


| Basic Information | |
|---|---|
| Family ID | F045064 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTKDKSPINFDKTIAGFNITEHGVKSYTKSIKLGPFQVTLN |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 28.29 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.170 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.405 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (49.673 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 31.88% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF02511 | Thy1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.17 % |
| All Organisms | root | All Organisms | 41.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10261167 | Not Available | 523 | Open in IMG/M |
| 3300001687|WOR8_10030804 | All Organisms → Viruses | 7072 | Open in IMG/M |
| 3300004448|Ga0065861_1150418 | Not Available | 553 | Open in IMG/M |
| 3300005527|Ga0068876_10135876 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300006025|Ga0075474_10131706 | All Organisms → Viruses | 792 | Open in IMG/M |
| 3300006026|Ga0075478_10150496 | Not Available | 726 | Open in IMG/M |
| 3300006637|Ga0075461_10245151 | Not Available | 527 | Open in IMG/M |
| 3300006639|Ga0079301_1061543 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1196 | Open in IMG/M |
| 3300006641|Ga0075471_10648548 | Not Available | 516 | Open in IMG/M |
| 3300006734|Ga0098073_1005867 | All Organisms → Viruses → Predicted Viral | 2452 | Open in IMG/M |
| 3300006734|Ga0098073_1019325 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300006734|Ga0098073_1038629 | Not Available | 655 | Open in IMG/M |
| 3300006790|Ga0098074_1028839 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
| 3300006790|Ga0098074_1179842 | All Organisms → Viruses | 531 | Open in IMG/M |
| 3300006810|Ga0070754_10441797 | Not Available | 565 | Open in IMG/M |
| 3300006870|Ga0075479_10104759 | All Organisms → Viruses → Predicted Viral | 1173 | Open in IMG/M |
| 3300006916|Ga0070750_10315836 | All Organisms → Viruses | 665 | Open in IMG/M |
| 3300007216|Ga0103961_1275341 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300007344|Ga0070745_1218212 | Not Available | 699 | Open in IMG/M |
| 3300007344|Ga0070745_1323966 | Not Available | 545 | Open in IMG/M |
| 3300007345|Ga0070752_1232016 | Not Available | 724 | Open in IMG/M |
| 3300007345|Ga0070752_1333588 | Not Available | 572 | Open in IMG/M |
| 3300007538|Ga0099851_1194469 | Not Available | 740 | Open in IMG/M |
| 3300007539|Ga0099849_1091343 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300007539|Ga0099849_1235771 | Not Available | 677 | Open in IMG/M |
| 3300007539|Ga0099849_1291873 | Not Available | 590 | Open in IMG/M |
| 3300007541|Ga0099848_1102284 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300007541|Ga0099848_1185450 | Not Available | 753 | Open in IMG/M |
| 3300007541|Ga0099848_1230976 | Not Available | 653 | Open in IMG/M |
| 3300007541|Ga0099848_1333021 | All Organisms → Viruses | 515 | Open in IMG/M |
| 3300007542|Ga0099846_1197018 | All Organisms → Viruses | 712 | Open in IMG/M |
| 3300007542|Ga0099846_1306825 | All Organisms → Viruses | 543 | Open in IMG/M |
| 3300007640|Ga0070751_1051316 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
| 3300007960|Ga0099850_1021443 | All Organisms → Viruses → Predicted Viral | 2864 | Open in IMG/M |
| 3300007960|Ga0099850_1114360 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300007960|Ga0099850_1253543 | Not Available | 678 | Open in IMG/M |
| 3300007960|Ga0099850_1289050 | Not Available | 624 | Open in IMG/M |
| 3300007960|Ga0099850_1350526 | Not Available | 553 | Open in IMG/M |
| 3300007960|Ga0099850_1370281 | Not Available | 534 | Open in IMG/M |
| 3300009159|Ga0114978_10869480 | All Organisms → Viruses | 505 | Open in IMG/M |
| 3300009169|Ga0105097_10827182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
| 3300009170|Ga0105096_10077420 | All Organisms → Viruses → Predicted Viral | 1651 | Open in IMG/M |
| 3300009466|Ga0126448_1069026 | Not Available | 804 | Open in IMG/M |
| 3300009466|Ga0126448_1146857 | Not Available | 533 | Open in IMG/M |
| 3300010296|Ga0129348_1210758 | Not Available | 659 | Open in IMG/M |
| 3300010296|Ga0129348_1235611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 617 | Open in IMG/M |
| 3300010296|Ga0129348_1324041 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 513 | Open in IMG/M |
| 3300010299|Ga0129342_1221783 | Not Available | 666 | Open in IMG/M |
| 3300010299|Ga0129342_1221947 | All Organisms → Viruses | 665 | Open in IMG/M |
| 3300010299|Ga0129342_1229925 | Not Available | 651 | Open in IMG/M |
| 3300010318|Ga0136656_1157573 | Not Available | 774 | Open in IMG/M |
| 3300010354|Ga0129333_10209277 | Not Available | 1771 | Open in IMG/M |
| 3300010354|Ga0129333_10255580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1578 | Open in IMG/M |
| 3300010354|Ga0129333_10672548 | Not Available | 892 | Open in IMG/M |
| 3300010354|Ga0129333_10882314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 758 | Open in IMG/M |
| 3300010354|Ga0129333_11362398 | Not Available | 584 | Open in IMG/M |
| 3300010354|Ga0129333_11423000 | Not Available | 570 | Open in IMG/M |
| 3300010354|Ga0129333_11679122 | Not Available | 517 | Open in IMG/M |
| 3300010368|Ga0129324_10201441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 808 | Open in IMG/M |
| 3300010370|Ga0129336_10541699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 625 | Open in IMG/M |
| 3300010389|Ga0136549_10126626 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300010389|Ga0136549_10233467 | Not Available | 787 | Open in IMG/M |
| 3300012953|Ga0163179_10063031 | Not Available | 2584 | Open in IMG/M |
| 3300013087|Ga0163212_1189123 | Not Available | 645 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10500835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 804 | Open in IMG/M |
| 3300013372|Ga0177922_10666232 | Not Available | 547 | Open in IMG/M |
| 3300013372|Ga0177922_10979497 | Not Available | 748 | Open in IMG/M |
| 3300017707|Ga0181363_1082417 | Not Available | 549 | Open in IMG/M |
| 3300017716|Ga0181350_1065948 | Not Available | 936 | Open in IMG/M |
| 3300017716|Ga0181350_1145493 | Not Available | 555 | Open in IMG/M |
| 3300017747|Ga0181352_1029557 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300017761|Ga0181356_1060039 | Not Available | 1294 | Open in IMG/M |
| 3300017777|Ga0181357_1186317 | Not Available | 748 | Open in IMG/M |
| 3300017785|Ga0181355_1199352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 787 | Open in IMG/M |
| 3300017785|Ga0181355_1253656 | Not Available | 674 | Open in IMG/M |
| 3300017986|Ga0181569_10727694 | Not Available | 655 | Open in IMG/M |
| 3300018424|Ga0181591_10510329 | Not Available | 875 | Open in IMG/M |
| 3300018682|Ga0188851_1006068 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1715 | Open in IMG/M |
| 3300019753|Ga0194010_1040927 | Not Available | 737 | Open in IMG/M |
| 3300020074|Ga0194113_11157621 | Not Available | 507 | Open in IMG/M |
| 3300020084|Ga0194110_10855757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 545 | Open in IMG/M |
| 3300020151|Ga0211736_10745400 | All Organisms → Viruses → Predicted Viral | 3359 | Open in IMG/M |
| 3300020183|Ga0194115_10358350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 642 | Open in IMG/M |
| 3300020196|Ga0194124_10171091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1147 | Open in IMG/M |
| 3300020196|Ga0194124_10390312 | Not Available | 640 | Open in IMG/M |
| 3300020214|Ga0194132_10087346 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2060 | Open in IMG/M |
| 3300020221|Ga0194127_10924458 | Not Available | 529 | Open in IMG/M |
| 3300020222|Ga0194125_10298074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1070 | Open in IMG/M |
| 3300021091|Ga0194133_10119357 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1963 | Open in IMG/M |
| 3300021376|Ga0194130_10626460 | Not Available | 530 | Open in IMG/M |
| 3300021379|Ga0213864_10033492 | Not Available | 2404 | Open in IMG/M |
| 3300021963|Ga0222712_10424945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 802 | Open in IMG/M |
| 3300022176|Ga0212031_1093771 | All Organisms → Viruses | 513 | Open in IMG/M |
| 3300022187|Ga0196899_1043681 | Not Available | 1503 | Open in IMG/M |
| 3300022190|Ga0181354_1200663 | Not Available | 594 | Open in IMG/M |
| 3300022198|Ga0196905_1040070 | Not Available | 1369 | Open in IMG/M |
| 3300022200|Ga0196901_1254918 | Not Available | 543 | Open in IMG/M |
| 3300024357|Ga0255165_1024500 | Not Available | 1109 | Open in IMG/M |
| 3300024481|Ga0256330_1088859 | Not Available | 653 | Open in IMG/M |
| 3300025610|Ga0208149_1028503 | Not Available | 1544 | Open in IMG/M |
| 3300025646|Ga0208161_1043738 | Not Available | 1482 | Open in IMG/M |
| 3300025655|Ga0208795_1106279 | Not Available | 746 | Open in IMG/M |
| 3300025655|Ga0208795_1159793 | All Organisms → Viruses | 555 | Open in IMG/M |
| 3300025671|Ga0208898_1181330 | Not Available | 531 | Open in IMG/M |
| 3300025674|Ga0208162_1085474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 967 | Open in IMG/M |
| 3300025759|Ga0208899_1126624 | Not Available | 909 | Open in IMG/M |
| 3300025769|Ga0208767_1105660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 1116 | Open in IMG/M |
| 3300025815|Ga0208785_1155522 | Not Available | 520 | Open in IMG/M |
| 3300025848|Ga0208005_1236105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 564 | Open in IMG/M |
| 3300025853|Ga0208645_1102562 | Not Available | 1181 | Open in IMG/M |
| 3300025889|Ga0208644_1165152 | Not Available | 999 | Open in IMG/M |
| 3300027114|Ga0208009_1032814 | Not Available | 1070 | Open in IMG/M |
| 3300027138|Ga0255064_1044718 | All Organisms → Viruses | 708 | Open in IMG/M |
| 3300027693|Ga0209704_1016297 | Not Available | 1844 | Open in IMG/M |
| 3300027693|Ga0209704_1081733 | Not Available | 908 | Open in IMG/M |
| 3300027804|Ga0209358_10068317 | All Organisms → Viruses → Predicted Viral | 2046 | Open in IMG/M |
| 3300027816|Ga0209990_10238248 | All Organisms → Viruses | 832 | Open in IMG/M |
| 3300027917|Ga0209536_102883247 | Not Available | 558 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1258929 | Not Available | 560 | Open in IMG/M |
| 3300029306|Ga0135212_1011610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S04-C348 | 793 | Open in IMG/M |
| 3300029345|Ga0135210_1011179 | All Organisms → Viruses | 813 | Open in IMG/M |
| 3300031539|Ga0307380_10950186 | Not Available | 692 | Open in IMG/M |
| 3300031539|Ga0307380_10972231 | Not Available | 681 | Open in IMG/M |
| 3300031539|Ga0307380_11263332 | Not Available | 567 | Open in IMG/M |
| 3300031566|Ga0307378_10991182 | Not Available | 685 | Open in IMG/M |
| 3300031566|Ga0307378_11317774 | Not Available | 562 | Open in IMG/M |
| 3300031578|Ga0307376_10073673 | All Organisms → Viruses → Predicted Viral | 2438 | Open in IMG/M |
| 3300031669|Ga0307375_10322909 | Not Available | 982 | Open in IMG/M |
| 3300031669|Ga0307375_10648874 | Not Available | 615 | Open in IMG/M |
| 3300031669|Ga0307375_10714386 | All Organisms → Viruses | 576 | Open in IMG/M |
| 3300031673|Ga0307377_10326096 | Not Available | 1157 | Open in IMG/M |
| 3300031673|Ga0307377_10834775 | All Organisms → Viruses | 634 | Open in IMG/M |
| 3300031673|Ga0307377_10844252 | All Organisms → Viruses | 629 | Open in IMG/M |
| 3300031746|Ga0315293_10204055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1624 | Open in IMG/M |
| 3300031787|Ga0315900_10855028 | Not Available | 618 | Open in IMG/M |
| 3300031857|Ga0315909_10265520 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
| 3300031951|Ga0315904_10801020 | Not Available | 775 | Open in IMG/M |
| 3300033557|Ga0316617_101955732 | Not Available | 601 | Open in IMG/M |
| 3300033980|Ga0334981_0250929 | Not Available | 802 | Open in IMG/M |
| 3300033981|Ga0334982_0279348 | Not Available | 793 | Open in IMG/M |
| 3300033994|Ga0334996_0313721 | Not Available | 774 | Open in IMG/M |
| 3300033994|Ga0334996_0476478 | Not Available | 565 | Open in IMG/M |
| 3300034021|Ga0335004_0329062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 892 | Open in IMG/M |
| 3300034066|Ga0335019_0689961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 587 | Open in IMG/M |
| 3300034073|Ga0310130_0114107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 816 | Open in IMG/M |
| 3300034073|Ga0310130_0303844 | Not Available | 508 | Open in IMG/M |
| 3300034103|Ga0335030_0526979 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 740 | Open in IMG/M |
| 3300034109|Ga0335051_0334260 | Not Available | 728 | Open in IMG/M |
| 3300034112|Ga0335066_0045871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2938 | Open in IMG/M |
| 3300034116|Ga0335068_0194564 | Not Available | 1068 | Open in IMG/M |
| 3300034119|Ga0335054_0765509 | Not Available | 512 | Open in IMG/M |
| 3300034375|Ga0348336_019858 | All Organisms → Viruses → Predicted Viral | 3524 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 29.41% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.15% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.50% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 7.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.19% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.31% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.31% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.31% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.31% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.31% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.31% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.31% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.65% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.65% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.65% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.65% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.65% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019753 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
| 3300029345 | Marine harbor viral communities from the Indian Ocean - SCH1 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_102611673 | 3300000116 | Marine | MSNEKSPINFDKTIAGFNVTEHGIKSYSKSFSLGP |
| WOR8_100308041 | 3300001687 | Marine Sediment | MTQHKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQ |
| Ga0065861_11504182 | 3300004448 | Marine | MTKKSPINFDKTVAGFNITERGVRSFTKSIQLGPFQITLNARDSGV |
| Ga0068876_101358761 | 3300005527 | Freshwater Lake | MTKDKSPINFDKTIAGFNITENGVKSYTKSFQLGPFQLTLNARDSGVRGS |
| Ga0075474_101317061 | 3300006025 | Aqueous | MTKPKSSINFDRTIAGFNVTEHGVQSYSKSIKLGPLQLTINARGSGVRGSIS |
| Ga0075478_101504963 | 3300006026 | Aqueous | MTNKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQV |
| Ga0075461_102451512 | 3300006637 | Aqueous | MTKDKSPLNFDKTIAGFNVTERGIQSYTKSFQLGPFQL |
| Ga0079301_10615432 | 3300006639 | Deep Subsurface | MTHKKSLISFDRTIHGVNITEHGVKSFTKSIKLGPLQLTLNANPN |
| Ga0075471_106485481 | 3300006641 | Aqueous | MTQKKSPINFDKTIAGFNVTERGIKSFTKSIKLGPFQVTFNAR |
| Ga0098073_10058671 | 3300006734 | Marine | MTKDKSPLNFDKTIAGFNVTERGIQSYTKSFQLGPF |
| Ga0098073_10193254 | 3300006734 | Marine | MSQPKSPLNFDRTIGGFNITEHGVKSYTKSIKLGPFQ |
| Ga0098073_10386291 | 3300006734 | Marine | MSDKSPINFDKTIAGFNITEHGVKSYTKSFQLGPIQFT |
| Ga0098074_10288391 | 3300006790 | Marine | MTSERSAFNFDKTIAGLNITERGVKSYSKSIKLGPLQFTVNVRGSGIRG |
| Ga0098074_11798423 | 3300006790 | Marine | MPDKKSPINFDKTIAGFNFTERGIKSYSKSFSLGPF |
| Ga0070754_104417973 | 3300006810 | Aqueous | MTQHKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQVTLNARGSGI |
| Ga0075479_101047591 | 3300006870 | Aqueous | MTKPKSAINFDRTIAGFNVTEHGVQSYTKSIKLGPLQLTINARGSGVRGSI |
| Ga0070750_103158361 | 3300006916 | Aqueous | MTKPKSTINFDRTIAGFNVTEHGVQSYTKSIKLGPLQLTINARGSG |
| Ga0103961_12753411 | 3300007216 | Freshwater Lake | MTERSAFNFDRTIAGVNITEHGIKSFTKSIRLGPIQFTLNARKS |
| Ga0070745_12182121 | 3300007344 | Aqueous | MTQDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLT |
| Ga0070745_13239663 | 3300007344 | Aqueous | MTQDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTL |
| Ga0070752_12320163 | 3300007345 | Aqueous | MTKDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTLNA |
| Ga0070752_13335882 | 3300007345 | Aqueous | MTKPKSTINFDRTIAGFNVTEHGVQSYTKSIKLGPL |
| Ga0099851_11944693 | 3300007538 | Aqueous | MSQPKSPLNFDRTIGGFNITEHGVKSYTKSIKLGPFQLT |
| Ga0099849_10913434 | 3300007539 | Aqueous | MADKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQVTLNARGS |
| Ga0099849_12357713 | 3300007539 | Aqueous | MTKDKSPINFDKTIAGFNVTERGIKSYSKSFSLGPFR |
| Ga0099849_12918731 | 3300007539 | Aqueous | MTDKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQVTLNAR |
| Ga0099848_11022844 | 3300007541 | Aqueous | MTQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSGV |
| Ga0099848_11854501 | 3300007541 | Aqueous | MAQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSGVRGSIG |
| Ga0099848_12309762 | 3300007541 | Aqueous | MADKSFFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSGV |
| Ga0099848_13330212 | 3300007541 | Aqueous | MTDKSSFNFDKTIAGFNITEHGIKSFSKSLKLGPFQITLNARESGIRGSIGI |
| Ga0099846_11970181 | 3300007542 | Aqueous | MTDKSSFNFDKTIAGFNITEHGIKSFSKSLKLGPFQITLNARESGI |
| Ga0099846_13068251 | 3300007542 | Aqueous | MTDKKSPINFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNARESGVRGSI |
| Ga0070751_10513165 | 3300007640 | Aqueous | MTQDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTLNARESGVRGSIS |
| Ga0099850_10214439 | 3300007960 | Aqueous | MTEKSSFNFDKTIAGFNITEHGIKSFSKSLKLGPFQITLNARGS |
| Ga0099850_11143604 | 3300007960 | Aqueous | MAQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSGVRGS |
| Ga0099850_12535433 | 3300007960 | Aqueous | MTDKKSPINFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNARESGV |
| Ga0099850_12890501 | 3300007960 | Aqueous | MTEKSSFNFDKTIAGFNITEHGVKSYSKTIKLGPFQVTL |
| Ga0099850_13505262 | 3300007960 | Aqueous | MADKSFFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSGVRGS |
| Ga0099850_13702812 | 3300007960 | Aqueous | MSQPKSPLNFDRTIGGFNITEHGVKSYTKSIKLGPFQLTLNAR |
| Ga0114978_108694802 | 3300009159 | Freshwater Lake | MTKKSIVNFDKTITGFNITERGVKSFTKSFKLGPFQLTLNA |
| Ga0105097_108271821 | 3300009169 | Freshwater Sediment | MTEKSPINFDKTIAGFNVTERGIKSFTKSIQLGPFQVTLNARESGVR |
| Ga0105096_100774206 | 3300009170 | Freshwater Sediment | MTDKSPINFDKTIAGFNLTEHGIKSFTKSIQLGPFQVTL |
| Ga0126448_10690263 | 3300009466 | Meromictic Pond | MTKDKSPLNFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTLNA |
| Ga0126448_11468571 | 3300009466 | Meromictic Pond | MSNEKSSINFDKTIAGFNVTERGIKSYSKSFSLGPFQ |
| Ga0129348_12107583 | 3300010296 | Freshwater To Marine Saline Gradient | MTDRKSPINFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNARESGVRG |
| Ga0129348_12356111 | 3300010296 | Freshwater To Marine Saline Gradient | MTSERSAFNFDKTIAGLNITERGVKSYSKSIKLGPLQFTVNV |
| Ga0129348_13240411 | 3300010296 | Freshwater To Marine Saline Gradient | MTQKKSPINFDKTIAGFNITERGVKSYTKSFKLGPFQLTLNARDSGVR |
| Ga0129342_12217831 | 3300010299 | Freshwater To Marine Saline Gradient | MTQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSG |
| Ga0129342_12219473 | 3300010299 | Freshwater To Marine Saline Gradient | MTERSAFNFDKTIAGFSITERGIKSWSKSFKVGPFNLTLNA |
| Ga0129342_12299251 | 3300010299 | Freshwater To Marine Saline Gradient | MTQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFN |
| Ga0136656_11575731 | 3300010318 | Freshwater To Marine Saline Gradient | MTDKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQV |
| Ga0129333_102092771 | 3300010354 | Freshwater To Marine Saline Gradient | MTKDKSPISFDKTIAGFNITENGIKSYSKSFQLGPFQFTVNARESGVRG |
| Ga0129333_102555801 | 3300010354 | Freshwater To Marine Saline Gradient | MTDKSPINFDKTIAGFNITEHGIKSFTKSIQLGPFQVTLNARESG |
| Ga0129333_106725481 | 3300010354 | Freshwater To Marine Saline Gradient | MTKKSPINFDRTIAGFNITEHGIKSYTKSFQLGPFQLTLNAK |
| Ga0129333_108823141 | 3300010354 | Freshwater To Marine Saline Gradient | MTKDKLPINFDKTIAGFNITEHGIKSFTKSIQLGPFQVTLNARESG |
| Ga0129333_113623983 | 3300010354 | Freshwater To Marine Saline Gradient | MTEKSSFNFDKTIAGFNITERGIKSFSKSLKLGPFQITLNARESGIRGSIGI |
| Ga0129333_114230003 | 3300010354 | Freshwater To Marine Saline Gradient | MTKDKSPISFDKTIAGFNITENGIKSYSKSFQLGPFQFTVNARESGV |
| Ga0129333_116791222 | 3300010354 | Freshwater To Marine Saline Gradient | MTRKSIINFDRTIHGVNITEHGIKSLTKAIKLGPFQVTLNANPNGVKG |
| Ga0129324_102014411 | 3300010368 | Freshwater To Marine Saline Gradient | MTSERSAFNFDKTIAGLNITERGVKSYSKSIKLGPLQFTVNVRGS |
| Ga0129336_105416993 | 3300010370 | Freshwater To Marine Saline Gradient | MTDKSPINFDKTIAGFNITEHGIKSFTKSIQLGPFQV |
| Ga0136549_101266264 | 3300010389 | Marine Methane Seep Sediment | VTQERSPLNFDKTIAGFNVTERGIQSYSKSFQLGPFQLTLNARE |
| Ga0136549_102334671 | 3300010389 | Marine Methane Seep Sediment | MTQDKSPINFDKTIAGFNVTERGVQSYTKSFQLGPFQLTLNARESGVRGS |
| Ga0163179_100630311 | 3300012953 | Seawater | MPKRKRSAFNFDKTIFGVNVTERGPQSASKTIKLGPLSVTLNGRKSGVR |
| Ga0163212_11891231 | 3300013087 | Freshwater | MTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQFTLNARPSG |
| (restricted) Ga0172372_105008351 | 3300013132 | Freshwater | MTERSAFNFDKTIAGVNVTEHGIKSFTKSIRLGPIQFTLNARPSGML |
| Ga0177922_106662321 | 3300013372 | Freshwater | MTQKKSLINFDKTIAGFNITERGIKSYTKSIKLGPFQVTFNARESGVH |
| Ga0177922_109794973 | 3300013372 | Freshwater | MTQKKSPINFDKTIAGFNITERGVKSYTKSIKLGPFQVTF |
| Ga0181363_10824172 | 3300017707 | Freshwater Lake | VTKKSLISFDRTIHGVNITEHGIKSVSKQIKLGPFQLTVN |
| Ga0181350_10659481 | 3300017716 | Freshwater Lake | MTKPKSAFNFDKTIAGFNITENGIKSFTKTIQLGPLQLTFNT |
| Ga0181350_11454931 | 3300017716 | Freshwater Lake | MTDKSPINFDKTVAGFNITERGVRSFTKSIQLGPFQITLNA |
| Ga0181352_10295575 | 3300017747 | Freshwater Lake | MTKDKSPINFDKTIAGFNITEHGVKSYTKSIKLGPFQVTL |
| Ga0181356_10600394 | 3300017761 | Freshwater Lake | MTKPKSAFNFDKVIAGFNITENGIKSFTKTIKVGPFQLTLNTRGTGIN |
| Ga0181357_11863171 | 3300017777 | Freshwater Lake | MTKPKSAFNFDKTIAGFNITENGIKSFTKTIQLGPLQLT |
| Ga0181355_11993521 | 3300017785 | Freshwater Lake | MTKPKSAFNFDKVIAGFNITENGIKSFTKTIKVGPFQLT |
| Ga0181355_12536561 | 3300017785 | Freshwater Lake | MTRKSPLSFDRTIHGVNITEHGIKSVSKQIKLGPFQLTVNASPNGVKGSVS |
| Ga0181569_107276943 | 3300017986 | Salt Marsh | MTQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRG |
| Ga0181591_105103293 | 3300018424 | Salt Marsh | MANKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQVTLN |
| Ga0188851_10060685 | 3300018682 | Freshwater Lake | MTKPKSPINFDRTIAGVNITENGIKSYTKSFKLGPFQLTLNARESGVLGS |
| Ga0194010_10409271 | 3300019753 | Sediment | MTDKSSFNFDKTIAGFNITEHGVNSYSKSIKLGPFQVTLNARGS |
| Ga0194113_111576212 | 3300020074 | Freshwater Lake | MQTLPMTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQFTLNARPSGM |
| Ga0194110_108557571 | 3300020084 | Freshwater Lake | MTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQFTLN |
| Ga0211736_107454001 | 3300020151 | Freshwater | MTKNKSPINFDRTIFGVNLTEHGIKSFTKSIQLGPFQVTLNARESGVRGSI |
| Ga0194115_103583501 | 3300020183 | Freshwater Lake | MTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQ |
| Ga0194124_101710911 | 3300020196 | Freshwater Lake | MTKKSPINFDRTIAGFNITERGVKSYTKSIKLGPFQVTLNARQSGLHGS |
| Ga0194124_103903121 | 3300020196 | Freshwater Lake | MTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQFTLNARPSGMLGS |
| Ga0194132_100873465 | 3300020214 | Freshwater Lake | MTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQF |
| Ga0194127_109244582 | 3300020221 | Freshwater Lake | MTDKSAFNFDRTIHGVNITEHGVKSFTKSIQLGPFQLTLNARKSGVLGS |
| Ga0194125_102980743 | 3300020222 | Freshwater Lake | MQTLPMTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQFTLNARPS |
| Ga0211614_105697491 | 3300020471 | Marine | MAKRKRSAFNFDKTIFGVNVTERGPQSLSKRIKLGPLS |
| Ga0194133_101193575 | 3300021091 | Freshwater Lake | MQTLPMTERSAFNFDKTIAGVNITERGIKSFTKSI |
| Ga0194130_106264601 | 3300021376 | Freshwater Lake | MTERSAFNFDKTIAGVNITERGIKSFTKSIRLGPIQFTLNARPSGMLG |
| Ga0213864_100334921 | 3300021379 | Seawater | MTKPKSAINFDRTIAGFNVTEHGVQSYTKSIKLGPLQLTINARGSGVRGSIS |
| Ga0222712_104249451 | 3300021963 | Estuarine Water | MIKKSIVNFDKTIAGFNITEHGVKSFTKSFKLGPFQLTLNARDSGVRGSIS |
| Ga0212031_10937712 | 3300022176 | Aqueous | MTDKSPLNFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNARESGVRGSV |
| Ga0196899_10436813 | 3300022187 | Aqueous | MTKPKSTINFDRTIAGFNVTEHGVQSYTKSIKLGPLQLTIN |
| Ga0181354_12006632 | 3300022190 | Freshwater Lake | MTKPKSAFNFDKVIAGFNITENGIKSFTKTIKVGP |
| Ga0196905_10400701 | 3300022198 | Aqueous | MTKDKSPLNFDRTIAGFNITENGIKSYTKSFQLGPFQLT |
| Ga0196901_12549181 | 3300022200 | Aqueous | MTKDKSPINFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNARESGVRGSISI |
| Ga0255165_10245001 | 3300024357 | Freshwater | MTKKSLISFDRTIHGVNITEHGVKSLTKAVKLGPFQLTLNASP |
| Ga0256330_10888591 | 3300024481 | Freshwater | MTEKSPLNFDRTVAGFNITEHGIKSFTKSIKLGPLQLT |
| Ga0208149_10285035 | 3300025610 | Aqueous | MTQDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTLNARESGVRGSISI |
| Ga0208161_10437381 | 3300025646 | Aqueous | MTDKKSPINFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNA |
| Ga0208795_11062794 | 3300025655 | Aqueous | MTSERSAFNFDKTIAGLNITERGVKSYSKSIKLGPLQFTVN |
| Ga0208795_11597931 | 3300025655 | Aqueous | MTDKSPLNFDKTIAGFNVTERGIQSYTKSFQLGPFQLTLNARESGV |
| Ga0208898_11813301 | 3300025671 | Aqueous | MTQDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTLNARESG |
| Ga0208162_10854741 | 3300025674 | Aqueous | MTQKKSPINFDKTIAGFNITERGVKSYTKSFKLGPFQLTLNARDS |
| Ga0208899_11266241 | 3300025759 | Aqueous | MTDKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQVT |
| Ga0208767_11056601 | 3300025769 | Aqueous | MTKPKSAINFDRTIAGFNVTEHGVQSYTKSIKLGPLQLTINARGSGV |
| Ga0208785_11555222 | 3300025815 | Aqueous | MTQHKSSFNFDKTVAGFNITERGIKSFSKGIKVGPFQITFNVRGSGVRGSV |
| Ga0208005_12361051 | 3300025848 | Aqueous | MTRKKSLISFDRTIHGVNITEHGIKSVTKQIKLGPFQLTVNANPNGIKGS |
| Ga0208645_11025621 | 3300025853 | Aqueous | MTKPKSTINFDRTIAGFNVTEHGVQSYTKSIKLGP |
| Ga0208644_11651524 | 3300025889 | Aqueous | MTKDKSPISFDKTIAGFNITENGIQSYSKSFQLGPFQLTL |
| Ga0208009_10328141 | 3300027114 | Deep Subsurface | MTKPKAAFNFDKTIAGFNITENGIKSFTKTIQLGPLQLTLNTRESGVHASIA |
| Ga0255064_10447181 | 3300027138 | Freshwater | MTKKSIVNFDKTIAGFNITERGVKSYTKSFQLGPFQLTLNARD |
| Ga0209704_10162975 | 3300027693 | Freshwater Sediment | VTKKSPISFDRTIHGVNITEHGIKSVSKQIKLGPFQLTVNASSNGVK |
| Ga0209704_10817331 | 3300027693 | Freshwater Sediment | MTRKSPLSFDRTIHGVNITEHGIKSVSKQIKLGPFQLTVNASPNA |
| Ga0209358_100683176 | 3300027804 | Freshwater Lake | MTQKKSPINFDKTIAGFNITERGVKSYTKSIKLGPFQV |
| Ga0209990_102382483 | 3300027816 | Freshwater Lake | MTKDKSPINFDRTIFGVNLTEHGVKSYTKSFQLGPFQLTLNARDSGVRGSI |
| Ga0209536_1028832473 | 3300027917 | Marine Sediment | MTKDKSPINFDKTIAGFNVTERGIQSYTKSFQLGPFPLTLNAR |
| (restricted) Ga0247835_12589291 | 3300028114 | Freshwater | MTKPKSAFNFDKTIAGFNITENGIKSFTKTIQLGPL |
| Ga0135212_10116102 | 3300029306 | Marine Harbor | MPRRKKSKVNFDKTIAGFNITEHGIKSYSKTIKLGPFQFTANINGSQARGSL |
| Ga0135210_10111794 | 3300029345 | Marine Harbor | MTRKRSAINFDKTIAGINFTERGPQSFSKSFKLGPFQLTLNASQ |
| Ga0307380_109501861 | 3300031539 | Soil | MTKKSPINFDRTIAGVNITENGIKSYTKSFKLGPFQL |
| Ga0307380_109722311 | 3300031539 | Soil | MTKPKSPINFDRTIAGVNITEHGIKSYTKSFQLGPFQLTLN |
| Ga0307380_112633321 | 3300031539 | Soil | MTKKSPLNFDKTIAGFNVTEHGVKSYTKSIKLGPFQVTLNARGSGMHGSIS |
| Ga0307378_109911821 | 3300031566 | Soil | MAKEKSPLNFDKTIAGFNVTEHGVKSYTKSIKLGPFQVTLNA |
| Ga0307378_113177741 | 3300031566 | Soil | MTKEKSPLNFDKTIAGFNVTEHGVKSYTKSIKLGPFQ |
| Ga0307376_100736731 | 3300031578 | Soil | MTDKSSFNFDKTIAGFNITEHGVKSYSKSIKLGPFQVTLNT |
| Ga0307375_103229094 | 3300031669 | Soil | MTKKSIVNFDKTIAGFNITERGVKSFTKSFKLGPFQLT |
| Ga0307375_106488741 | 3300031669 | Soil | MTKPKSPINFDRTIAGVNITENGIKSYTKSFKLGPFQLTLNGSDSGVHGSIS |
| Ga0307375_107143862 | 3300031669 | Soil | MTKPKSLINFDRTIAGVNITENGIKSYTKSFKLGPFQLTLNGSDSGVHGSI |
| Ga0307377_103260964 | 3300031673 | Soil | MTKEKSPLNFDKTIAGFNVTEHGVKSYTKSIKLGPFQVTLNARG |
| Ga0307377_108347753 | 3300031673 | Soil | MTKKSPINFDRTIAGVNITENGIKSYTKSFKLGPFQLTLNCSDSGVHGSI |
| Ga0307377_108442521 | 3300031673 | Soil | MDKSPLNFDKTIAGFNVTEHGVKSYTKSIKLGPFQLTLNARGSGVHG |
| Ga0315293_102040556 | 3300031746 | Sediment | MTKKSIVNFDKTIAGFNITERGVKSFTKSFKLGPFQL |
| Ga0315900_108550283 | 3300031787 | Freshwater | MTKKSPISFDRTIHGVNITEHGIKSVSKQIKLGPFQL |
| Ga0315909_102655201 | 3300031857 | Freshwater | MNNKSTFNFDRTIHGVNITEHGIKSYTKSIQLGPFQLTLNARKSGL |
| Ga0315904_108010203 | 3300031951 | Freshwater | MTRKSPLSFDRTIHGVNITEHGIKSVSKQIKLGPFQ |
| Ga0316617_1019557322 | 3300033557 | Soil | MNKSSFNFDKTIAGINITENGIKSITKSIKLGPFQLTVNGRRTGVRASISI |
| Ga0334981_0250929_3_119 | 3300033980 | Freshwater | MTKKSPINFDRTIAGFNLTEHGIKSYTKSFKLGPLQLTL |
| Ga0334982_0279348_1_141 | 3300033981 | Freshwater | MTQKKSPINFDKTIAGFNITERGVKSYTKSIKLGPFQVTFNARESGV |
| Ga0334996_0313721_1_141 | 3300033994 | Freshwater | MTKKSPISFDRTIHGVNITEHGIKSVSKQIKLGPFQLTVNASPNGVK |
| Ga0334996_0476478_1_141 | 3300033994 | Freshwater | MTKRLPISFDRTIHGVNITEHGVKSYSKAVKLGPFQVTLNASPNGVK |
| Ga0335004_0329062_785_892 | 3300034021 | Freshwater | MTKDKSPINFDKTIAGFNITEHGVKSYTKSIKLGPF |
| Ga0335019_0689961_461_586 | 3300034066 | Freshwater | MTDKSPINFDKTIAGFNVTEHGIKSFTKSIQLGPFQVTLNAR |
| Ga0310130_0114107_2_130 | 3300034073 | Fracking Water | MKKSHVSFDKTIGGFNITERGVRSYSKSIKLGPFQVTLNARAS |
| Ga0310130_0303844_2_133 | 3300034073 | Fracking Water | MTKKSHVSFDKTIGGFNITERGVRSYSKSIKLGPFQVTLNARAS |
| Ga0335030_0526979_1_138 | 3300034103 | Freshwater | MTKDKSPINFDKTIAGFNITEHGIKSFTKSIQLGPFQVTLNARKSG |
| Ga0335051_0334260_1_111 | 3300034109 | Freshwater | MSNKKSHVSFDKTIAGFNVTERGVRSYSKSIKLGPLQ |
| Ga0335066_0045871_3_125 | 3300034112 | Freshwater | MTKDKSPINFDKTIAGFNITEHGVKSYTKSIKLGPFQVTLN |
| Ga0335068_0194564_945_1067 | 3300034116 | Freshwater | MTDKSAFNFDRTIAGINITEHGIKSYTKSIQLGPFQLTLNA |
| Ga0335054_0765509_1_147 | 3300034119 | Freshwater | MTKKSPISFDRTIHGVNITEHGIKSVSKQIKLGPFQLTVNVSPNGVKGS |
| Ga0348336_019858_1_132 | 3300034375 | Aqueous | MTKDKSPINFDKTIAGFNVTEHGIKSYSKSFSLGPFQLTLNARE |
| ⦗Top⦘ |