


| Basic Information | |
|---|---|
| Family ID | F045011 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAPKEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTAL |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 153 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.27 % |
| % of genes near scaffold ends (potentially truncated) | 85.62 % |
| % of genes from short scaffolds (< 2000 bps) | 86.93 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.013 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.451 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.784 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.76% β-sheet: 0.00% Coil/Unstructured: 74.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 153 Family Scaffolds |
|---|---|---|
| PF14294 | DUF4372 | 45.75 |
| PF01609 | DDE_Tnp_1 | 3.27 |
| PF13482 | RNase_H_2 | 1.96 |
| PF13620 | CarboxypepD_reg | 1.96 |
| PF03551 | PadR | 1.31 |
| PF00512 | HisKA | 1.31 |
| PF03683 | UPF0175 | 1.31 |
| PF01797 | Y1_Tnp | 1.31 |
| PF08843 | AbiEii | 0.65 |
| PF13194 | DUF4010 | 0.65 |
| PF14257 | DUF4349 | 0.65 |
| PF06649 | DUF1161 | 0.65 |
| PF12323 | HTH_OrfB_IS605 | 0.65 |
| PF01656 | CbiA | 0.65 |
| PF13701 | DDE_Tnp_1_4 | 0.65 |
| PF04434 | SWIM | 0.65 |
| PF00665 | rve | 0.65 |
| PF07238 | PilZ | 0.65 |
| PF09722 | Xre_MbcA_ParS_C | 0.65 |
| PF01264 | Chorismate_synt | 0.65 |
| PF14903 | WG_beta_rep | 0.65 |
| PF01740 | STAS | 0.65 |
| PF13581 | HATPase_c_2 | 0.65 |
| PF01850 | PIN | 0.65 |
| PF01695 | IstB_IS21 | 0.65 |
| PF13560 | HTH_31 | 0.65 |
| PF02517 | Rce1-like | 0.65 |
| PF00990 | GGDEF | 0.65 |
| PF00082 | Peptidase_S8 | 0.65 |
| PF00690 | Cation_ATPase_N | 0.65 |
| PF08241 | Methyltransf_11 | 0.65 |
| PF02702 | KdpD | 0.65 |
| PF02894 | GFO_IDH_MocA_C | 0.65 |
| PF02882 | THF_DHG_CYH_C | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 3.27 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 3.27 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 3.27 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 3.27 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 3.27 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 3.27 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.31 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.31 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.31 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.31 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 1.31 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.65 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.65 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.65 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.65 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.65 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 0.65 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.65 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.65 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.65 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.65 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.65 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.65 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.65 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.01 % |
| Unclassified | root | N/A | 33.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16790519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 1325 | Open in IMG/M |
| 2228664022|INPgaii200_c0987473 | Not Available | 1379 | Open in IMG/M |
| 3300000789|JGI1027J11758_12976963 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300000955|JGI1027J12803_100066412 | Not Available | 1384 | Open in IMG/M |
| 3300001661|JGI12053J15887_10159127 | Not Available | 1180 | Open in IMG/M |
| 3300001661|JGI12053J15887_10172065 | Not Available | 1120 | Open in IMG/M |
| 3300001867|JGI12627J18819_10140240 | Not Available | 988 | Open in IMG/M |
| 3300002914|JGI25617J43924_10299325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 553 | Open in IMG/M |
| 3300002916|JGI25389J43894_1047293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 730 | Open in IMG/M |
| 3300002917|JGI25616J43925_10401314 | Not Available | 504 | Open in IMG/M |
| 3300003218|JGI26339J46600_10037135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1352 | Open in IMG/M |
| 3300005175|Ga0066673_10238209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300005184|Ga0066671_10492380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300005187|Ga0066675_10239555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1291 | Open in IMG/M |
| 3300005451|Ga0066681_10165565 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005454|Ga0066687_10092674 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300005557|Ga0066704_10395892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 918 | Open in IMG/M |
| 3300005558|Ga0066698_10172354 | Not Available | 1471 | Open in IMG/M |
| 3300005566|Ga0066693_10164322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300005568|Ga0066703_10113955 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300005574|Ga0066694_10013492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3514 | Open in IMG/M |
| 3300005586|Ga0066691_10344398 | Not Available | 882 | Open in IMG/M |
| 3300005591|Ga0070761_10267732 | Not Available | 1023 | Open in IMG/M |
| 3300005921|Ga0070766_10656533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 707 | Open in IMG/M |
| 3300005921|Ga0070766_10664271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 703 | Open in IMG/M |
| 3300006031|Ga0066651_10049834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1955 | Open in IMG/M |
| 3300006031|Ga0066651_10423282 | Not Available | 708 | Open in IMG/M |
| 3300006796|Ga0066665_10340708 | Not Available | 1220 | Open in IMG/M |
| 3300006797|Ga0066659_10003969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7137 | Open in IMG/M |
| 3300006797|Ga0066659_10152518 | Not Available | 1644 | Open in IMG/M |
| 3300006797|Ga0066659_10766344 | Not Available | 795 | Open in IMG/M |
| 3300006797|Ga0066659_10915848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300007258|Ga0099793_10575055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300009038|Ga0099829_10192951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300009038|Ga0099829_10753323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 809 | Open in IMG/M |
| 3300009088|Ga0099830_10723331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 820 | Open in IMG/M |
| 3300009088|Ga0099830_11322383 | Not Available | 599 | Open in IMG/M |
| 3300009089|Ga0099828_10199713 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300009090|Ga0099827_10420431 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300009137|Ga0066709_102354692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300010320|Ga0134109_10337848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300010321|Ga0134067_10191148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300010321|Ga0134067_10427833 | Not Available | 536 | Open in IMG/M |
| 3300010321|Ga0134067_10462265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300010326|Ga0134065_10087265 | Not Available | 1017 | Open in IMG/M |
| 3300010337|Ga0134062_10238461 | Not Available | 842 | Open in IMG/M |
| 3300012096|Ga0137389_10067871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2748 | Open in IMG/M |
| 3300012198|Ga0137364_10324422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1146 | Open in IMG/M |
| 3300012200|Ga0137382_11332852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012203|Ga0137399_10268753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1402 | Open in IMG/M |
| 3300012205|Ga0137362_10017976 | All Organisms → cellular organisms → Bacteria | 5378 | Open in IMG/M |
| 3300012205|Ga0137362_10687462 | Not Available | 879 | Open in IMG/M |
| 3300012210|Ga0137378_10435817 | Not Available | 1215 | Open in IMG/M |
| 3300012210|Ga0137378_10743101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 893 | Open in IMG/M |
| 3300012349|Ga0137387_10228007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1340 | Open in IMG/M |
| 3300012351|Ga0137386_10990293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 598 | Open in IMG/M |
| 3300012361|Ga0137360_11238538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 645 | Open in IMG/M |
| 3300012363|Ga0137390_11256780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 687 | Open in IMG/M |
| 3300012685|Ga0137397_10004407 | All Organisms → cellular organisms → Bacteria | 9778 | Open in IMG/M |
| 3300012685|Ga0137397_10036158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3532 | Open in IMG/M |
| 3300012685|Ga0137397_10116553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1966 | Open in IMG/M |
| 3300012918|Ga0137396_11254191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300012925|Ga0137419_10192660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1504 | Open in IMG/M |
| 3300012925|Ga0137419_10567299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300012925|Ga0137419_11580438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012927|Ga0137416_10398964 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300012929|Ga0137404_10183847 | Not Available | 1761 | Open in IMG/M |
| 3300012930|Ga0137407_12121709 | Not Available | 537 | Open in IMG/M |
| 3300012944|Ga0137410_10153625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1755 | Open in IMG/M |
| 3300012975|Ga0134110_10175589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300014501|Ga0182024_11096946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 940 | Open in IMG/M |
| 3300014501|Ga0182024_11891038 | Not Available | 664 | Open in IMG/M |
| 3300015053|Ga0137405_1043086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1341 | Open in IMG/M |
| 3300015241|Ga0137418_10943686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 630 | Open in IMG/M |
| 3300016702|Ga0181511_1401333 | Not Available | 544 | Open in IMG/M |
| 3300017943|Ga0187819_10064578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2175 | Open in IMG/M |
| 3300018047|Ga0187859_10427526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 730 | Open in IMG/M |
| 3300018431|Ga0066655_11040089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300018468|Ga0066662_11560949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 688 | Open in IMG/M |
| 3300018482|Ga0066669_10084239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2152 | Open in IMG/M |
| 3300019789|Ga0137408_1308236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1336 | Open in IMG/M |
| 3300020006|Ga0193735_1038276 | Not Available | 1450 | Open in IMG/M |
| 3300020199|Ga0179592_10308305 | Not Available | 702 | Open in IMG/M |
| 3300020579|Ga0210407_11334275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 534 | Open in IMG/M |
| 3300021086|Ga0179596_10291839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 812 | Open in IMG/M |
| 3300021171|Ga0210405_11229573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 553 | Open in IMG/M |
| 3300021181|Ga0210388_10739363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 855 | Open in IMG/M |
| 3300021405|Ga0210387_10113910 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300022557|Ga0212123_10232225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1338 | Open in IMG/M |
| 3300022730|Ga0224570_101353 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300022734|Ga0224571_101600 | Not Available | 1423 | Open in IMG/M |
| 3300023030|Ga0224561_1004966 | Not Available | 952 | Open in IMG/M |
| 3300024225|Ga0224572_1009802 | Not Available | 1793 | Open in IMG/M |
| 3300024225|Ga0224572_1059743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300024330|Ga0137417_1116741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1358 | Open in IMG/M |
| 3300026277|Ga0209350_1027211 | Not Available | 1727 | Open in IMG/M |
| 3300026305|Ga0209688_1050234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300026306|Ga0209468_1148134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300026313|Ga0209761_1099945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1452 | Open in IMG/M |
| 3300026328|Ga0209802_1060882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1821 | Open in IMG/M |
| 3300026333|Ga0209158_1347600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 515 | Open in IMG/M |
| 3300026355|Ga0257149_1035629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 705 | Open in IMG/M |
| 3300026377|Ga0257171_1013153 | Not Available | 1369 | Open in IMG/M |
| 3300026467|Ga0257154_1000977 | All Organisms → cellular organisms → Bacteria | 3172 | Open in IMG/M |
| 3300026475|Ga0257147_1026029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 831 | Open in IMG/M |
| 3300026481|Ga0257155_1082142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 524 | Open in IMG/M |
| 3300026489|Ga0257160_1051268 | Not Available | 713 | Open in IMG/M |
| 3300026490|Ga0257153_1010894 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300026508|Ga0257161_1031730 | Not Available | 1039 | Open in IMG/M |
| 3300026523|Ga0209808_1228800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 597 | Open in IMG/M |
| 3300026530|Ga0209807_1107850 | Not Available | 1185 | Open in IMG/M |
| 3300026538|Ga0209056_10198211 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1473 | Open in IMG/M |
| 3300026551|Ga0209648_10039421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4090 | Open in IMG/M |
| 3300026551|Ga0209648_10800380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 515 | Open in IMG/M |
| 3300026557|Ga0179587_10111778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1665 | Open in IMG/M |
| 3300027381|Ga0208983_1018374 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1362 | Open in IMG/M |
| 3300027570|Ga0208043_1041391 | Not Available | 1380 | Open in IMG/M |
| 3300027616|Ga0209106_1023605 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1344 | Open in IMG/M |
| 3300027655|Ga0209388_1169332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 613 | Open in IMG/M |
| 3300027663|Ga0208990_1022079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2067 | Open in IMG/M |
| 3300027684|Ga0209626_1019665 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300027812|Ga0209656_10006530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 7489 | Open in IMG/M |
| 3300027846|Ga0209180_10106318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300027846|Ga0209180_10670510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 567 | Open in IMG/M |
| 3300027854|Ga0209517_10564962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 608 | Open in IMG/M |
| 3300027875|Ga0209283_10981900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 505 | Open in IMG/M |
| 3300027882|Ga0209590_10170415 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 1362 | Open in IMG/M |
| 3300028015|Ga0265353_1002512 | Not Available | 1369 | Open in IMG/M |
| 3300028047|Ga0209526_10538904 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300030854|Ga0075385_11315155 | Not Available | 526 | Open in IMG/M |
| 3300030935|Ga0075401_11979326 | Not Available | 671 | Open in IMG/M |
| 3300031231|Ga0170824_127500198 | Not Available | 1268 | Open in IMG/M |
| 3300031525|Ga0302326_11107144 | Not Available | 1100 | Open in IMG/M |
| 3300031708|Ga0310686_108026808 | Not Available | 1231 | Open in IMG/M |
| 3300031754|Ga0307475_10185158 | Not Available | 1662 | Open in IMG/M |
| 3300031910|Ga0306923_10440305 | Not Available | 1479 | Open in IMG/M |
| 3300031942|Ga0310916_11287654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 602 | Open in IMG/M |
| 3300031954|Ga0306926_10599327 | Not Available | 1346 | Open in IMG/M |
| 3300031954|Ga0306926_12675496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 542 | Open in IMG/M |
| 3300031962|Ga0307479_10361385 | Not Available | 1435 | Open in IMG/M |
| 3300031962|Ga0307479_11363500 | Not Available | 669 | Open in IMG/M |
| 3300032059|Ga0318533_11172883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 562 | Open in IMG/M |
| 3300032094|Ga0318540_10288992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_61_14 | 791 | Open in IMG/M |
| 3300032160|Ga0311301_10741312 | Not Available | 1367 | Open in IMG/M |
| 3300032174|Ga0307470_10014464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3381 | Open in IMG/M |
| 3300032261|Ga0306920_101163112 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300033977|Ga0314861_0422706 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 | Host-Associated | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03953800 | 2088090014 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDWSDFLGTAL |
| INPgaii200_09874731 | 2228664022 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDWSDFLGTALIL |
| JGI1027J11758_129769632 | 3300000789 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDWSDFLGTALICIQ* |
| JGI1027J12803_1000664122 | 3300000955 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDWSDFLGTALI |
| JGI12053J15887_101591271 | 3300001661 | Forest Soil | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTA |
| JGI12053J15887_101720652 | 3300001661 | Forest Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALILGIK* |
| JGI12627J18819_101402402 | 3300001867 | Forest Soil | MGPNEKQKIEIEKLHWAPLPPLNQAVTADYADFLGTAL |
| JGI25617J43924_102993251 | 3300002914 | Grasslands Soil | MAPKEKEKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALNLYETASNFGIQA* |
| JGI25389J43894_10472933 | 3300002916 | Grasslands Soil | MAPNEKQTIEIEKLERDPLLSFNQAVTGDCSDFLGTALIS |
| JGI25616J43925_104013142 | 3300002917 | Grasslands Soil | IEIEKSHRDPLVSFNQAVTVDCSDFLGTALISTQLVGTGH* |
| JGI26339J46600_100371352 | 3300003218 | Bog Forest Soil | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALLHYYNF |
| Ga0066672_100470587 | 3300005167 | Soil | MRKSSRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALISQNLSGEAP* |
| Ga0066673_102382092 | 3300005175 | Soil | MAPKEKQTIEIEKTHGDPLLPFNQAVTVDCSDFLGTALVANEKVW* |
| Ga0066671_104923801 | 3300005184 | Soil | KEKQKIEIKKTRRDPLLLFHQAVTVNCSDFLGTALIEKSA* |
| Ga0066675_102395553 | 3300005187 | Soil | MAPKEKQTIEIEKTHGDPLLPFNQAVTVDCSDFLGTALK* |
| Ga0066681_101655651 | 3300005451 | Soil | RMAPKEKQQIEIEKTHRDPLPSFNQAVTVDCSDFLGTALIFGTP* |
| Ga0066687_100926742 | 3300005454 | Soil | MAPKEKQKIEIEKTYGDPLLSFHQAVTVNYSDFLGTALIEKNA* |
| Ga0066704_103958921 | 3300005557 | Soil | MAPKEKQKIEIEKTHRDPLPSFNQAVTVDCSDFLGTAL |
| Ga0066698_101723544 | 3300005558 | Soil | MAPKEKQQIEIEKTHRDPLPSFNQAVTVDCSDFLGTAL |
| Ga0066693_101643221 | 3300005566 | Soil | SRMAPKEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALHGTY* |
| Ga0066703_101139552 | 3300005568 | Soil | MAPKEKQKIEIEKTHGDPLLSFHQAVTVNYSDFLGTALIEKSA* |
| Ga0066694_100134924 | 3300005574 | Soil | MAPKEKQQIEIEKTHRDPLPSFNQAVTVDCSDFLGTALIFGTP* |
| Ga0066691_103443981 | 3300005586 | Soil | SRMAPKEKQKIEIEKTHRDPLLSFNQAVTVNCSGFLGTALF* |
| Ga0070761_102677322 | 3300005591 | Soil | MRRNEKQKIEIEKLHWDPLPPLNQAVTADYSDFLGTALI |
| Ga0070766_106565332 | 3300005921 | Soil | MAPKVKQKIEIEKTHRDPLLSFHQAVTMVCSDFLGTAL |
| Ga0070766_106642712 | 3300005921 | Soil | MAPKEKQKIEIEKSHRDPLLSFHQAVTMVCSDFLGTA |
| Ga0066651_100498343 | 3300006031 | Soil | RMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTAL* |
| Ga0066651_104232821 | 3300006031 | Soil | MAPKEKQTIEIEKTHGDPLLPFNQAVTVDCSDFLGTAL |
| Ga0066665_103407082 | 3300006796 | Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALMLGEEG* |
| Ga0066659_100039691 | 3300006797 | Soil | MAPKEKQTIEIEKTHGDPLLPFNQAVTVDCSDFLGTALALLTF* |
| Ga0066659_101525182 | 3300006797 | Soil | SRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALSPNT* |
| Ga0066659_107663442 | 3300006797 | Soil | SRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALITSYR* |
| Ga0066659_109158481 | 3300006797 | Soil | SSRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALW* |
| Ga0099793_105750551 | 3300007258 | Vadose Zone Soil | SSRMAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALGQ* |
| Ga0099829_101929512 | 3300009038 | Vadose Zone Soil | KQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIMAFIFR* |
| Ga0099829_107533231 | 3300009038 | Vadose Zone Soil | MAPKEKQTIEIEKTHRDPLLSFNQAVTVGCSDFLGTAL |
| Ga0099830_107233312 | 3300009088 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIMN |
| Ga0099830_113223831 | 3300009088 | Vadose Zone Soil | KEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIMNQ* |
| Ga0099828_101997133 | 3300009089 | Vadose Zone Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALMRFVD* |
| Ga0099827_104204311 | 3300009090 | Vadose Zone Soil | MAPKEKQTIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIHDLM |
| Ga0066709_1023546921 | 3300009137 | Grasslands Soil | MESAPKEKQAIEIEKTHRDPLLAFNQAVTVDCSDFLGTAL |
| Ga0134109_103378481 | 3300010320 | Grasslands Soil | MAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTAL |
| Ga0134067_101911481 | 3300010321 | Grasslands Soil | MAPKEKQTIEIEKTHRDPLLSFNQAVTVDCSDFLGTAL |
| Ga0134067_104278332 | 3300010321 | Grasslands Soil | APKEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALHGTY* |
| Ga0134067_104622651 | 3300010321 | Grasslands Soil | KEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALI* |
| Ga0134065_100872652 | 3300010326 | Grasslands Soil | MATKEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALIAE |
| Ga0134062_102384612 | 3300010337 | Grasslands Soil | MAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTAL* |
| Ga0137389_100678711 | 3300012096 | Vadose Zone Soil | IEIEKTHRDPLLSFNQAVTVDCSDFLGTALIMAFIFR* |
| Ga0137364_103244221 | 3300012198 | Vadose Zone Soil | SSRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALGSTDKTRAY* |
| Ga0137382_113328521 | 3300012200 | Vadose Zone Soil | SSRMAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALDANGFS* |
| Ga0137399_102687531 | 3300012203 | Vadose Zone Soil | RMAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALISDF* |
| Ga0137362_100179761 | 3300012205 | Vadose Zone Soil | RRMAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALKKNNK* |
| Ga0137362_106874622 | 3300012205 | Vadose Zone Soil | RMAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALISDQ* |
| Ga0137378_104358171 | 3300012210 | Vadose Zone Soil | MAPKEKQKIEIEKSHRDPLLSLNQAVTVDCSDFLGTALL |
| Ga0137378_107431011 | 3300012210 | Vadose Zone Soil | MGPNEKQKIEIEKLRPAPLPPLNQAVTADYSDFLGTALI |
| Ga0137387_102280071 | 3300012349 | Vadose Zone Soil | MAPREKQKIEIEKTHRDPLLSFHQAVTVDRSDFLGTALIRN |
| Ga0137386_109902931 | 3300012351 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSFNQGVTVDCSDFLGTALSSKTNRQAAACA |
| Ga0137360_112385383 | 3300012361 | Vadose Zone Soil | RMAPKEKQKIEIEKTHRDPLLSFNQAVTVNCSGFLGTALIQGK* |
| Ga0137390_112567801 | 3300012363 | Vadose Zone Soil | MAPKEKQTIEIEKTHRDPLLSFNQAVTVGCSDFLGTA |
| Ga0137397_100044071 | 3300012685 | Vadose Zone Soil | SSRMAPKEKQTIEIEKSHRDPLLSFNQAVTVDCSDFLGTALSQHIEIN* |
| Ga0137397_100361583 | 3300012685 | Vadose Zone Soil | SRMAPKEKQTIEIEKSHRDPLLSFNQAVTVDCSDFLGTALKGIQSCG* |
| Ga0137397_101165533 | 3300012685 | Vadose Zone Soil | EKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALIVNLFS* |
| Ga0137396_112541911 | 3300012918 | Vadose Zone Soil | APKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALPGKM* |
| Ga0137419_101926603 | 3300012925 | Vadose Zone Soil | SRMAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALGQ* |
| Ga0137419_105672991 | 3300012925 | Vadose Zone Soil | PKEKQKIEIEKSHKDPLLSFNQAVTVDCSDFLGTALTFSV* |
| Ga0137419_115804381 | 3300012925 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALVDFMNQAR* |
| Ga0137416_103989641 | 3300012927 | Vadose Zone Soil | KQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALISNF* |
| Ga0137404_101838471 | 3300012929 | Vadose Zone Soil | EKQKIEIEKTHRDPLLSFNQAVTVNCSGFLGTALIRFF* |
| Ga0137407_121217091 | 3300012930 | Vadose Zone Soil | RMAPKEKQKIEIEKTHRDPLLSFNQAVTVNCSGFLGTALIRFF* |
| Ga0137410_101536252 | 3300012944 | Vadose Zone Soil | SRMAPKEKQTIEIEKSHRDPLLSFNQAVTVDCSDFLGTALIVNLFS* |
| Ga0134110_101755891 | 3300012975 | Grasslands Soil | EKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALICSIETVFS* |
| Ga0182024_110969461 | 3300014501 | Permafrost | MAPKEKQKIEIAKTHGDPLLSFNQAVTVDCSDFLGTAL |
| Ga0182024_118910381 | 3300014501 | Permafrost | SSRIAPKEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALLGNS* |
| Ga0137405_10430862 | 3300015053 | Vadose Zone Soil | MAPKENEKIEIEKSHRDPLLSFNQAVTVDCSDFLGTAL |
| Ga0137418_109436861 | 3300015241 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSLHQAVTVDCSDFLGTAL |
| Ga0181511_14013332 | 3300016702 | Peatland | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLG |
| Ga0187819_100645782 | 3300017943 | Freshwater Sediment | MRPNEKQKIEIEKLHRDPLPPLNQAVTVDYSDFRGTALNSNNQLWSA |
| Ga0187859_104275262 | 3300018047 | Peatland | MAPNEKQKIEIEKTHRDTLLSFNQAVTVDCSDFLGTALIEDQVFAVLTRSFR |
| Ga0066655_110400891 | 3300018431 | Grasslands Soil | MRKSSRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTAL |
| Ga0066667_102603163 | 3300018433 | Grasslands Soil | RMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALISQNLSGEAP |
| Ga0066662_115609492 | 3300018468 | Grasslands Soil | MAPKEKQKIEIEKSHRDPLLSLNQAVTVDCSDFLGTALFGH |
| Ga0066669_100842392 | 3300018482 | Grasslands Soil | SSRMAPKEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALHGTY |
| Ga0137408_13082361 | 3300019789 | Vadose Zone Soil | MAPKEKHKIEIEKTHRDPLLSFHQAVTVDCSDFLGTGTDAGMISERYRR |
| Ga0193735_10382761 | 3300020006 | Soil | MAPKQRQEIEIEKTHPDPLLSFNQTVTANCTDFLGTVLKQYNE |
| Ga0179592_103083051 | 3300020199 | Vadose Zone Soil | ENQKIEIEKTHRDPLLSFNQAVTADCSDFLGTALILN |
| Ga0210407_113342751 | 3300020579 | Soil | MAPKENQKIEIEKTPRDPLLSFNQAVTADCSDFLGTALGFDIG |
| Ga0179596_102918391 | 3300021086 | Vadose Zone Soil | MAPKKKQKIEIEKTHRDPLLSFNQAVTGDCSDFLGTALISVLFKSP |
| Ga0210405_112295732 | 3300021171 | Soil | MAPNEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALIY |
| Ga0210388_107393632 | 3300021181 | Soil | MAPKVKQKIEIEKSHKDPLLSFHQAVTMVCSDFLGTALIWNKK |
| Ga0210387_101139101 | 3300021405 | Soil | IATKEQQKIEIEKTPRDPLLSFNQAVTADCSDFLGTALILGKK |
| Ga0212123_102322252 | 3300022557 | Iron-Sulfur Acid Spring | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCLDFLGTAL |
| Ga0224570_1013531 | 3300022730 | Rhizosphere | MGPNEKQKIEIEKLHRDPLPPLNQAVTADYSDFLGTALIRTP |
| Ga0224571_1016003 | 3300022734 | Rhizosphere | MGPNEKQKIEIEKLHRDPLPPLNQAVTADYSDFLGTALIENP |
| Ga0224561_10049661 | 3300023030 | Soil | KQKIEIEKLHRDPLPPLNQAVTADYSDFLGTALISNTTICFWH |
| Ga0224572_10098024 | 3300024225 | Rhizosphere | MGPNEKQKIEIEKLHRDPLPPLNQAVTADYSDFLGTALISNTTIC |
| Ga0224572_10597432 | 3300024225 | Rhizosphere | QKIEIEKLHRDPLPPLNQAVTADYSDFLGTALILTL |
| Ga0137417_11167412 | 3300024330 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTAL |
| Ga0209350_10272111 | 3300026277 | Grasslands Soil | KSSRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTAL |
| Ga0209688_10502342 | 3300026305 | Soil | KQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALHGTY |
| Ga0209468_11481342 | 3300026306 | Soil | MAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALSP |
| Ga0209239_10329043 | 3300026310 | Grasslands Soil | VMRKSSRMAPKEKQTIEIEKTDRDPLLSFNQAVTVDCSDFLGTALMPWINAIML |
| Ga0209761_10999451 | 3300026313 | Grasslands Soil | MAPKEKQQIEIEKTHRDPLPSFNQAVTVDCSDFLGTALIH |
| Ga0209802_10608823 | 3300026328 | Soil | MAPKQRQKIEIDKTHRGPLVSFNQAVTVDCSDFLGTALV |
| Ga0209158_13476001 | 3300026333 | Soil | MAPKQRQKIEIEKTHRDPLLPFNQAVTVNCSDFLGTALILDHFRLSIF |
| Ga0257151_10153511 | 3300026341 | Soil | MAPKEKQKIEIEKTHRDPLPSFNQAVTVDCLDFLGTALIRYKEARLLAPDP |
| Ga0257149_10356292 | 3300026355 | Soil | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALN |
| Ga0257171_10131531 | 3300026377 | Soil | MGPNEKQKIEIEKLHWAPLPPLNQAVTADYSDFLGTALIRTPSSSR |
| Ga0257154_10009771 | 3300026467 | Soil | EKQKIEIDKLHWDPLPPLNQAVTADYIDFLGTALI |
| Ga0257147_10260292 | 3300026475 | Soil | MAPKEKQKIEIEKTHRDPLPSFNQAVTVDCLDFLGTALISLI |
| Ga0257155_10821421 | 3300026481 | Soil | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALI |
| Ga0257160_10512681 | 3300026489 | Soil | MGPNEKQKIEIEKLHWAPLPPLNQAVTADYSDFLGTALIRTP |
| Ga0257153_10108941 | 3300026490 | Soil | MAPKEKQKIEIEKTHRDPLLSFNQAVTVNCSDFLGTALL |
| Ga0257161_10317302 | 3300026508 | Soil | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALISN |
| Ga0209808_12288001 | 3300026523 | Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTALFQEMSCGGIPN |
| Ga0209807_11078501 | 3300026530 | Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCPDFLGTAL |
| Ga0209056_101982112 | 3300026538 | Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALMLGEEG |
| Ga0209648_100394211 | 3300026551 | Grasslands Soil | RMAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALIRNQ |
| Ga0209648_108003802 | 3300026551 | Grasslands Soil | MAPKEKEKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALNLYETASNFGIQA |
| Ga0179587_101117783 | 3300026557 | Vadose Zone Soil | PKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALISDF |
| Ga0208983_10183741 | 3300027381 | Forest Soil | MAPKEKQKIEIEKSHGDPLLSFNQAVTVDCSDFLGTALAGLFKSG |
| Ga0208043_10413911 | 3300027570 | Peatlands Soil | MASSPRVAIKRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIL |
| Ga0209106_10236052 | 3300027616 | Forest Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALI |
| Ga0209388_11693322 | 3300027655 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSFNQAVTVYCSDFLGTALLLDREAH |
| Ga0208990_10220791 | 3300027663 | Forest Soil | MAPKEKQKIEIEKTHRDPLLSLHQAVTVDCSDFLG |
| Ga0209626_10196653 | 3300027684 | Forest Soil | MAPKEKQKIEIEKSHGDPLLSFNQAVTVDCLGFLGT |
| Ga0209656_100065306 | 3300027812 | Bog Forest Soil | APKEKQKIEIEKSHRDPLLSFNQAVTVDCSDFLGTALI |
| Ga0209180_101063182 | 3300027846 | Vadose Zone Soil | KQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIMAFIFR |
| Ga0209180_106705101 | 3300027846 | Vadose Zone Soil | MAPKEKQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALMQQ |
| Ga0209517_105649621 | 3300027854 | Peatlands Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALITN |
| Ga0209283_109819002 | 3300027875 | Vadose Zone Soil | MAPKEKQTIEIEKTHRDPLLSFNQAVTVGCSDFLGTALIF |
| Ga0209590_101704151 | 3300027882 | Vadose Zone Soil | MAPKEKQKIEIEKTHGDPLLSFNQAVTVDCSDFLGTALIFDSS |
| Ga0265353_10025122 | 3300028015 | Soil | MGPNEKQKIEIEKLHRDPLPPLNQAVTADYSDFLGTALIL |
| Ga0209526_105389041 | 3300028047 | Forest Soil | MRPNEKQKMEIEKLHWAPLPPLNQAVTSDYSDSVGTALS |
| Ga0075385_113151552 | 3300030854 | Soil | MEPNGKQKIEIEKLHWNSLPPLNQAVTEVYSDFLG |
| Ga0075401_119793262 | 3300030935 | Soil | MGPNEKQKIEIEKLHRGPLPPLHQAVKADYSDFLGTALI |
| Ga0170824_1275001981 | 3300031231 | Forest Soil | MEPNGKQKIEIEKLHWNSLPPLNQAVTAVYSDFLGTALISNE |
| Ga0302326_111071441 | 3300031525 | Palsa | MAPNEKQKIEIEKTHRDTLLSFNQAVTVDCSDFLGTALNSDHSA |
| Ga0310686_1080268081 | 3300031708 | Soil | MAPKEKQKIEIEKSHRDPLLSFNQAVTVDCSNFLGTAL |
| Ga0306917_102106683 | 3300031719 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALVVSQNAILRGDGVSGA |
| Ga0307475_101851581 | 3300031754 | Hardwood Forest Soil | MGPNEKQKIEIEKLHWAPLPPLNQAVTADYADFLGTALI |
| Ga0306923_104403051 | 3300031910 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALVVSQNAILR |
| Ga0310916_112876542 | 3300031942 | Soil | MAPNEKQKIEIEKTHEDPLLLFNQAVTLDCWDFLGTALILKYC |
| Ga0306926_105993271 | 3300031954 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALI |
| Ga0306926_126754962 | 3300031954 | Soil | MAPNEKQKIEIEKTHRDPLLSFNQAVTLDCWDFLGTALKKYEKG |
| Ga0307479_103613852 | 3300031962 | Hardwood Forest Soil | MGPNEKQKIEIEKLHWAPLPPLNQAVTADYADFLGTALIPNL |
| Ga0307479_113635001 | 3300031962 | Hardwood Forest Soil | SNMGPNEKQKIEIEKLHWAPLPPLNQAVTADYADFLGTALIRDLQFRD |
| Ga0318533_103009931 | 3300032059 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALVVSQNAILRGDGV |
| Ga0318533_111728832 | 3300032059 | Soil | MAPNEKQKIEIEKTHRDPLLSFNQAVTLDCWDFLGTALIR |
| Ga0318540_102889921 | 3300032094 | Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALIAHNDQ |
| Ga0311301_107413122 | 3300032160 | Peatlands Soil | MAPKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALILNLSRAPSSA |
| Ga0307470_100144643 | 3300032174 | Hardwood Forest Soil | MGPNEKQKIEIEKLHWAPLPPLNQAVTADYADFLGTALSLNK |
| Ga0306920_1011631121 | 3300032261 | Soil | PKQRQKIEIEKTHRDPLLSFNQAVTVDCSDFLGTALFSDR |
| Ga0314861_0422706_439_579 | 3300033977 | Peatland | RSSNMGPSEKQKIEIEKLHRGLLPPLNQAVTTGYSDFLGTALVSNI |
| ⦗Top⦘ |