


| Basic Information | |
|---|---|
| Family ID | F045025 |
| Family Type | Metagenome |
| Number of Sequences | 153 |
| Average Sequence Length | 46 residues |
| Representative Sequence | PKDIAVQLPTYADNQAISVREDDQWEADRIVQIEERFTQWLAS |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.31 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 91.50 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.693 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.340 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.569 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF00378 | ECH_1 | 37.25 |
| PF13030 | DUF3891 | 26.14 |
| PF03401 | TctC | 5.88 |
| PF05985 | EutC | 5.23 |
| PF04392 | ABC_sub_bind | 2.61 |
| PF01042 | Ribonuc_L-PSP | 2.61 |
| PF00005 | ABC_tran | 2.61 |
| PF13549 | ATP-grasp_5 | 1.31 |
| PF13561 | adh_short_C2 | 0.65 |
| PF02311 | AraC_binding | 0.65 |
| PF12770 | CHAT | 0.65 |
| PF00266 | Aminotran_5 | 0.65 |
| PF09335 | SNARE_assoc | 0.65 |
| PF02265 | S1-P1_nuclease | 0.65 |
| PF16113 | ECH_2 | 0.65 |
| PF12860 | PAS_7 | 0.65 |
| PF04909 | Amidohydro_2 | 0.65 |
| PF08402 | TOBE_2 | 0.65 |
| PF01799 | Fer2_2 | 0.65 |
| PF00069 | Pkinase | 0.65 |
| PF13340 | DUF4096 | 0.65 |
| PF00561 | Abhydrolase_1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 5.88 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 5.23 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.61 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.61 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.61 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.65 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.69 % |
| Unclassified | root | N/A | 1.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100544228 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100546457 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10085419 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300000955|JGI1027J12803_102579703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
| 3300002495|BRMGV_1066339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300004092|Ga0062389_103602596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300004114|Ga0062593_103394632 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300004479|Ga0062595_100953453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300005148|Ga0066819_1004644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
| 3300005177|Ga0066690_10472774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300005332|Ga0066388_107895662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300005338|Ga0068868_100094638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2410 | Open in IMG/M |
| 3300005339|Ga0070660_101702536 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005353|Ga0070669_100103741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2149 | Open in IMG/M |
| 3300005437|Ga0070710_10660476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300005455|Ga0070663_100089881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
| 3300005545|Ga0070695_101846463 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005547|Ga0070693_100522084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300005549|Ga0070704_100604846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300005555|Ga0066692_10619512 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005615|Ga0070702_101371411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300005713|Ga0066905_101923917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005764|Ga0066903_100684114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
| 3300005764|Ga0066903_103616985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
| 3300005764|Ga0066903_106736160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300005764|Ga0066903_107726448 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005764|Ga0066903_108179129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005937|Ga0081455_10326820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300006028|Ga0070717_10708428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300006791|Ga0066653_10397731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300006853|Ga0075420_100217518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1666 | Open in IMG/M |
| 3300006904|Ga0075424_100319742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1653 | Open in IMG/M |
| 3300006904|Ga0075424_100963355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300009038|Ga0099829_11042106 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300009089|Ga0099828_11932019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300009094|Ga0111539_13117101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300009100|Ga0075418_11569276 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300009143|Ga0099792_10153416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1271 | Open in IMG/M |
| 3300009162|Ga0075423_11130457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300009784|Ga0123357_10451301 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300009792|Ga0126374_10913244 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010037|Ga0126304_11281559 | Not Available | 502 | Open in IMG/M |
| 3300010044|Ga0126310_11126649 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010048|Ga0126373_11681899 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010049|Ga0123356_13251752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300010358|Ga0126370_10994992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300010358|Ga0126370_11205827 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010360|Ga0126372_10354677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1317 | Open in IMG/M |
| 3300010361|Ga0126378_12810777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300010362|Ga0126377_11849090 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010373|Ga0134128_11939826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300010396|Ga0134126_11153609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300010398|Ga0126383_10273283 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300010398|Ga0126383_13535692 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300011000|Ga0138513_100066735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300011271|Ga0137393_10854206 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012189|Ga0137388_11072073 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012201|Ga0137365_10045877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3323 | Open in IMG/M |
| 3300012205|Ga0137362_11648572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300012209|Ga0137379_10110312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2648 | Open in IMG/M |
| 3300012362|Ga0137361_11878466 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
| 3300012363|Ga0137390_10381020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1390 | Open in IMG/M |
| 3300012902|Ga0157291_10160734 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012915|Ga0157302_10149069 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012930|Ga0137407_10696367 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012937|Ga0162653_100029264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300012948|Ga0126375_11202796 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012957|Ga0164303_10577669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300012958|Ga0164299_10288548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1002 | Open in IMG/M |
| 3300013296|Ga0157374_12230655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300014501|Ga0182024_11515284 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300015201|Ga0173478_10071018 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300015371|Ga0132258_10338028 | All Organisms → cellular organisms → Bacteria | 3719 | Open in IMG/M |
| 3300015371|Ga0132258_11427938 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300015372|Ga0132256_100384604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1503 | Open in IMG/M |
| 3300015372|Ga0132256_102304955 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300015373|Ga0132257_100525690 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300015373|Ga0132257_101123768 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300015374|Ga0132255_101058394 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300016404|Ga0182037_12003191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300017959|Ga0187779_10276372 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300018055|Ga0184616_10160637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300018073|Ga0184624_10006290 | All Organisms → cellular organisms → Bacteria | 3910 | Open in IMG/M |
| 3300018469|Ga0190270_11959732 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300019869|Ga0193705_1040329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300019873|Ga0193700_1058349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300020579|Ga0210407_10844021 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300021073|Ga0210378_10208477 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021170|Ga0210400_11395224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300021363|Ga0193699_10033151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1943 | Open in IMG/M |
| 3300025315|Ga0207697_10509099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300025915|Ga0207693_11314252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
| 3300025928|Ga0207700_12017918 | Not Available | 504 | Open in IMG/M |
| 3300025929|Ga0207664_10973248 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026116|Ga0207674_11636471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300026498|Ga0257156_1135974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300026555|Ga0179593_1000399 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300026855|Ga0208404_1001345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300027381|Ga0208983_1052336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300027846|Ga0209180_10369166 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300028704|Ga0307321_1024823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300028710|Ga0307322_10124795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300028712|Ga0307285_10112094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300028716|Ga0307311_10047451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1136 | Open in IMG/M |
| 3300028717|Ga0307298_10172676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300028718|Ga0307307_10266149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300028754|Ga0307297_10326904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300028755|Ga0307316_10373532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300028784|Ga0307282_10640359 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300028799|Ga0307284_10060336 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300028807|Ga0307305_10259832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300028828|Ga0307312_10149634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1480 | Open in IMG/M |
| 3300028875|Ga0307289_10017766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2736 | Open in IMG/M |
| 3300029957|Ga0265324_10263440 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031226|Ga0307497_10145085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 979 | Open in IMG/M |
| 3300031366|Ga0307506_10244892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300031469|Ga0170819_15832771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1080 | Open in IMG/M |
| 3300031543|Ga0318516_10236013 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031544|Ga0318534_10293929 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031564|Ga0318573_10577482 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031716|Ga0310813_10905225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 800 | Open in IMG/M |
| 3300031719|Ga0306917_11050725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300031744|Ga0306918_10008789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5621 | Open in IMG/M |
| 3300031751|Ga0318494_10899329 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031763|Ga0318537_10013191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2804 | Open in IMG/M |
| 3300031769|Ga0318526_10438724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031769|Ga0318526_10460187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300031770|Ga0318521_10750247 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031771|Ga0318546_10823038 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031780|Ga0318508_1218647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031823|Ga0307478_10448418 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300031854|Ga0310904_10372592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 927 | Open in IMG/M |
| 3300031893|Ga0318536_10397943 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031896|Ga0318551_10525758 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031896|Ga0318551_10605038 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031910|Ga0306923_10673296 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300031912|Ga0306921_12390494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300031942|Ga0310916_10123723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2107 | Open in IMG/M |
| 3300031942|Ga0310916_10311902 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300031942|Ga0310916_10925974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300031947|Ga0310909_10869389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300031954|Ga0306926_12731921 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031981|Ga0318531_10502870 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032001|Ga0306922_10984408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
| 3300032035|Ga0310911_10569379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300032059|Ga0318533_10171703 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300032076|Ga0306924_10887625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300032076|Ga0306924_11059466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300032076|Ga0306924_11430769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300032090|Ga0318518_10478549 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300032261|Ga0306920_102828777 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300032782|Ga0335082_10091413 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
| 3300033290|Ga0318519_10228620 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.34% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.31% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.31% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.31% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.65% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002495 | 454 Fosmid Sequence | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026855 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1005442281 | 3300000364 | Soil | ELNTRLFYGPIHPDAYAFIPKDIAVQLPTYADNQAISVREDDQWEADRIVQIEERFTQWLAS* |
| INPhiseqgaiiFebDRAFT_1005464571 | 3300000364 | Soil | TRLFYGPIHPDAYAFIPKDIAVQLPTYADNQAISVREDDQWEADRIVAIEERFTQWLAS* |
| AF_2010_repII_A1DRAFT_100854191 | 3300000597 | Forest Soil | FIPHDIAVVLPTYSENLAVSIREDDEWEADRIVALEQRFMQWLAS* |
| JGI1027J12803_1025797033 | 3300000955 | Soil | PKDIAVQLPTYADNQAISVREDDQWEADRIVQIEERFTQWLAS* |
| BRMGV_10663391 | 3300002495 | Mangrove Soil | NPDAYALIPKDIAVQLPTYSGNVEVSVKEDDVWEADRITQIEERFTQWLAS* |
| Ga0062389_1036025961 | 3300004092 | Bog Forest Soil | DAYDLIPKDIAVQLPTYRDNLAVSVKEDDVWEADRIAAVEERFTQWLAS* |
| Ga0062593_1033946322 | 3300004114 | Soil | KEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0062595_1009534531 | 3300004479 | Soil | PPDIARQLPTFAANMAVSVKEDDQWEAERIAQIEQRFTQWVAS* |
| Ga0066819_10046442 | 3300005148 | Soil | PIHPGAYAFIPKEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0066690_104727743 | 3300005177 | Soil | AFIPQEIAVQLPTHKDNAAVSVREDDQWEADRIVQIEERFNQWLAS* |
| Ga0066388_1078956622 | 3300005332 | Tropical Forest Soil | HDIAVVLPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS* |
| Ga0068868_1000946384 | 3300005338 | Miscanthus Rhizosphere | SQAKPQAEFNTRLFYGPIHPGAYAFIPKEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0070660_1017025362 | 3300005339 | Corn Rhizosphere | EIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0070669_1001037413 | 3300005353 | Switchgrass Rhizosphere | EIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0070710_106604762 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PKEIAVQLPTYSGNVEVSVKEDDVWEADRIVKLEERFTQWLAS* |
| Ga0070663_1000898811 | 3300005455 | Corn Rhizosphere | KEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0070695_1018464632 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AFIPKEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0070693_1005220842 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AFIPKEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0070704_1006048462 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AYAFIPKEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0066692_106195121 | 3300005555 | Soil | VVLPTYSENLAVSIREDDEWEADRIVPLEERFTQWLAS* |
| Ga0070702_1013714112 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EIAKQLPTYPANKAVSVTTDDRWEADHIAEIEQRFTQWVSS* |
| Ga0066905_1019239171 | 3300005713 | Tropical Forest Soil | FIPHDIAVVLPTYKENLAVSIREDDEWEAERIVPLEERFTQWLAS* |
| Ga0066903_1006841141 | 3300005764 | Tropical Forest Soil | PAAFEFIPHDIAVVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0066903_1036169852 | 3300005764 | Tropical Forest Soil | TRLYYGPINPDAFAHIPPEIARQLPTYEANMAVSVKEDDHWESERIAQIEQRFTQWVAS* |
| Ga0066903_1067361602 | 3300005764 | Tropical Forest Soil | IPHDIAVVLPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS* |
| Ga0066903_1077264481 | 3300005764 | Tropical Forest Soil | AVQLPTYAENEAISVREDDQWEADRIVAIEERFTQWLAS* |
| Ga0066903_1081791292 | 3300005764 | Tropical Forest Soil | GELATQLPTHPDNLAVSVREDDEWEADRIAAIEERFMQWVAS* |
| Ga0081455_103268202 | 3300005937 | Tabebuia Heterophylla Rhizosphere | PREIAVQLPTHSENMAVSVKEDDQWEADRIVQIEERFTRWLSS* |
| Ga0070717_107084281 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AEFDTRLYYGPINPDAFAHIPPEIARQLPTFAANMAVSVKEDDHWESERIAAIEQRFTQWVAS* |
| Ga0066653_103977311 | 3300006791 | Soil | PIHPRAYELIPPSIAVQLPTYPDNLAVSVKEDEEWEADRIADIEERFTQWLAS* |
| Ga0075420_1002175183 | 3300006853 | Populus Rhizosphere | PGAYEFIPREIAAQLPTYAENMAVSVKEDDQWEADRIAQIEERFTRWLSS* |
| Ga0075424_1003197421 | 3300006904 | Populus Rhizosphere | PTYAANMAVSVKEDDHWESERIAQIEQRFTQWVAS* |
| Ga0075424_1009633553 | 3300006904 | Populus Rhizosphere | TNPAAFEFIPHDIAVVLPTYKENLAVSIREDDEWEAERIVPLEERFTQWLAS* |
| Ga0099829_110421062 | 3300009038 | Vadose Zone Soil | AYELIPREIAVQLPTYSENLAVSIKEDDQWEADRISQIEERFNHWLAS* |
| Ga0099828_119320192 | 3300009089 | Vadose Zone Soil | EFNTRLYYGPIHPGAYELIPHHIAVQLPTHSGNLAVSVKEDEEWEADRIAQIEERFTQWLAS* |
| Ga0111539_131171011 | 3300009094 | Populus Rhizosphere | FIPKEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0075418_115692762 | 3300009100 | Populus Rhizosphere | QLPTYAENMAVSVKEDDQWEAERIAQIEERFTRWLSS* |
| Ga0099792_101534163 | 3300009143 | Vadose Zone Soil | VQLPTWPANQAISVKEDDHWEADRIVGIEERFTQWVAS* |
| Ga0075423_111304572 | 3300009162 | Populus Rhizosphere | HPDAYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0123357_104513012 | 3300009784 | Termite Gut | ALIAKQIAVQLPTYRDNVAVSVKEDDVWEADRIAKLEERFTQWLAS* |
| Ga0126374_109132441 | 3300009792 | Tropical Forest Soil | TYRDNLAVSVREDDEWEADRIVAIEERFRQWLSS* |
| Ga0126304_112815592 | 3300010037 | Serpentine Soil | LPTYKDNMAVSVKANDEWEADRIVEIEERFNRWLSS* |
| Ga0126310_111266492 | 3300010044 | Serpentine Soil | LPTYKDNMAVSVKENDEWEAERIVEIEERFNRWLSS* |
| Ga0126373_116818991 | 3300010048 | Tropical Forest Soil | TYSENLAVSIREDDEWEADRIVALEERFMQWLAS* |
| Ga0123356_132517522 | 3300010049 | Termite Gut | AYALISKQIAVQLPTYRDNVAVSVKEDDVWEADRIAKLEERFTQWLAS* |
| Ga0126370_109949921 | 3300010358 | Tropical Forest Soil | IPPEIARQLPTYAANKAVSVVSDDRWEAEHVADIEQRFTQWVSS* |
| Ga0126370_112058271 | 3300010358 | Tropical Forest Soil | YGPIDPAAFDFIPHEVAVQLPTYRDNLAVSVREDDEWEADRIVAIEERFRQWLSS* |
| Ga0126372_103546771 | 3300010360 | Tropical Forest Soil | LYYGPINPGAFELIPHELAVQLPTYGDNLKVSVREDDEWEADRIDAIEERFTQWLAS* |
| Ga0126378_128107771 | 3300010361 | Tropical Forest Soil | PAAFEFIPHDIAVVLPTYSDNLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0126377_118490901 | 3300010362 | Tropical Forest Soil | AAFEFIPHDIAVVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0134128_119398261 | 3300010373 | Terrestrial Soil | IHPGAYAFIPEEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0134126_111536092 | 3300010396 | Terrestrial Soil | YAFIPKEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0126383_102732831 | 3300010398 | Tropical Forest Soil | HDIAVVLPTYKENLAVSIREDDEWEAERIVPLEERFTQWLAS* |
| Ga0126383_135356922 | 3300010398 | Tropical Forest Soil | DIARQLPTFAANDAASVKEDDHWEADRIAAIEERFTQWLAS* |
| Ga0138513_1000667352 | 3300011000 | Soil | FYGPIHPGAYAFIPEEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0137393_108542062 | 3300011271 | Vadose Zone Soil | ELPTYSENLAVSIKEDDQWEADRISQIEERFNHWLAS* |
| Ga0137388_110720732 | 3300012189 | Vadose Zone Soil | PTYSENLAVSIKEDDQWEADRISQIEERFNHWLAS* |
| Ga0137365_100458773 | 3300012201 | Vadose Zone Soil | PTYSENLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0137362_116485721 | 3300012205 | Vadose Zone Soil | TYSENLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0137379_101103125 | 3300012209 | Vadose Zone Soil | PHGIAVVLPTYSENLAVSIREDDEWEADRIVPLEERFTQWLAS* |
| Ga0137361_118784661 | 3300012362 | Vadose Zone Soil | AVVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0137390_103810201 | 3300012363 | Vadose Zone Soil | ELIPREIAIQLPTYSDNLAVSIKEDDQWEADRISQIEERFNHWLAS* |
| Ga0157291_101607341 | 3300012902 | Soil | QAKPQAEFNTRLFYGPIHPDAYAFIPKDIAMQLPTYEDNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0157302_101490692 | 3300012915 | Soil | KPQAEFNTRLFYGPIHPGAYAFIPKEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0137407_106963671 | 3300012930 | Vadose Zone Soil | PHDIAVVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS* |
| Ga0162653_1000292641 | 3300012937 | Soil | LFYGPIHPGAYAFIPEEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFMQWLAS* |
| Ga0126375_112027961 | 3300012948 | Tropical Forest Soil | IHPDAYAFIPKDIAVQLPTYADNQAISVREDDQWEADRIVAIEERFTQWLAS* |
| Ga0164303_105776691 | 3300012957 | Soil | TRLFYGPIHPDTYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0164299_102885482 | 3300012958 | Soil | FYGPIHPGAYAFIPKEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0157374_122306552 | 3300013296 | Miscanthus Rhizosphere | IPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0182024_115152842 | 3300014501 | Permafrost | DAYALIPKDIAVQLPTYRDNLAVSVQEDDVWEADRIAAIEERFTQWLAS* |
| Ga0173478_100710182 | 3300015201 | Soil | LFYGPIHPGAYAFIPKEIALQLPTYADNQAISIREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0132258_103380282 | 3300015371 | Arabidopsis Rhizosphere | MQLPTYEDNQAISVREDDQWEADRIVQIEQRFTQWLAS* |
| Ga0132258_114279381 | 3300015371 | Arabidopsis Rhizosphere | GPINPDAFAHIPPEIARQLPTYEANMAVSVKEDDHWESERIGEIEQRFTQWVSS* |
| Ga0132256_1003846041 | 3300015372 | Arabidopsis Rhizosphere | TYKDNVAVSVKENDEWEAERIAQIEERFKSWLSS* |
| Ga0132256_1023049551 | 3300015372 | Arabidopsis Rhizosphere | INPGAYELIPKEIAMQLPTYKDNVAVSVKENDEWEAERIAAIEERFKSWLSS* |
| Ga0132257_1005256903 | 3300015373 | Arabidopsis Rhizosphere | GPINPGAYELIPKEIAMQLPTYKDNVAVSVKENDEWEAERIAAIEERFKSWLSS* |
| Ga0132257_1011237682 | 3300015373 | Arabidopsis Rhizosphere | GAYELIPKEIAMQLPTYKDNVAVSVKENDEWEAERIAQIEERFKSWLSS* |
| Ga0132255_1010583941 | 3300015374 | Arabidopsis Rhizosphere | AYELIPKEIAMQLPTYKDNVAVSVKENDEWEAERIAAIEERFKSWLSS* |
| Ga0182037_120031912 | 3300016404 | Soil | PTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0187779_102763722 | 3300017959 | Tropical Peatland | TNPDAYALIPKDIAVQLPTYSGNVEVSVKEDDAWEADRITKIEERFTQWLAS |
| Ga0184616_101606371 | 3300018055 | Groundwater Sediment | LPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0184624_100062905 | 3300018073 | Groundwater Sediment | FIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0190270_119597321 | 3300018469 | Soil | IAAQLPTYAENMAVSVKEDDQWEADRIAQIEERFTRWLSS |
| Ga0193705_10403292 | 3300019869 | Soil | IAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0193700_10583492 | 3300019873 | Soil | TRLFYGPIHPDAYAFIPKDIAVQLPTYEGNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0210407_108440211 | 3300020579 | Soil | HIAVVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS |
| Ga0210378_102084771 | 3300021073 | Groundwater Sediment | FMPREIAAQLPTYAENMAVSVKEDDQWEADRIAQIEERFTRWLSS |
| Ga0210400_113952241 | 3300021170 | Soil | AYIPPDIARQLPTFAANAAVSVKEDDHWEADRIAEIEQRFTQWVAS |
| Ga0193699_100331511 | 3300021363 | Soil | LFYGPIHPDAYAFIPKDIAVQLPTYEDNQAISVREDDQWEAERIVQIEQRFMQWLAS |
| Ga0207697_105090991 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | EIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0207693_113142522 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AKQLPTYPANKAVSVTTDDRWEADHIAEIEQRFTQWVSS |
| Ga0207700_120179182 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PTFAANMAVSVKEDDHWESERIAAIEQRFTQWVAS |
| Ga0207664_109732481 | 3300025929 | Agricultural Soil | NPDAYAMIPKDIAVQLPTYRDNIAISVKEDDVWEAERIAGIEERFTQWLAS |
| Ga0207674_116364711 | 3300026116 | Corn Rhizosphere | AFIPKEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0257156_11359741 | 3300026498 | Soil | VVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS |
| Ga0179593_10003993 | 3300026555 | Vadose Zone Soil | MQLPTYKDNEAVSIRENDEWEAERIVQIEERFNRWLSS |
| Ga0208404_10013451 | 3300026855 | Soil | PIHPGAYAFIPKEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0208983_10523362 | 3300027381 | Forest Soil | FIPKDIAVQLPTYEGNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0209180_103691661 | 3300027846 | Vadose Zone Soil | HDIAVVLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS |
| Ga0307321_10248232 | 3300028704 | Soil | DIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0307322_101247951 | 3300028710 | Soil | VQLPTYEDNQAISVREDDQWEADRIAQIEQRFMQWLAS |
| Ga0307285_101120941 | 3300028712 | Soil | AYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0307311_100474512 | 3300028716 | Soil | KDIAVQLPTYEDNQAISVREDDQWEADRIAQIEQRFMQWLAS |
| Ga0307298_101726762 | 3300028717 | Soil | GPIHPDAYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0307307_102661492 | 3300028718 | Soil | AVQLPTYEENQAISVREDDQWEADRIAQIEQRFMQWLAS |
| Ga0307297_103269041 | 3300028754 | Soil | LPTYEDNQAISVREDDQWEAERIVQIEQRFMQWLAS |
| Ga0307316_103735321 | 3300028755 | Soil | DAYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0307282_106403591 | 3300028784 | Soil | DIAVQLPTHSANLAVSIREDDEWEADRIVAIEERFRQWLAS |
| Ga0307284_100603363 | 3300028799 | Soil | AVQLPTHSANLAVSIREDDEWEADRIVAIEERFRQWLAS |
| Ga0307305_102598322 | 3300028807 | Soil | AKPQAEFNKRLFYGPIDPAAFAFIPDDIAVQLPTHSANLAVSIREDDEWEADRIVAIEERFRQWLAS |
| Ga0307312_101496343 | 3300028828 | Soil | PTYEENQAISVREDDQWEADRIAQIEQRFMQWLAS |
| Ga0307289_100177664 | 3300028875 | Soil | FYGPIHPDAYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0265324_102634401 | 3300029957 | Rhizosphere | YALIPKDIAVQLPTWRANEAVSVKEDDTWEVDRIAKLEERFTQWLAS |
| Ga0307497_101450851 | 3300031226 | Soil | TRLFYGPIHPDAYTFIPKDIAVQLPTYEDNQAISVREDDQWEADRIVQIEQRFMQWLAS |
| Ga0307506_102448922 | 3300031366 | Soil | QLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0170819_158327712 | 3300031469 | Forest Soil | AYAFIPKDIAVQLPTYEDNQAISVREDDQWEADRIAQIEQRFMQWLAS |
| Ga0318516_102360131 | 3300031543 | Soil | YALIPKDIAVQLPTYSGNVEVSVKEDDVWEADRITKIEERFTQWLAS |
| Ga0318534_102939292 | 3300031544 | Soil | GPTNPDAYALIPKDIAVQLPTYSGNVEVSVKEDDVWEADRITKIEERFTQWLAS |
| Ga0318573_105774822 | 3300031564 | Soil | AVQLPTYSGNVEVSVKEDDVWEADRITKIEERFTQWLAS |
| Ga0310813_109052252 | 3300031716 | Soil | AFAHIPPEIAKQLPTYPANKAVSVTTDDRWEADHIAEIEQRFTQWVSS |
| Ga0306917_110507252 | 3300031719 | Soil | NMIPRELAVELPTYSDNLAVSIKEDDHWEADRIAQIEERFAQWLAS |
| Ga0306918_100087897 | 3300031744 | Soil | DLAVQLPTYSENLAVSVREDDEWEADRIVQIEERFTQWLAS |
| Ga0318494_108993292 | 3300031751 | Soil | PEAFAFIPHDLAVQLPTYSENLAVSVREDDEWEADRIVQIEERFTQWLAS |
| Ga0318537_100131915 | 3300031763 | Soil | NPAAFEFIPHDIAVVLPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0318526_104387243 | 3300031769 | Soil | VVLPTYSENLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0318526_104601871 | 3300031769 | Soil | KDIAVQLPTYSGNVEVSVKEDDVWEADRITKIEERFTQWLAS |
| Ga0318521_107502471 | 3300031770 | Soil | PINPRAYNMIPRELAVELPTYSDNLAVSIKEDDHWEADRIAHIEERFAQWLAS |
| Ga0318546_108230381 | 3300031771 | Soil | IAVVLPTYSENLAVSIREDDEREADRIVALEERFTQWLAF |
| Ga0318508_12186471 | 3300031780 | Soil | HDIAVVLPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0307478_104484181 | 3300031823 | Hardwood Forest Soil | EFNTRLYYGPINPDAFAQIPPEIARQLPTFAANAAVSVKEDDHWEVDRIASIEERFTQWVAS |
| Ga0310904_103725921 | 3300031854 | Soil | QAKPQAEFNTRLFYGPIHPGAYAFIPEEIALQLPTYADNQAISVREDDQWEADRIVQIEQRFTQWLAS |
| Ga0318536_103979432 | 3300031893 | Soil | VVLPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0318551_105257582 | 3300031896 | Soil | LPTYSENLAVSIREDDEWEADRIVALEERFTQWLAS |
| Ga0318551_106050381 | 3300031896 | Soil | VLPTYSENLAVSIREDDEWEADRIVALEERFTQWLAF |
| Ga0306923_106732961 | 3300031910 | Soil | PTYSENLAVSIREDDEWEADRIVALEERFTQWLAS |
| Ga0306921_123904942 | 3300031912 | Soil | VLPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0310916_101237233 | 3300031942 | Soil | LPTYRDNLAVSIREDDEWEADRIVALEQRFMQWLAS |
| Ga0310916_103119022 | 3300031942 | Soil | PAAFEFIPHDIAVVLPTYSENLAVSIREDDEREADRIVALEERFTQWLAF |
| Ga0310916_109259742 | 3300031942 | Soil | LPTYAENLAVSVREDDEWEADRIAAIEERFTQWLSS |
| Ga0310909_108693892 | 3300031947 | Soil | HPGAYELIPPQIAVQLPTYAKNLAVSVKEDEEWEADRIAQIEERFAQWLAS |
| Ga0306926_127319211 | 3300031954 | Soil | AKPQAEFASRLYYGPINPDAYNMISRELAVELPTYSDNLAVSIKEDERWEADRIAQIEERFAQWLAS |
| Ga0318531_105028701 | 3300031981 | Soil | VQLPTYSGNVEVSVKEDDVWEADRITKIEERFTQWLAS |
| Ga0306922_109844082 | 3300032001 | Soil | AYELIRPDIAVQLPTYPENLAVSVKEDEEWEADRIAQIEERFAQWLAS |
| Ga0310911_105693791 | 3300032035 | Soil | LPTYPDNLAVSVKEDDAWEADRIAQIEERFTQWLAS |
| Ga0318533_101717033 | 3300032059 | Soil | HDIAVVLPTYNENLAVSIREDDEWEADRIVALEERFTQWLAS |
| Ga0306924_108876251 | 3300032076 | Soil | IHPGAYAFIAPNIAVQLPTYPDNLAVSVKEDDAWEADRIAQIEERFTQWLAS |
| Ga0306924_110594661 | 3300032076 | Soil | YELIPPQIAVQLPTYAKNLAVSVKEDEEWEADRIAQIEERFAQWLAS |
| Ga0306924_114307692 | 3300032076 | Soil | EVAVQLPTHPDNLAVSVKEDDVWEADRIAQIEERFTAWLAS |
| Ga0318518_104785491 | 3300032090 | Soil | DIAVQLPTYSGNVEVSVKEDDVWEADRITKIEERFTQWLAS |
| Ga0306920_1028287771 | 3300032261 | Soil | LFYGPIDPAAFDFIPREVAVQLPTYRDNLAISVREDDEWEADRIVAIEERFRQWLSS |
| Ga0335082_100914131 | 3300032782 | Soil | AHIPPDIARQLPTFAANMAVSVKEDDHWESERIAAIEQRFTQWVAS |
| Ga0318519_102286201 | 3300033290 | Soil | LAVELPTYSDNLAVSIKEDERWEADRIAQIEERFAQWLAS |
| ⦗Top⦘ |