYIRLYNKNPRPFQWVASASQIIRKVNKYKGISETGD* |
| Ga0073928_1003244311 | 3300006893 | Iron-Sulfur Acid Spring | IKDYVLHYNKNPQSFQWVATASKIIRKVNKYKETLETGD* |
| Ga0073928_100526584 | 3300006893 | Iron-Sulfur Acid Spring | AIKDYVLHYNKNPQSFQWVATASKIIRKVNKYKETLETGD* |
| Ga0073928_101595491 | 3300006893 | Iron-Sulfur Acid Spring | IHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGD* |
| Ga0073928_103903813 | 3300006893 | Iron-Sulfur Acid Spring | AIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGD* |
| Ga0073928_109750923 | 3300006893 | Iron-Sulfur Acid Spring | VLHYNKNPQPFQWVASASKIIRKVNIYKETLETGD* |
| Ga0099829_112030801 | 3300009038 | Vadose Zone Soil | YIRLYNKNPRPFQWVASASRITRKVDKYKGTSETGD* |
| Ga0066709_1042040811 | 3300009137 | Grasslands Soil | IRHYNKNPRPFQWVASASRIIKKVNKYKEILETGD* |
| Ga0116128_100067713 | 3300009518 | Peatland | AIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD* |
| Ga0116137_10725381 | 3300009549 | Peatland | IQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD* |
| Ga0116132_100152113 | 3300009646 | Peatland | QDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD* |
| Ga0116219_103868012 | 3300009824 | Peatlands Soil | DLVHAIQEYIRENNKSPRPFQWVARANTIIRKVRKYKWTLETGD* |
| Ga0116223_104203751 | 3300009839 | Peatlands Soil | SVRDLVHAIQEYIRENNKSPRPFQWVARANTIIRKVRKYKWTLETGD* |
| Ga0126384_106045573 | 3300010046 | Tropical Forest Soil | VRHYNRNSQPFQWVASASRIIRKVNKYRQGLETAD* |
| Ga0126378_100022341 | 3300010361 | Tropical Forest Soil | KAIQDYIQRYNRNPQPFRWIASASKIIRKVNKYKDTLETGD* |
| Ga0126379_109490263 | 3300010366 | Tropical Forest Soil | QDYIQHYNRNPQPFPWVASASKIIRKVNKYKETLETGD* |
| Ga0126379_109739041 | 3300010366 | Tropical Forest Soil | MTFKAIQDYIQHYNRNPQPFPWVASASKIIRKVNKYKETL |
| Ga0134128_101030034 | 3300010373 | Terrestrial Soil | HSVRELIKAIRDYIRHHNSSPRPFQWVASASQIIRKVSKYREILETGD* |
| Ga0134128_105373013 | 3300010373 | Terrestrial Soil | YIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0134128_108920322 | 3300010373 | Terrestrial Soil | RHHNSSPRPFQWVASASQIIRKVSKYKEILETGD* |
| Ga0134128_112005591 | 3300010373 | Terrestrial Soil | AIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD* |
| Ga0126381_1015760311 | 3300010376 | Tropical Forest Soil | IQDYIQHYNRNPQPFQWVASASKIIRKVNKYKETLETGD* |
| Ga0126381_1025745311 | 3300010376 | Tropical Forest Soil | SVRHLVHAIQDYIHENNKSPRPFQWVASANTIIRKVRKYKWTLETGD* |
| Ga0126381_1032779551 | 3300010376 | Tropical Forest Soil | DYIRENNKHPRPFQWVASANTIIRKVRKYKWTLETAD* |
| Ga0126381_1037497421 | 3300010376 | Tropical Forest Soil | DGYIQTYNQNPQPFRWVASASRIIRKVRKYKRTSETGH* |
| Ga0136449_1016327031 | 3300010379 | Peatlands Soil | DYIRIYNNNPRPFQWVASASRIIRKVNKYRRTSETPD* |
| Ga0137392_115808373 | 3300011269 | Vadose Zone Soil | AIQDYIRLYNKNPRPFQWVASASRIIRKVNKYKGTSETGD* |
| Ga0137393_103261072 | 3300011271 | Vadose Zone Soil | AIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGDYGQARIDG* |
| Ga0137393_111229582 | 3300011271 | Vadose Zone Soil | IKAIHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETED* |
| Ga0137358_102791811 | 3300012582 | Vadose Zone Soil | LVQAIQEYVRENNKNPRPFQWVASANTIVRKVRKSKWTLETGD* |
| Ga0157306_100212733 | 3300012912 | Soil | TIHDYIRLYNKNPRRFHWVANASRIIRKVNKHKGISETGD* |
| Ga0137359_117734111 | 3300012923 | Vadose Zone Soil | VRELIKTIHDYIRLYNNNPQPFQWVASASRIIRKVNKYKETSETGD* |
| Ga0126369_100818241 | 3300012971 | Tropical Forest Soil | AIQDYIQHYNRNPQPFPWVASASKIIRKVNKYKETLETGD* |
| Ga0126369_109769852 | 3300012971 | Tropical Forest Soil | DLTKAIQDYIQRYNRNPQPFRWVASASKIIRKVNKYKDTLETGD* |
| Ga0126369_113989491 | 3300012971 | Tropical Forest Soil | IQDYIQRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD* |
| Ga0181524_100330851 | 3300014155 | Bog | IHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD* |
| Ga0181538_102422391 | 3300014162 | Bog | RDLIKTIHDYIRHYNKNPRPFQWVASASRIIRKVSKYKGTSETED* |
| Ga0182018_105474391 | 3300014489 | Palsa | IHDYVRNYNRNPQPFHWVASASRIIRKVNRYKQTSETGD* |
| Ga0182024_1004816011 | 3300014501 | Permafrost | AIQDYIRLYNKNPQPFQWIASASRIIRKVNKYKGISETGD* |
| Ga0182024_128775722 | 3300014501 | Permafrost | IQDYIRLYNKNPRPFHWVASASRIIRKVNKYKGISDTGD* |
| Ga0132258_109836183 | 3300015371 | Arabidopsis Rhizosphere | VRDLIKAIRDYVRQYNRNPQPFQWVASASKIIRKINKYKETLETGD* |
| Ga0182040_101235873 | 3300016387 | Soil | ELTKAIQDYIQRYNRNSQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0182038_100256061 | 3300016445 | Soil | IQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0187856_100176314 | 3300017925 | Peatland | AIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD |
| Ga0187819_100019031 | 3300017943 | Freshwater Sediment | IHRYNRNPQPFQWIASASKIIRKVNKYKETLETGD |
| Ga0187817_100271051 | 3300017955 | Freshwater Sediment | IQDYIHRYNRNPQPFQWIASASKIIRKVNKYKETLETGD |
| Ga0187817_104148532 | 3300017955 | Freshwater Sediment | AIQDYIHRYNRNPQPFQWIASASKIIRKVNKYKETLETGD |
| Ga0187815_100690211 | 3300018001 | Freshwater Sediment | DYIRLYNKKPRPFQWIASASQIIRKVNKYKDTSETRD |
| Ga0187815_102873171 | 3300018001 | Freshwater Sediment | YLRQYNKNPQPFQWVASASRIIRKVNKYKEISETGD |
| Ga0187766_111964901 | 3300018058 | Tropical Peatland | TKAIHEYIRIYNNKPRPFQWVASASRIIRKVNKYRQTSETAD |
| Ga0187770_105575311 | 3300018090 | Tropical Peatland | DYIQRYNRDPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0190275_100168294 | 3300018432 | Soil | IKDYVRHYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0190275_100576661 | 3300018432 | Soil | TIKDYVRHYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0190270_111449482 | 3300018469 | Soil | WTIKDYVRHYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0210403_107866292 | 3300020580 | Soil | KAIQDYVQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0210401_106931841 | 3300020583 | Soil | LIKTIHDYIRHYNQNPRPFQWVASASRIIRKVRKYKGTSESGH |
| Ga0210405_100647464 | 3300021171 | Soil | KTIHDYIRLYNKNPRPFQWVASASRIIRKVNKYKETSETGD |
| Ga0213882_102662531 | 3300021362 | Exposed Rock | KAIHDYIRFYNQNPQPFQWVASASRIIRKVRKYKEISDTED |
| Ga0213881_100625841 | 3300021374 | Exposed Rock | TAIHDYIRVYNKNPQPFHWVASASRIIRKVRNYKETSDTGD |
| Ga0210383_113957801 | 3300021407 | Soil | KAIHDYIRHYNKNPRPFQWVASASRIIRKVSKYKGTSETGD |
| Ga0210402_117706251 | 3300021478 | Soil | KTIHDYIRLYNKNPRPFQWVASASRIIRKVNKYKGTSETAD |
| Ga0212123_100009631 | 3300022557 | Iron-Sulfur Acid Spring | IKDYVLHYNKNPQSFQWVATASKIIRKVNKYKETLETGD |
| Ga0212123_104537771 | 3300022557 | Iron-Sulfur Acid Spring | IHEYVQRYNRNPQPFHWVASASKIIRKVNKYKQTLETGD |
| Ga0224544_10039133 | 3300023250 | Soil | EAIHDYVRNYNRNPQPFHWVASASRIIRKVNRYKQTSETGD |
| Ga0208821_100109314 | 3300025432 | Peatland | KAIQDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD |
| Ga0208563_100136014 | 3300025501 | Peatland | QDYIHRYNRNPQPFQWVVSASKIIRKVNKYKETLETGD |
| Ga0207692_104783981 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DLVKAIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLERED |
| Ga0207663_111569033 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIQNYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETED |
| Ga0207657_107690362 | 3300025919 | Corn Rhizosphere | DYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD |
| Ga0207652_103787882 | 3300025921 | Corn Rhizosphere | KTIQDYIRLYNKNPRPFQWVASASRIIRKVNKYKGTSETGD |
| Ga0207679_109766441 | 3300025945 | Corn Rhizosphere | KAIRDYIRIYNNDPHPFQWFSSASRIIRKVAKYRKSERAD |
| Ga0207667_101559265 | 3300025949 | Corn Rhizosphere | IRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD |
| Ga0207639_103755231 | 3300026041 | Corn Rhizosphere | IRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD |
| Ga0207702_101737682 | 3300026078 | Corn Rhizosphere | TAAIGDYIRTYNENPRPFQWIASASKIIRKVRKYKEISDA |
| Ga0209736_12055971 | 3300027660 | Forest Soil | MHDLVRAVYDYVGNYNRKPQPWVASASRIIRKVNRYKETSETED |
| Ga0209580_105312632 | 3300027842 | Surface Soil | KAIRDYVRQYNKNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0209169_100825311 | 3300027879 | Soil | RSVRNLVHAIHDYVRHYNRNPQPFHWVASASRIVRKVNAYKQTSETAD |
| Ga0209380_100109896 | 3300027889 | Soil | DYVRHYNRNPRPFHWVASASRIVRKVNAYKQTSETAD |
| Ga0209624_104156481 | 3300027895 | Forest Soil | IRTYNYNPRPFHWVASASRIIRKINKYRRTSETAD |
| Ga0209061_10014901 | 3300027968 | Surface Soil | IHDYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD |
| Ga0209061_100218532 | 3300027968 | Surface Soil | HDYLKDYNENPRPFRWIASASQIIRKVNKYKAISETAD |
| Ga0209061_10253716 | 3300027968 | Surface Soil | LKDYNENPRPFRWIASASRIIRKVNKYKAISETAD |
| Ga0209061_10427061 | 3300027968 | Surface Soil | DYLKDYNENPRPFRWIASASRIIRKVNKYKAISETAD |
| Ga0209061_11006931 | 3300027968 | Surface Soil | RKDYNENPRPFRWIASASRIICKVNKYKAISETAD |
| Ga0265354_10258941 | 3300028016 | Rhizosphere | VRDLVLSIHDYVRNYNRNPRPFHWVASASRIIRKVNRYKDT |
| Ga0268266_119793052 | 3300028379 | Switchgrass Rhizosphere | KAIRDYIRHYNNNPRPFHWVAGASKIIRKVSKYKETLETGD |
| Ga0308309_105562481 | 3300028906 | Soil | AIQNYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETED |
| Ga0311362_103247621 | 3300029913 | Bog | ATGIRTYNENPKPFQWVASASRIIRKVRKYKRTSESAD |
| Ga0311338_102439194 | 3300030007 | Palsa | KAIQDYIRLYNKNPQPFQWIASASRIIRKVNKYKGISETGD |
| Ga0272436_10825552 | 3300030523 | Rock | RDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272436_11062133 | 3300030523 | Rock | YIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272436_11217703 | 3300030523 | Rock | DYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272436_11662991 | 3300030523 | Rock | IRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0310039_103163551 | 3300030706 | Peatlands Soil | KEIHDYIRIYNNNPRPFQWVASASRIIRKVNKYRRTSETPD |
| Ga0307920_1036531 | 3300030716 | Soil | IQDYIQCYNRNPRPFQWVASASKIIRKVNKYKETLETGD |
| Ga0272422_10148811 | 3300031452 | Rock | AIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272422_10306905 | 3300031452 | Rock | KAIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272422_11942942 | 3300031452 | Rock | RVRDLIKAIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272428_100393121 | 3300031520 | Rock | YIRDYIRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272428_10173985 | 3300031520 | Rock | DLIKAIRDYISDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0272428_10241621 | 3300031520 | Rock | IRDHNNSPRPFQWVASASQIIRKVSKYKGILETGD |
| Ga0307374_100011301 | 3300031670 | Soil | KAIQDYIQCYNRNPRPFQWVASASKIIRKVNKYKETLETGD |
| Ga0307374_104943483 | 3300031670 | Soil | AIQDYIQCYNRNPRPFQWVASASKIIRKVNKYKETLETGD |
| Ga0318572_107771911 | 3300031681 | Soil | KAIQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0310686_1014689341 | 3300031708 | Soil | KTIHDYIRLYNKNPRPFQWVASASRIIRKVNKYKDISETGD |
| Ga0318501_105409662 | 3300031736 | Soil | TKAIQDYIQGYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0307475_112891931 | 3300031754 | Hardwood Forest Soil | AIQNYLQPYNRNPQPFQWVASASKIIRKVNKYKETLETED |
| Ga0308174_111879873 | 3300031939 | Soil | RELIKAIRDYIRHHNSSPRPFQWVASASQIIRKVSKYKEILETGA |
| Ga0310912_100783121 | 3300031941 | Soil | AIQDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0306926_116065571 | 3300031954 | Soil | TFRSVRELIRAIKDYVRIYTKNPQPFQCVATANQIAWKVNKYKETLEKGD |
| Ga0307479_100837691 | 3300031962 | Hardwood Forest Soil | MAIQNYLQRYNRNPQPFQWVASASKIIRKVNKYKETLETED |
| Ga0318533_109834743 | 3300032059 | Soil | IQHYNQNPKPFQWVASASKIIRKVNKYKETLETGD |
| Ga0306924_101862591 | 3300032076 | Soil | QDYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETGD |
| Ga0311301_124149971 | 3300032160 | Peatlands Soil | LIQAINDYIRLYNKKPRPFQWIASASQIIRKVNKYKDTSETGD |
| Ga0307472_1021412751 | 3300032205 | Hardwood Forest Soil | KTIHDYIRIYNKNPRPFQWVASASRIIRKVNKYKETSETVD |
| Ga0335078_113872061 | 3300032805 | Soil | TAIQDYIRLYNKNPRPFQWVASASRIIRKVSKYKGISDTGD |
| Ga0310914_102111643 | 3300033289 | Soil | DYIQRYNRNPQPFQWVASASKIIRKVNKYKETLETED |
| Ga0372943_0247430_1003_1119 | 3300034268 | Soil | NDYIRHYNKNPRPFHWVASASQIIRKVRKYKEISDTAD |
| Ga0372943_0587592_1_126 | 3300034268 | Soil | TAIHDYIRLYNKNPQPFRWVASASRIIRKVHKYKEISDTGD |
| Ga0372943_1234067_380_499 | 3300034268 | Soil | IKDYVRQYNKNPQPFQWIASASKIIRKVNKYKETLETGD |
| ⦗Top⦘ |