


| Basic Information | |
|---|---|
| Family ID | F044864 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 153 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKRPLIGREDFEASIGQGEQAQGKVMEAYQGREEYLVLGKGERRRMNV |
| Number of Associated Samples | 9 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 6.25 % |
| % of genes near scaffold ends (potentially truncated) | 1.96 % |
| % of genes from short scaffolds (< 2000 bps) | 14.38 % |
| Associated GOLD sequencing projects | 7 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.974 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated (100.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant corpus (100.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.32% β-sheet: 0.00% Coil/Unstructured: 48.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 5.26 |
| PF00665 | rve | 2.63 |
| PF07727 | RVT_2 | 2.63 |
| PF02992 | Transposase_21 | 1.97 |
| PF04937 | DUF659 | 1.97 |
| PF14432 | DYW_deaminase | 1.97 |
| PF03732 | Retrotrans_gag | 1.97 |
| PF10513 | EPL1 | 1.32 |
| PF14214 | Helitron_like_N | 1.32 |
| PF13207 | AAA_17 | 1.32 |
| PF14244 | Retrotran_gag_3 | 1.32 |
| PF09668 | Asp_protease | 1.32 |
| PF14223 | Retrotran_gag_2 | 1.32 |
| PF00385 | Chromo | 0.66 |
| PF02179 | BAG | 0.66 |
| PF06549 | DUF1118 | 0.66 |
| PF00656 | Peptidase_C14 | 0.66 |
| PF06098 | Radial_spoke_3 | 0.66 |
| PF03372 | Exo_endo_phos | 0.66 |
| PF09265 | Cytokin-bind | 0.66 |
| PF11744 | ALMT | 0.66 |
| PF00069 | Pkinase | 0.66 |
| PF08284 | RVP_2 | 0.66 |
| PF00724 | Oxidored_FMN | 0.66 |
| PF07714 | PK_Tyr_Ser-Thr | 0.66 |
| PF00575 | S1 | 0.66 |
| PF13960 | DUF4218 | 0.66 |
| PF03031 | NIF | 0.66 |
| PF13976 | gag_pre-integrs | 0.66 |
| PF00702 | Hydrolase | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.26 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 2.63 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 2.63 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 2.63 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 2.63 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.66 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.66 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.66 |
| COG5190 | TFIIF-interacting CTD phosphatase, includes NLI-interacting factor | Transcription [K] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.97 % |
| All Organisms | root | All Organisms | 32.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009500|Ga0116229_10000195 | Not Available | 68131 | Open in IMG/M |
| 3300009500|Ga0116229_10000303 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 60097 | Open in IMG/M |
| 3300009500|Ga0116229_10000311 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina | 59616 | Open in IMG/M |
| 3300009500|Ga0116229_10000371 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 57326 | Open in IMG/M |
| 3300009500|Ga0116229_10000521 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 51524 | Open in IMG/M |
| 3300009500|Ga0116229_10000793 | All Organisms → cellular organisms → Eukaryota | 45712 | Open in IMG/M |
| 3300009500|Ga0116229_10001001 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens | 42358 | Open in IMG/M |
| 3300009500|Ga0116229_10001143 | Not Available | 40413 | Open in IMG/M |
| 3300009500|Ga0116229_10001464 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 37050 | Open in IMG/M |
| 3300009500|Ga0116229_10001694 | Not Available | 34959 | Open in IMG/M |
| 3300009500|Ga0116229_10002185 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus | 31416 | Open in IMG/M |
| 3300009500|Ga0116229_10002203 | Not Available | 31320 | Open in IMG/M |
| 3300009500|Ga0116229_10002390 | Not Available | 30281 | Open in IMG/M |
| 3300009500|Ga0116229_10003749 | Not Available | 25015 | Open in IMG/M |
| 3300009500|Ga0116229_10004176 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 23705 | Open in IMG/M |
| 3300009500|Ga0116229_10005488 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 20669 | Open in IMG/M |
| 3300009500|Ga0116229_10005639 | All Organisms → cellular organisms → Eukaryota | 20325 | Open in IMG/M |
| 3300009500|Ga0116229_10005810 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina | 20015 | Open in IMG/M |
| 3300009500|Ga0116229_10006268 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis | 19202 | Open in IMG/M |
| 3300009500|Ga0116229_10008392 | All Organisms → cellular organisms → Eukaryota | 16064 | Open in IMG/M |
| 3300009500|Ga0116229_10009309 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 15016 | Open in IMG/M |
| 3300009500|Ga0116229_10010017 | Not Available | 14316 | Open in IMG/M |
| 3300009500|Ga0116229_10011499 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 13031 | Open in IMG/M |
| 3300009500|Ga0116229_10016039 | Not Available | 10114 | Open in IMG/M |
| 3300009500|Ga0116229_10018106 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus | 9208 | Open in IMG/M |
| 3300009500|Ga0116229_10018222 | Not Available | 9163 | Open in IMG/M |
| 3300009500|Ga0116229_10018263 | Not Available | 9150 | Open in IMG/M |
| 3300009500|Ga0116229_10020506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B | 8369 | Open in IMG/M |
| 3300009500|Ga0116229_10028288 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus | 6451 | Open in IMG/M |
| 3300009500|Ga0116229_10033099 | Not Available | 5686 | Open in IMG/M |
| 3300009500|Ga0116229_10048665 | Not Available | 4268 | Open in IMG/M |
| 3300009500|Ga0116229_10049642 | Not Available | 4208 | Open in IMG/M |
| 3300009500|Ga0116229_10050759 | Not Available | 4143 | Open in IMG/M |
| 3300009500|Ga0116229_10053208 | Not Available | 4005 | Open in IMG/M |
| 3300009500|Ga0116229_10060975 | Not Available | 3635 | Open in IMG/M |
| 3300009500|Ga0116229_10084247 | Not Available | 2923 | Open in IMG/M |
| 3300009500|Ga0116229_10102393 | Not Available | 2581 | Open in IMG/M |
| 3300009500|Ga0116229_10104111 | Not Available | 2554 | Open in IMG/M |
| 3300009500|Ga0116229_10174452 | Not Available | 1866 | Open in IMG/M |
| 3300009500|Ga0116229_10314719 | Not Available | 1319 | Open in IMG/M |
| 3300009500|Ga0116229_10325573 | Not Available | 1294 | Open in IMG/M |
| 3300009500|Ga0116229_10366539 | Not Available | 1207 | Open in IMG/M |
| 3300009500|Ga0116229_10382990 | Not Available | 1176 | Open in IMG/M |
| 3300009500|Ga0116229_10606353 | Not Available | 899 | Open in IMG/M |
| 3300009500|Ga0116229_10930742 | Not Available | 701 | Open in IMG/M |
| 3300009500|Ga0116229_11064999 | Not Available | 648 | Open in IMG/M |
| 3300009510|Ga0116230_10000097 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida | 64691 | Open in IMG/M |
| 3300009510|Ga0116230_10001211 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens | 24143 | Open in IMG/M |
| 3300009510|Ga0116230_10004869 | Not Available | 13143 | Open in IMG/M |
| 3300009510|Ga0116230_10007339 | Not Available | 10887 | Open in IMG/M |
| 3300009510|Ga0116230_10129801 | Not Available | 2117 | Open in IMG/M |
| 3300009510|Ga0116230_10255763 | Not Available | 1403 | Open in IMG/M |
| 3300009510|Ga0116230_10257270 | Not Available | 1398 | Open in IMG/M |
| 3300009510|Ga0116230_10263498 | Not Available | 1378 | Open in IMG/M |
| 3300009510|Ga0116230_10322565 | Not Available | 1218 | Open in IMG/M |
| 3300009697|Ga0116231_10000021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida | 141390 | Open in IMG/M |
| 3300009697|Ga0116231_10000280 | Not Available | 79887 | Open in IMG/M |
| 3300009697|Ga0116231_10001622 | Not Available | 46418 | Open in IMG/M |
| 3300009697|Ga0116231_10002228 | Not Available | 40501 | Open in IMG/M |
| 3300009697|Ga0116231_10002228 | Not Available | 40501 | Open in IMG/M |
| 3300009697|Ga0116231_10002978 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina | 35406 | Open in IMG/M |
| 3300009697|Ga0116231_10004080 | Not Available | 29769 | Open in IMG/M |
| 3300009697|Ga0116231_10004559 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 27934 | Open in IMG/M |
| 3300009697|Ga0116231_10008740 | Not Available | 17575 | Open in IMG/M |
| 3300009697|Ga0116231_10010847 | Not Available | 14373 | Open in IMG/M |
| 3300009697|Ga0116231_10011234 | All Organisms → cellular organisms → Eukaryota | 13905 | Open in IMG/M |
| 3300009697|Ga0116231_10012278 | Not Available | 12685 | Open in IMG/M |
| 3300009697|Ga0116231_10032398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B | 4442 | Open in IMG/M |
| 3300009697|Ga0116231_10041704 | Not Available | 3540 | Open in IMG/M |
| 3300009697|Ga0116231_10042883 | Not Available | 3453 | Open in IMG/M |
| 3300009697|Ga0116231_10091938 | Not Available | 1904 | Open in IMG/M |
| 3300009697|Ga0116231_10107771 | Not Available | 1702 | Open in IMG/M |
| 3300009697|Ga0116231_10276136 | Not Available | 935 | Open in IMG/M |
| 3300009701|Ga0116228_10044264 | Not Available | 3611 | Open in IMG/M |
| 3300009701|Ga0116228_10840642 | Not Available | 615 | Open in IMG/M |
| 3300009709|Ga0116227_10000700 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina | 67868 | Open in IMG/M |
| 3300009709|Ga0116227_10001598 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 51004 | Open in IMG/M |
| 3300009709|Ga0116227_10003013 | Not Available | 37840 | Open in IMG/M |
| 3300009709|Ga0116227_10003296 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 36062 | Open in IMG/M |
| 3300009709|Ga0116227_10006146 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 24592 | Open in IMG/M |
| 3300009709|Ga0116227_10017509 | Not Available | 9989 | Open in IMG/M |
| 3300009709|Ga0116227_10044518 | Not Available | 4215 | Open in IMG/M |
| 3300009709|Ga0116227_10091318 | Not Available | 2505 | Open in IMG/M |
| 3300009787|Ga0116226_10001427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B | 20715 | Open in IMG/M |
| 3300009787|Ga0116226_10002855 | Not Available | 15162 | Open in IMG/M |
| 3300009787|Ga0116226_10011119 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha | 8283 | Open in IMG/M |
| 3300009787|Ga0116226_10014554 | Not Available | 7377 | Open in IMG/M |
| 3300009787|Ga0116226_10024094 | Not Available | 5899 | Open in IMG/M |
| 3300009787|Ga0116226_10051602 | Not Available | 4155 | Open in IMG/M |
| 3300009787|Ga0116226_10070014 | Not Available | 3584 | Open in IMG/M |
| 3300009787|Ga0116226_10086934 | Not Available | 3218 | Open in IMG/M |
| 3300009787|Ga0116226_10658261 | Not Available | 1042 | Open in IMG/M |
| 3300009787|Ga0116226_11062906 | Not Available | 775 | Open in IMG/M |
| 3300010200|Ga0127507_1231590 | Not Available | 504 | Open in IMG/M |
| 3300027807|Ga0209208_10000925 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 40084 | Open in IMG/M |
| 3300027807|Ga0209208_10012912 | Not Available | 10506 | Open in IMG/M |
| 3300027807|Ga0209208_10029575 | Not Available | 5664 | Open in IMG/M |
| 3300027807|Ga0209208_10080901 | Not Available | 2377 | Open in IMG/M |
| 3300027807|Ga0209208_10123560 | Not Available | 1647 | Open in IMG/M |
| 3300027807|Ga0209208_10279411 | Not Available | 866 | Open in IMG/M |
| 3300027860|Ga0209611_10000172 | Not Available | 81674 | Open in IMG/M |
| 3300027860|Ga0209611_10000212 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 74913 | Open in IMG/M |
| 3300027860|Ga0209611_10000236 | Not Available | 73041 | Open in IMG/M |
| 3300027860|Ga0209611_10000437 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 61099 | Open in IMG/M |
| 3300027860|Ga0209611_10000520 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 58062 | Open in IMG/M |
| 3300027860|Ga0209611_10000665 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida | 53504 | Open in IMG/M |
| 3300027860|Ga0209611_10000824 | All Organisms → cellular organisms → Eukaryota | 49292 | Open in IMG/M |
| 3300027860|Ga0209611_10000863 | Not Available | 48543 | Open in IMG/M |
| 3300027860|Ga0209611_10001766 | Not Available | 37494 | Open in IMG/M |
| 3300027860|Ga0209611_10001785 | Not Available | 37335 | Open in IMG/M |
| 3300027860|Ga0209611_10002017 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 35501 | Open in IMG/M |
| 3300027860|Ga0209611_10002345 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 33183 | Open in IMG/M |
| 3300027860|Ga0209611_10002964 | Not Available | 29731 | Open in IMG/M |
| 3300027860|Ga0209611_10003823 | Not Available | 25954 | Open in IMG/M |
| 3300027860|Ga0209611_10004085 | Not Available | 25046 | Open in IMG/M |
| 3300027860|Ga0209611_10004194 | Not Available | 24744 | Open in IMG/M |
| 3300027860|Ga0209611_10004281 | All Organisms → cellular organisms → Eukaryota | 24470 | Open in IMG/M |
| 3300027860|Ga0209611_10004970 | All Organisms → cellular organisms → Eukaryota | 22525 | Open in IMG/M |
| 3300027860|Ga0209611_10006229 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 19645 | Open in IMG/M |
| 3300027860|Ga0209611_10006448 | Not Available | 19218 | Open in IMG/M |
| 3300027860|Ga0209611_10008419 | All Organisms → cellular organisms → Eukaryota | 16128 | Open in IMG/M |
| 3300027860|Ga0209611_10009324 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 14904 | Open in IMG/M |
| 3300027860|Ga0209611_10009672 | Not Available | 14489 | Open in IMG/M |
| 3300027860|Ga0209611_10009687 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus | 14470 | Open in IMG/M |
| 3300027860|Ga0209611_10009799 | Not Available | 14350 | Open in IMG/M |
| 3300027860|Ga0209611_10010162 | Not Available | 13954 | Open in IMG/M |
| 3300027860|Ga0209611_10011872 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina | 12405 | Open in IMG/M |
| 3300027860|Ga0209611_10015721 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 9827 | Open in IMG/M |
| 3300027860|Ga0209611_10016449 | Not Available | 9442 | Open in IMG/M |
| 3300027860|Ga0209611_10017428 | Not Available | 8986 | Open in IMG/M |
| 3300027860|Ga0209611_10018882 | Not Available | 8387 | Open in IMG/M |
| 3300027860|Ga0209611_10020165 | Not Available | 7898 | Open in IMG/M |
| 3300027860|Ga0209611_10020424 | Not Available | 7798 | Open in IMG/M |
| 3300027860|Ga0209611_10024988 | Not Available | 6457 | Open in IMG/M |
| 3300027860|Ga0209611_10031705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus | 5118 | Open in IMG/M |
| 3300027860|Ga0209611_10032936 | Not Available | 4939 | Open in IMG/M |
| 3300027860|Ga0209611_10040279 | Not Available | 4091 | Open in IMG/M |
| 3300027860|Ga0209611_10041901 | Not Available | 3950 | Open in IMG/M |
| 3300027860|Ga0209611_10046526 | Not Available | 3593 | Open in IMG/M |
| 3300027860|Ga0209611_10050262 | Not Available | 3358 | Open in IMG/M |
| 3300027860|Ga0209611_10053601 | Not Available | 3178 | Open in IMG/M |
| 3300027860|Ga0209611_10065548 | Not Available | 2692 | Open in IMG/M |
| 3300027860|Ga0209611_10090586 | Not Available | 2103 | Open in IMG/M |
| 3300027860|Ga0209611_10115074 | Not Available | 1772 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 100.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010200 | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0116229_1000019549 | 3300009500 | Host-Associated | MKRPLIRGKDFEASIRQRKQVQGKVMEAYQGREEYLMLGERERRRMNV* |
| Ga0116229_100003032 | 3300009500 | Host-Associated | MRRPLIRGKDFEASIGQGEQTQGKVMEAYQERKEYFVLGKGKGK* |
| Ga0116229_1000031166 | 3300009500 | Host-Associated | MKRPLIGGEDFETSIGQGEQAQGKDMEAYQGRKKSLRLGKEKRKRRNV* |
| Ga0116229_1000037117 | 3300009500 | Host-Associated | MKRPLIGRENFEASIGQGEQAQGKDMEVYQGRGEFFGLGEGKRKKRNV* |
| Ga0116229_1000052150 | 3300009500 | Host-Associated | MRRPLIGGKDFEASIGQGEQTQGKVMEVYQGKEKYFVLGEGERKKRNV* |
| Ga0116229_1000079352 | 3300009500 | Host-Associated | MRRPLIGGKDFEVSIRQGEQVQGKVMEVYQGRKEYFVLREGERRRMNV* |
| Ga0116229_100010013 | 3300009500 | Host-Associated | MKRPLIGGKDFKASIRQGEHVQRKVMEAYLGREEYLVLGEGERKRMNV* |
| Ga0116229_1000114332 | 3300009500 | Host-Associated | MRRPLIRGEDFETSIGQGEQTQGKDMEIYQGRGESLGLGEGKRKKMNV* |
| Ga0116229_1000146439 | 3300009500 | Host-Associated | MRRPLIGRKDFETSIGQGEQAQGKDMEAYQGRGEYLVLGEGERKRMNV* |
| Ga0116229_1000169424 | 3300009500 | Host-Associated | MRRPLIRGKNFETSIGQGEQAQGKVMEVYRGRKEYLVLGKGKGGE* |
| Ga0116229_1000218516 | 3300009500 | Host-Associated | MRGPLIRGKDFEASIGQGEQVQGKVMEAYKGRKEYLVLEKGKGKE* |
| Ga0116229_100022031 | 3300009500 | Host-Associated | MRRPLIKGKDFEASIGQGEQIRGKVMEAYQGREKYLVLGKGKGGE* |
| Ga0116229_1000239031 | 3300009500 | Host-Associated | MKRALIGRENFETSIGQGEQAHGKVMEAYQRKKEYLVLGEGERRRMNV* |
| Ga0116229_1000374924 | 3300009500 | Host-Associated | MKRPLIRREDFEASIGQGEQAQGKDMEAYQRRGESFGLRKGKRKKRNVAGSKGG* |
| Ga0116229_1000417612 | 3300009500 | Host-Associated | MRRPLIRGKDFEASIGQKEQAQGKVMEAYQGREEYLVLGEGERRKMNV* |
| Ga0116229_100054884 | 3300009500 | Host-Associated | MRRPLIKGEDFEASIGQGEQVQGKVMEAYQGKEEYLVLGEGKRKRRKM* |
| Ga0116229_100056392 | 3300009500 | Host-Associated | LIGGEDFETSIGQGEQAQGKVMEAYHGREEYLVLGEGERRRMNV* |
| Ga0116229_1000581016 | 3300009500 | Host-Associated | MRIERKDFEASIGQREQVQGKVMEVYQRREEYLVLGEGERKIMNV* |
| Ga0116229_100062682 | 3300009500 | Host-Associated | MGRPLIRGKDFEASIKQREQAQGKVMEVYQGREEYFVLGKGKRGE* |
| Ga0116229_100083925 | 3300009500 | Host-Associated | MRRPLIRGEDFEASIGQGEQAQGKYMEAYQGKEDSLGLGKGKRRRMNV* |
| Ga0116229_100093091 | 3300009500 | Host-Associated | MRRPLIGREDFKTFIGQGEQVQGKVMEAYQDKEEYLMLGEGERKRMNV* |
| Ga0116229_100100172 | 3300009500 | Host-Associated | MRRPFFGGEDFETSIGQGEQAQRKDMEAYQGIKKFLRLGEGKRKKRNV* |
| Ga0116229_100114995 | 3300009500 | Host-Associated | MRRLLIGREDFEASIGQGEQAQGKVIKAYQGREKYLVLREGERKRMNV* |
| Ga0116229_100160398 | 3300009500 | Host-Associated | MKRPLIGGEDFKASIGQGEQAQGKDMEVYQGRRDFLGLGEGKGKRRNV* |
| Ga0116229_100181068 | 3300009500 | Host-Associated | MRGPLIGGEDFETSIGQGEQAQGKVMEVYQGRKEYLVLGKGKGGE* |
| Ga0116229_100182225 | 3300009500 | Host-Associated | MKRPLIGRKDFEASIGQGEQVQGKVMEAYQGREEYFVLGEGERRRMNV* |
| Ga0116229_100182634 | 3300009500 | Host-Associated | MRRPLIRGEDFEASIGQREQVQGKVMEAYQGREEYLVLGKGKGGE* |
| Ga0116229_1002050612 | 3300009500 | Host-Associated | MKRPLIGGEDFETSIGQGEQTQGKDMEAYQKRGEFLGLGERKRKKKNL* |
| Ga0116229_100282888 | 3300009500 | Host-Associated | MRRQFIGEEDFEASIRQGEQAQGKVMEVYQEREEYLMLGERGRRRMNV* |
| Ga0116229_100330994 | 3300009500 | Host-Associated | MRRPLIGGKDFEASIGQREQIQGKVMEAYQGREEYFVLGEGERKKMNV* |
| Ga0116229_100486651 | 3300009500 | Host-Associated | MRRPLIRGEDFNASIGQGEQAQGKVMEAYQGREEYLVLGERERKRMNV* |
| Ga0116229_100496423 | 3300009500 | Host-Associated | LIGGKDFEAFIGQGKQAQGKVMEVYQGRKESLVLGEGKRKRRNVRKILVFMC* |
| Ga0116229_100507591 | 3300009500 | Host-Associated | MRRPLIRGKDFEASIGQGEQAQKKVMEAYQGGEEYFMLGKGKERK* |
| Ga0116229_100532082 | 3300009500 | Host-Associated | MRRPLIEREDFEASIRQGEQTQGKIMDAYHGREEYLVLGEAERRRMNV* |
| Ga0116229_100609753 | 3300009500 | Host-Associated | MRRPLIGREDFEASIGQGEQAEGKVMEAYQGREEYLVLGEGERKRMNV* |
| Ga0116229_100842475 | 3300009500 | Host-Associated | MRRPLIRGEDFEASIGQGEQAQGNVMETYQGKEEYLVLGEGERRRMNV* |
| Ga0116229_100896051 | 3300009500 | Host-Associated | MRGPLIKGKDLETSIGQGKQTQGKVMEAYQGREEYLVWKKEERRRMNV* |
| Ga0116229_101023933 | 3300009500 | Host-Associated | MRRPLIGREDFEASIGQGEQAQGKVMEAYQGREEYLVLGERERRRMNVQGKD* |
| Ga0116229_101041112 | 3300009500 | Host-Associated | MRRPLIGGEDFETSIRQGEQTQEKVMDAYQGREEYLVLGEGERKRMNV* |
| Ga0116229_101744522 | 3300009500 | Host-Associated | MRRPLIGGEDFETSIRQGEQAQGKVMEAYQGRDEYLVLGEGERKKMNA* |
| Ga0116229_103147192 | 3300009500 | Host-Associated | MRRPLIGGKDFEASIGQGEQAQRKVMEAYQGREEYLMRGKGK* |
| Ga0116229_103255731 | 3300009500 | Host-Associated | MSRPLVGGKDFEASIEQKEQAQGKVMEVYQGRKEYFIFWKGERMIMNV* |
| Ga0116229_103665391 | 3300009500 | Host-Associated | MRRPLIGRKDFETSIRQREQVQGKVMEAYQGREEYLGLGEGEMKRMNV* |
| Ga0116229_103829901 | 3300009500 | Host-Associated | MRRPLIRREDFEASIGQGEQVQGKVMEAYQGREEYLVLREGERKKRNV* |
| Ga0116229_106063532 | 3300009500 | Host-Associated | MRRPLIEGKDFETSFGKGEQVQGKVMEAYQGRKEYFGLEERERRIRNV* |
| Ga0116229_109307421 | 3300009500 | Host-Associated | MKRPLIGGEDFEASIGQGEQAQGKVMEAYQGREEYLVLGERERRRKNV* |
| Ga0116229_110649991 | 3300009500 | Host-Associated | MRRPLVRKEDFEASIGQGEQVQGKVMEVYQGREEYLVLGEGERKRRNV* |
| Ga0116230_1000009719 | 3300009510 | Host-Associated | MRRPLIRREDFEASIGQGEQAQGKVMEAYQGRGKSLRLGKGKKKRRNVWEKENKN* |
| Ga0116230_1000121125 | 3300009510 | Host-Associated | MRRPLIGGEDFEASIGQREQAQGKVMEAYQGRGKSFGLGKGKRKRRNV* |
| Ga0116230_100048695 | 3300009510 | Host-Associated | MKRPLIEGEDFETSIGQRKQAQGTVMEAYQGRGKFLKLGKEKKKD* |
| Ga0116230_1000733911 | 3300009510 | Host-Associated | MRRPLIGGEDFEASIGQGEQAQGKVMEVYEGRGKSLRWGKGKRKRRNV* |
| Ga0116230_101298011 | 3300009510 | Host-Associated | MRRPLIRGEDLEASIGQGEQAQGKVMETYQGKGKSLELGKGKRKRRNV* |
| Ga0116230_102557632 | 3300009510 | Host-Associated | MKRPLIGGKDFEASIGQGEQTPGKVMEVYQRREKYLVLGEGEGKE* |
| Ga0116230_102572702 | 3300009510 | Host-Associated | MRRPLIGGKDFKASIGQGEQIQGKVMEAYQRKEKYLVLGEGEGRE* |
| Ga0116230_102634982 | 3300009510 | Host-Associated | MRRPLIGGEDFEASIGQGEQVQGKVMETYQGKGKSLELGKGKRKRRNV* |
| Ga0116230_103225651 | 3300009510 | Host-Associated | MRRPLIRGEDFEASIRQGEQAQGKVMEVYQGRGKYLGLGKGKRKRRNVWEKKKD* |
| Ga0116231_1000002178 | 3300009697 | Host-Associated | MRRPLIKGKDFEASIGQKEQAQGKVMEAYQGREEYLVLGEGERRKMNV* |
| Ga0116231_1000028030 | 3300009697 | Host-Associated | MKRPLIGGKDFEASIGQGEQVQGKVMEAYQRINEYLVLGEGERKRMNV* |
| Ga0116231_1000162252 | 3300009697 | Host-Associated | MKRPLIRGKDFEASIGQRKQVQGKVMEAYQGREEYLMLGERERRRMNV* |
| Ga0116231_1000222813 | 3300009697 | Host-Associated | MRRPLIRREDFEASIGQGEQVQGKVMEAHQGREEYLVLREGERKKRNV* |
| Ga0116231_1000222846 | 3300009697 | Host-Associated | MRRPSIEGKDFETSFGKGEQVQGKVMEAYQGRNEYFGLEERERRRRNV* |
| Ga0116231_1000297813 | 3300009697 | Host-Associated | MKRPLIRGEDFETSIGQGEQAQGKDMEAYQGRKKSLRLGKEKRKRRNV* |
| Ga0116231_1000408023 | 3300009697 | Host-Associated | MKRPLIGGKDFEASIGQGEQVQGKVMEAYQGREEYFVLGEGERRRMNV* |
| Ga0116231_1000455920 | 3300009697 | Host-Associated | MRRPLIGEKDFEASIRQGEQAQGKVMEVYQGREEYLVLGEGEKREMNV* |
| Ga0116231_1000874022 | 3300009697 | Host-Associated | MRRPLIGGEDFETSIGQGEQAQGKVMEAYQGRDEYLVLGEGERKKMNA* |
| Ga0116231_100108472 | 3300009697 | Host-Associated | MKRPLIGGEDFKASIGQGEQAQGKDMEVYQGKGDSLGLGEGKGKRRNV* |
| Ga0116231_1001123421 | 3300009697 | Host-Associated | MKRPLIGRKDFETSIRQREQVQGKVMEAYQGREEYLGLGEGEMKRMNV* |
| Ga0116231_100122784 | 3300009697 | Host-Associated | MKRALIGRENFETSIGQGEQAHGKVMEAYQRKKEYLMLGEGERRKMNV* |
| Ga0116231_100140086 | 3300009697 | Host-Associated | MRGPLIGGKDFEASIGRGEQAQGKVMEVYQRRKEYLVWKKEERRKMNV* |
| Ga0116231_100162411 | 3300009697 | Host-Associated | MRGPLIEGKDLEASIGQGKQTQGKVMEAYRGREEYLVWKKEERRRMNV* |
| Ga0116231_100323982 | 3300009697 | Host-Associated | MKRPLIGGEDFETSIGQREQTQGKDMEAYQKRGEFLGLGERKRKRRNV* |
| Ga0116231_100417043 | 3300009697 | Host-Associated | LKDEEPLIRKEDFEASIGQGEQVQGKVMEVYQGREEYLVLGEGERKRRNV* |
| Ga0116231_100428833 | 3300009697 | Host-Associated | MRRPLIGGEDFEASIGQREQAQGKDMEVYQGRGEYLVLKEGENKRMNM* |
| Ga0116231_100919382 | 3300009697 | Host-Associated | LIGGKDFEAFIGQGKQAQGKVMEVYQGRKESLVLGEGKRKRRNVRKKLVFMC* |
| Ga0116231_101077713 | 3300009697 | Host-Associated | MWRPLIEREDFEASIRQGEQTQGKIMDAYHGREEYLVLGEAERRRMNV* |
| Ga0116231_101107081 | 3300009697 | Host-Associated | MRGPLIGRKDFEISIGQMKQVQRKVMEACQRREEYLVWEEEERRRMNV* |
| Ga0116231_102761362 | 3300009697 | Host-Associated | MKRPLIRREDFEASIGQGEQVQGKDMEAYQRRGESFGLRKGKRKKRNVAGSKGG* |
| Ga0116228_100042843 | 3300009701 | Host-Associated | MKRPLIGGEDFEASIGQGVQAQGKVMEAYQGRGKSFRVGERKKEKKECVKKN* |
| Ga0116228_100442642 | 3300009701 | Host-Associated | MRRPLIRGEDFEASIGQGEQAQGKVMEAYQKKKKFLGLGKGKKKRRNV* |
| Ga0116228_108406422 | 3300009701 | Host-Associated | MRRPLIGGKDFEASIGQGEQAQRKVMEAYQGRGKSLGLRKGKRKRRNV* |
| Ga0116227_100007009 | 3300009709 | Host-Associated | MRRPLIGGEDFEASIKQGEQAQEKVMEAYQGREEYLVLGEGERKRMNV* |
| Ga0116227_1000159814 | 3300009709 | Host-Associated | MRRPLIGWEDFEASIEQREQAQGKVMEIYQGREKYLVLGEGERKRRNV* |
| Ga0116227_1000301350 | 3300009709 | Host-Associated | MMRRPSIEGKDFETSFGKGEQVQGKVMEAYQGRKEYFGLEKRERRRRNV* |
| Ga0116227_1000329632 | 3300009709 | Host-Associated | MRRPLIGGEDFKASIGQREQAQGKDMEVYQGRGEYLVLKEGENKRMNM* |
| Ga0116227_1000614611 | 3300009709 | Host-Associated | MKGPLIGGEDFETSIGQREQTQGKVMEVYQGRNEYLVLGKGKGGE* |
| Ga0116227_100175092 | 3300009709 | Host-Associated | MKRALIGRENFETSIGQGEQAHGKVMEAYQRKKEYLVLGEGERRKMNV* |
| Ga0116227_100445181 | 3300009709 | Host-Associated | MKRPLIRGEDFNASIGQGEQAQGKVMEAYQGREEYLVLGEMERKRMNV* |
| Ga0116227_100913181 | 3300009709 | Host-Associated | MRGPLIGGKDFEASIGQGEQAQGKVMEAYQGREECLLWEKEKRRKMNV* |
| Ga0116227_102427361 | 3300009709 | Host-Associated | MRGPLIGGKDFEASIGQGEQAQRKVMEVYQGREECLVWEKEKRRRMNV* |
| Ga0116227_102768822 | 3300009709 | Host-Associated | MRGPLIEGKDLEASIGQGKQTQGKVMEAYQGREEYLVWKKEERRRMNV* |
| Ga0116226_1000142716 | 3300009787 | Host-Associated | MRRPLIGGEDFEASIEQGEQAQGKVMEAYQGRGKSLGWGKGKRKRMNV* |
| Ga0116226_100028553 | 3300009787 | Host-Associated | MRRPLIGGEDFEASIGQGEQAQGKVMEAYQGRGKSLGLGKGKRKIRNV* |
| Ga0116226_100111196 | 3300009787 | Host-Associated | MRRPLIGGEDFEASIGQGEQAQGKVMEAYQGRGKSLGLGKGKRKRRNV* |
| Ga0116226_100145542 | 3300009787 | Host-Associated | MRKPLIGGEDFETSIGQGDQAQGKVMEAYQGRGKSLRLGKGKRKRRNV* |
| Ga0116226_100240942 | 3300009787 | Host-Associated | MRRPLIRGEDFKASIGQGEQIQGKVMEAYQGRGKFLGLGKKEK* |
| Ga0116226_100516023 | 3300009787 | Host-Associated | MRRPLIGGEDFEASIGQGEQAEGKVMEAYQGRGKSLGLGKGKRKKKNV* |
| Ga0116226_100700142 | 3300009787 | Host-Associated | MKRPLIRGEDFEASVGQGEQAQGMVMESYQGGGKALGGEKKRD* |
| Ga0116226_100869341 | 3300009787 | Host-Associated | MKRPLIGGEDFEVSIGQGVQAQGKVMRLSKGEGNLLGLGKGKRKRMNV* |
| Ga0116226_106582611 | 3300009787 | Host-Associated | PLIGGEDFETSIGQGEQAQGKVMEAYQGKRKFLRLGKGKRKRRSV* |
| Ga0116226_110629062 | 3300009787 | Host-Associated | MRRPLIGGKDFEASIRQGEQTQGKVMEAYQRKEKYLVLGEGEGRE* |
| Ga0127507_12315901 | 3300010200 | Host-Associated | MRRPLIGREDFEASIGQGEQVQGKVMEVYQGREEYLVLGEGE |
| Ga0209208_1000092520 | 3300027807 | Host-Associated | MRRPLIRREDFEASIGQGEQAQGKVMEAYQGRGKSLRLGKGKKKRRNVWEKENKN |
| Ga0209208_100129125 | 3300027807 | Host-Associated | MKRPLIGGEDFEASIGQGEQAQGKVMEAYQGRRKSLGLGKGKRKRRNV |
| Ga0209208_100295754 | 3300027807 | Host-Associated | MRRPLIGGEDFEASIGQGEQAQGKVMEVYEGRGKSLRWGKGKRKRRNV |
| Ga0209208_100809012 | 3300027807 | Host-Associated | MRRPLIRGEDLEASIGQGEQAQGKVMETYQGKGKSLELGKGKRKRRNV |
| Ga0209208_101235601 | 3300027807 | Host-Associated | MKRPLIGGKDFEASIGQGEQTPGKVMEVYQRREKYLVLGEGEGKE |
| Ga0209208_102794112 | 3300027807 | Host-Associated | MRRPLIRGEDFEASIRQGEQAQGKVMEVYQRRGKYLGLGKGKRKRRNVWEKKKD |
| Ga0209611_1000017226 | 3300027860 | Host-Associated | MKRPLIRGKDFEASIRQRKQVQGKVMEAYQGREEYLMLGERERRRMNV |
| Ga0209611_1000021271 | 3300027860 | Host-Associated | MVIGSXRMRRPLIKGKDFEASIGQKEQAQGKVMEAYQGREEYLVLGEGERRKMNVXGKD |
| Ga0209611_1000023636 | 3300027860 | Host-Associated | MRRPLIRGEDFETSIGQGEQTQGKDMEIYQGRGESLGLGEGKRKKMNV |
| Ga0209611_1000043722 | 3300027860 | Host-Associated | MKRPLIGRENFEASIGQGEQAQGKDMEVYQGRGEFFGLGEGKRKKRNV |
| Ga0209611_100005206 | 3300027860 | Host-Associated | MRRPLIRGKDFEASIGQGEQTQGKVMEVYQEXKEYFVLGKGKGK |
| Ga0209611_1000066524 | 3300027860 | Host-Associated | MRRPLIKGEDFEASIGQGEQVQGKVMEAYQGKEEYLVLGEGKRKRRNV |
| Ga0209611_1000082422 | 3300027860 | Host-Associated | MRRPLIGGEDFKTSIGQREQTQGKDMEAYQGREEYLGLGEGERRRMNV |
| Ga0209611_1000086339 | 3300027860 | Host-Associated | MKRPLIGGEDFETSIGQGEQTQGKDMEAYQKRGEFLGLGERKRKKKNL |
| Ga0209611_1000176643 | 3300027860 | Host-Associated | MKRPLIGGKDFKASIRQGEHVQRKVMEAYLGREEYLVLGEGERKRMNV |
| Ga0209611_1000178515 | 3300027860 | Host-Associated | MRRPFFGGEDFETSIGQGEQAQRKDMEAYQGIKKFLRLGEGKRKKRNV |
| Ga0209611_100020179 | 3300027860 | Host-Associated | MRRPLIKGKDFEASIGQGEQIRGKVMEAYQGREKYLVLGKGKGGE |
| Ga0209611_100023452 | 3300027860 | Host-Associated | MRRPLIRGEDFEASIGQGEQAQGNVMETYQGKEEYLVLGEGERRRMNV |
| Ga0209611_1000296422 | 3300027860 | Host-Associated | MKRPLIGGKDFEASIGQGEQVQGKVMEAYQGREEYFVLGEGERRRMNV |
| Ga0209611_1000382326 | 3300027860 | Host-Associated | MRRPLIRGKDFEASIGQGEQAQKKVMEAYQGGEEYFMLGKGKERK |
| Ga0209611_1000408524 | 3300027860 | Host-Associated | MKRPLIRREDFEASIGQGEQAQGKDMEAYQRRGESFGLRKGKRKKRNVAGSKGG |
| Ga0209611_100041948 | 3300027860 | Host-Associated | MRRPLIGRKDFETSIGQGEQAQGKDMEAYQGRGEYLVLGEGERKRMNV |
| Ga0209611_1000428120 | 3300027860 | Host-Associated | MGRPLIRGKDFEASIKQREQAQGKVMEVYQGREEYFVLGKGKRGE |
| Ga0209611_100049702 | 3300027860 | Host-Associated | LIGGEDFETSIGQGEQAQGKVMEAYHGREEYLVLGEGERRRMNV |
| Ga0209611_1000622915 | 3300027860 | Host-Associated | MKRPLIGGKDFEASIGQGEQVQGKVMEAYQRINEYLVLGEGERKRMNV |
| Ga0209611_100064489 | 3300027860 | Host-Associated | MRRPLIGGKDFEVSIRQGEQVQGKVMEVYQGRKEYFVLREGERRRMNV |
| Ga0209611_1000841913 | 3300027860 | Host-Associated | MRRPLIRGEDFEASIGQGEQAQGKYMEAYQGKEDSLGLGKGKRRRMNV |
| Ga0209611_100093245 | 3300027860 | Host-Associated | MRRLLIGREDFEASIGQGEQAQGKVIKAYQGREKYLVLREGERKRMNV |
| Ga0209611_1000967213 | 3300027860 | Host-Associated | MRRPLIGGKDFEASIGQGEQTQGKVMEVYQGKEKYFVLGEGERKKRNV |
| Ga0209611_100096878 | 3300027860 | Host-Associated | MRGPLIGGEDFETSIGQGEQAQGKVMEVYQGRKEYLVLGKGKGGE |
| Ga0209611_1000979911 | 3300027860 | Host-Associated | MRRPLIGREDFEASIGQGEQAEGKVMEAYQGREEYLVLGEGERKRMNVXEKY |
| Ga0209611_100101629 | 3300027860 | Host-Associated | MRRPLIGREDFEASIGQGEQAQGKVMEAYQRREEYLVLGERERRRMNVQGKD |
| Ga0209611_1001187210 | 3300027860 | Host-Associated | MRIERKDFEASIGQREQVQGKVMEVYQRREEYLVLGEGERKIMNV |
| Ga0209611_100154861 | 3300027860 | Host-Associated | MRGPLIEGKDLEASIGQGKQTQGKVMEAYQGREEYLVWKKEERRRMNV |
| Ga0209611_1001572111 | 3300027860 | Host-Associated | MKRPLIGREDFEASIGQGEQAQGKVMEAYQGREEYLVLGKGERRRMNV |
| Ga0209611_1001644911 | 3300027860 | Host-Associated | MRRPLIGGEDFETSIRQGEQAQGKVMEAYQGRDEYLVLGEGERKKMNA |
| Ga0209611_100174286 | 3300027860 | Host-Associated | MRRPLIGGKDFEASIGQREQIQGKVMEAYQGREEYFVLGEGERKKMNV |
| Ga0209611_100188823 | 3300027860 | Host-Associated | MRRPLIRGEDFEASIGQREQVQGKVMEAYQGREEYLVLGKGKGGE |
| Ga0209611_100201652 | 3300027860 | Host-Associated | MRRPLIGGEDFETSIRQGEQTQEKVMDAYQGREEYLVLGEGERKRMNV |
| Ga0209611_100204244 | 3300027860 | Host-Associated | MRRPLIRREDFEASIGQGEQVQGKVMEAYQGREEYLVLREGERKKRNV |
| Ga0209611_100249882 | 3300027860 | Host-Associated | MKRPLIGGEDFKASIGQGEQVQGKDMEVYQGRGDSLGLGEGKGKRRNV |
| Ga0209611_100317054 | 3300027860 | Host-Associated | MRRQFIGEEDFEASIRQGEQAQGKVMEVYQEREEYLMLGERGRRRMNV |
| Ga0209611_100329364 | 3300027860 | Host-Associated | MRRPLIRKEDFEASIGQGEQVQGKVMEVYQGREEYLVLGEGERKRRNV |
| Ga0209611_100402793 | 3300027860 | Host-Associated | LIRREDFEASIGQREQAQGKDMEVYQGRGEYLVSKEGENKRMNM |
| Ga0209611_100419013 | 3300027860 | Host-Associated | MRRPLIRGEDFNASIGQGEQAQGKVMEAYQGREEYLVLGERERKRMNV |
| Ga0209611_100457233 | 3300027860 | Host-Associated | MRGPLIGGKDFEASIGRGEQAQGKVMEVYQRRKEYLVWKKEERRKMNV |
| Ga0209611_100465262 | 3300027860 | Host-Associated | MKRPLIGREDFEASIGQGEQAQGKVMEAYQGREEYLVLGEGERRKMNV |
| Ga0209611_100502621 | 3300027860 | Host-Associated | MRRPSIEGKDFETSFGKGEQVQGKVMEAYQGRKEYFGLEERERRRRNV |
| Ga0209611_100536012 | 3300027860 | Host-Associated | MKRPLIGGEDFEASIGQGEQAQGKVMEAYQGREEYLVLGERERRRKNV |
| Ga0209611_100655481 | 3300027860 | Host-Associated | LIGGKDFEAFIGQGKQAQGKVMEVYQGRKESLVLGEGKRKRRNVRKILVFMC |
| Ga0209611_100905861 | 3300027860 | Host-Associated | MKRPLIGGEDFETSIGQGEQAQGKDMEAYQGRKKSLRLGKEKRKRRNV |
| Ga0209611_101150743 | 3300027860 | Host-Associated | MRRPLIEREDFEASIRQGEQTQGKIMDAYHGREEYLVLGEAERRRMNV |
| ⦗Top⦘ |