


| Basic Information | |
|---|---|
| Family ID | F044519 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.48 % |
| % of genes near scaffold ends (potentially truncated) | 16.23 % |
| % of genes from short scaffolds (< 2000 bps) | 64.29 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.091 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (12.987 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.792 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.065 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 15.58 |
| PF12684 | DUF3799 | 5.19 |
| PF00182 | Glyco_hydro_19 | 5.19 |
| PF03118 | RNA_pol_A_CTD | 2.60 |
| PF13481 | AAA_25 | 1.30 |
| PF05127 | Helicase_RecD | 1.30 |
| PF11351 | GTA_holin_3TM | 1.30 |
| PF14090 | HTH_39 | 0.65 |
| PF00436 | SSB | 0.65 |
| PF13362 | Toprim_3 | 0.65 |
| PF13550 | Phage-tail_3 | 0.65 |
| PF04586 | Peptidase_S78 | 0.65 |
| PF08273 | Prim_Zn_Ribbon | 0.65 |
| PF04860 | Phage_portal | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 15.58 |
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 5.19 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 5.19 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 2.60 |
| COG1444 | tRNA(Met) C34 N-acetyltransferase TmcA | Translation, ribosomal structure and biogenesis [J] | 1.30 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.65 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.65 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.65 |
| COG4643 | Uncharacterized domain associated with phage/plasmid primase | Mobilome: prophages, transposons [X] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.09 % |
| All Organisms | root | All Organisms | 40.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10027983 | Not Available | 3143 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10075122 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10080349 | Not Available | 1448 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10084215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium | 1392 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10103261 | Not Available | 1177 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10107207 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10110878 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10119724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 1039 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10121308 | Not Available | 1027 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10193231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10257735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10261575 | Not Available | 538 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10010750 | Not Available | 4758 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10030902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 2505 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10157949 | Not Available | 769 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10161964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10169717 | Not Available | 727 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10185038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300000929|NpDRAFT_10075892 | Not Available | 552 | Open in IMG/M |
| 3300003271|JGI26114J46594_1003507 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300004448|Ga0065861_1009906 | Not Available | 3428 | Open in IMG/M |
| 3300004448|Ga0065861_1013933 | Not Available | 2762 | Open in IMG/M |
| 3300004460|Ga0066222_1055974 | Not Available | 798 | Open in IMG/M |
| 3300005086|Ga0072334_10144734 | Not Available | 506 | Open in IMG/M |
| 3300006382|Ga0075494_1186966 | Not Available | 669 | Open in IMG/M |
| 3300006399|Ga0075495_1466901 | Not Available | 579 | Open in IMG/M |
| 3300006419|Ga0075496_1459326 | Not Available | 572 | Open in IMG/M |
| 3300006484|Ga0070744_10000108 | All Organisms → cellular organisms → Bacteria | 20318 | Open in IMG/M |
| 3300006484|Ga0070744_10002448 | Not Available | 5598 | Open in IMG/M |
| 3300006484|Ga0070744_10012992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2470 | Open in IMG/M |
| 3300006621|Ga0101441_129582 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300006752|Ga0098048_1033233 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300006752|Ga0098048_1234885 | Not Available | 537 | Open in IMG/M |
| 3300006922|Ga0098045_1000304 | Not Available | 20475 | Open in IMG/M |
| 3300006922|Ga0098045_1083344 | Not Available | 763 | Open in IMG/M |
| 3300006924|Ga0098051_1173753 | Not Available | 566 | Open in IMG/M |
| 3300006990|Ga0098046_1077802 | Not Available | 749 | Open in IMG/M |
| 3300006990|Ga0098046_1145644 | Not Available | 507 | Open in IMG/M |
| 3300007229|Ga0075468_10014358 | Not Available | 3024 | Open in IMG/M |
| 3300007231|Ga0075469_10199612 | Not Available | 535 | Open in IMG/M |
| 3300007276|Ga0070747_1025914 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
| 3300007543|Ga0102853_1000177 | All Organisms → cellular organisms → Bacteria | 11724 | Open in IMG/M |
| 3300007555|Ga0102817_1001801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5469 | Open in IMG/M |
| 3300007636|Ga0102856_1004372 | Not Available | 1836 | Open in IMG/M |
| 3300007640|Ga0070751_1175031 | Not Available | 845 | Open in IMG/M |
| 3300007647|Ga0102855_1118538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300007862|Ga0105737_1175309 | Not Available | 562 | Open in IMG/M |
| 3300007954|Ga0105739_1145188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 561 | Open in IMG/M |
| 3300008012|Ga0075480_10446350 | Not Available | 630 | Open in IMG/M |
| 3300009024|Ga0102811_1121266 | Not Available | 978 | Open in IMG/M |
| 3300009079|Ga0102814_10745519 | Not Available | 539 | Open in IMG/M |
| 3300009436|Ga0115008_10001116 | All Organisms → cellular organisms → Bacteria | 21400 | Open in IMG/M |
| 3300009436|Ga0115008_10018473 | Not Available | 5668 | Open in IMG/M |
| 3300009436|Ga0115008_10593621 | Not Available | 797 | Open in IMG/M |
| 3300009436|Ga0115008_10887772 | Not Available | 658 | Open in IMG/M |
| 3300009436|Ga0115008_11556626 | Not Available | 512 | Open in IMG/M |
| 3300009467|Ga0115565_10542659 | Not Available | 521 | Open in IMG/M |
| 3300009495|Ga0115571_1009064 | Not Available | 5611 | Open in IMG/M |
| 3300009495|Ga0115571_1009452 | Not Available | 5465 | Open in IMG/M |
| 3300009495|Ga0115571_1109023 | Not Available | 1193 | Open in IMG/M |
| 3300009496|Ga0115570_10006781 | Not Available | 7779 | Open in IMG/M |
| 3300009507|Ga0115572_10009825 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium | 7040 | Open in IMG/M |
| 3300009507|Ga0115572_10053166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 2561 | Open in IMG/M |
| 3300009507|Ga0115572_10179431 | Not Available | 1232 | Open in IMG/M |
| 3300009507|Ga0115572_10614003 | Not Available | 598 | Open in IMG/M |
| 3300010150|Ga0098056_1313894 | Not Available | 516 | Open in IMG/M |
| 3300010300|Ga0129351_1220580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 731 | Open in IMG/M |
| 3300011253|Ga0151671_1019485 | Not Available | 1788 | Open in IMG/M |
| 3300017709|Ga0181387_1045175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 873 | Open in IMG/M |
| 3300017719|Ga0181390_1003286 | All Organisms → cellular organisms → Bacteria | 6454 | Open in IMG/M |
| 3300017724|Ga0181388_1007300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 2923 | Open in IMG/M |
| 3300017727|Ga0181401_1042335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
| 3300017730|Ga0181417_1004231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3944 | Open in IMG/M |
| 3300017735|Ga0181431_1000132 | All Organisms → cellular organisms → Bacteria | 24327 | Open in IMG/M |
| 3300017756|Ga0181382_1022250 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1982 | Open in IMG/M |
| 3300017764|Ga0181385_1011035 | Not Available | 2905 | Open in IMG/M |
| 3300017770|Ga0187217_1074633 | Not Available | 1166 | Open in IMG/M |
| 3300017770|Ga0187217_1187369 | Not Available | 686 | Open in IMG/M |
| 3300017772|Ga0181430_1020424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2179 | Open in IMG/M |
| 3300017776|Ga0181394_1264315 | Not Available | 513 | Open in IMG/M |
| 3300017786|Ga0181424_10007393 | All Organisms → cellular organisms → Bacteria | 4750 | Open in IMG/M |
| 3300017786|Ga0181424_10050844 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300017786|Ga0181424_10242474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium | 756 | Open in IMG/M |
| 3300020165|Ga0206125_10015102 | Not Available | 4997 | Open in IMG/M |
| 3300020165|Ga0206125_10038644 | Not Available | 2468 | Open in IMG/M |
| 3300020182|Ga0206129_10348245 | Not Available | 576 | Open in IMG/M |
| 3300020187|Ga0206130_10056844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 2695 | Open in IMG/M |
| 3300021085|Ga0206677_10015159 | Not Available | 4951 | Open in IMG/M |
| 3300021185|Ga0206682_10015151 | Not Available | 5169 | Open in IMG/M |
| 3300021373|Ga0213865_10047131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 2393 | Open in IMG/M |
| 3300021375|Ga0213869_10002863 | Not Available | 11746 | Open in IMG/M |
| 3300021957|Ga0222717_10048999 | Not Available | 2744 | Open in IMG/M |
| 3300021957|Ga0222717_10135933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. NLS-7 | 1509 | Open in IMG/M |
| 3300022053|Ga0212030_1023958 | Not Available | 833 | Open in IMG/M |
| 3300022061|Ga0212023_1038473 | Not Available | 665 | Open in IMG/M |
| 3300022164|Ga0212022_1000039 | Not Available | 11579 | Open in IMG/M |
| 3300022178|Ga0196887_1020013 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300022178|Ga0196887_1030978 | Not Available | 1493 | Open in IMG/M |
| 3300022178|Ga0196887_1098916 | Not Available | 655 | Open in IMG/M |
| 3300022221|Ga0224506_10264011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 781 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10042628 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300024180|Ga0228668_1007169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 2902 | Open in IMG/M |
| 3300024221|Ga0228666_1052710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300024223|Ga0228601_1018456 | Not Available | 856 | Open in IMG/M |
| 3300024226|Ga0228667_1107441 | Not Available | 520 | Open in IMG/M |
| 3300024231|Ga0233399_1068189 | Not Available | 882 | Open in IMG/M |
| 3300024236|Ga0228655_1021206 | Not Available | 1620 | Open in IMG/M |
| 3300024236|Ga0228655_1098984 | Not Available | 622 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10068355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2000 | Open in IMG/M |
| 3300024346|Ga0244775_10009150 | All Organisms → cellular organisms → Bacteria | 9544 | Open in IMG/M |
| 3300024346|Ga0244775_10053389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3511 | Open in IMG/M |
| 3300024346|Ga0244775_10140770 | Not Available | 2039 | Open in IMG/M |
| 3300024346|Ga0244775_10182651 | Not Available | 1764 | Open in IMG/M |
| 3300024348|Ga0244776_10008633 | Not Available | 8967 | Open in IMG/M |
| 3300025070|Ga0208667_1010268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2162 | Open in IMG/M |
| 3300025070|Ga0208667_1061539 | Not Available | 584 | Open in IMG/M |
| 3300025084|Ga0208298_1021671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
| 3300025085|Ga0208792_1007123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2706 | Open in IMG/M |
| 3300025626|Ga0209716_1025114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2306 | Open in IMG/M |
| 3300025832|Ga0209307_1088863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosovibrio → unclassified Nitrosovibrio → Nitrosovibrio sp. Nv4 | 1011 | Open in IMG/M |
| 3300025849|Ga0209603_1093890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium SB2 | 1362 | Open in IMG/M |
| 3300027367|Ga0208801_1040329 | Not Available | 725 | Open in IMG/M |
| 3300027406|Ga0208965_1000598 | Not Available | 16911 | Open in IMG/M |
| 3300027413|Ga0208950_1020479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1938 | Open in IMG/M |
| 3300027582|Ga0208971_1001267 | Not Available | 15362 | Open in IMG/M |
| 3300027631|Ga0208133_1004636 | All Organisms → cellular organisms → Bacteria | 4145 | Open in IMG/M |
| 3300027631|Ga0208133_1014134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2137 | Open in IMG/M |
| 3300027751|Ga0208304_10195961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300027833|Ga0209092_10002528 | All Organisms → cellular organisms → Bacteria | 16757 | Open in IMG/M |
| 3300027833|Ga0209092_10036233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3143 | Open in IMG/M |
| 3300027833|Ga0209092_10299920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium | 870 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10306299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300028125|Ga0256368_1020500 | Not Available | 1166 | Open in IMG/M |
| 3300028125|Ga0256368_1039866 | Not Available | 836 | Open in IMG/M |
| 3300028125|Ga0256368_1091090 | Not Available | 514 | Open in IMG/M |
| 3300028287|Ga0257126_1249024 | Not Available | 529 | Open in IMG/M |
| 3300028414|Ga0228627_1129554 | Not Available | 556 | Open in IMG/M |
| 3300031519|Ga0307488_10003644 | Not Available | 12840 | Open in IMG/M |
| 3300031519|Ga0307488_10130900 | Not Available | 1783 | Open in IMG/M |
| 3300031519|Ga0307488_10342057 | Not Available | 946 | Open in IMG/M |
| 3300031519|Ga0307488_10410488 | Not Available | 834 | Open in IMG/M |
| 3300031519|Ga0307488_10455828 | Not Available | 775 | Open in IMG/M |
| 3300031519|Ga0307488_10617415 | Not Available | 626 | Open in IMG/M |
| 3300031519|Ga0307488_10747111 | Not Available | 547 | Open in IMG/M |
| 3300031569|Ga0307489_10298343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1040 | Open in IMG/M |
| 3300031569|Ga0307489_10783555 | Not Available | 670 | Open in IMG/M |
| 3300031569|Ga0307489_11054785 | Not Available | 582 | Open in IMG/M |
| 3300031569|Ga0307489_11441358 | Not Available | 501 | Open in IMG/M |
| 3300031766|Ga0315322_10225173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium | 1306 | Open in IMG/M |
| 3300032088|Ga0315321_10169010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
| 3300032277|Ga0316202_10423116 | Not Available | 624 | Open in IMG/M |
| 3300033742|Ga0314858_042047 | Not Available | 1088 | Open in IMG/M |
| 3300033742|Ga0314858_103663 | Not Available | 722 | Open in IMG/M |
| 3300033742|Ga0314858_121947 | Not Available | 666 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.99% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 11.69% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.74% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.09% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.79% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 7.14% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.49% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.84% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 5.84% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 3.90% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.60% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.60% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.60% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.95% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.95% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.30% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.30% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.65% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.65% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.65% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.65% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.65% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.65% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.65% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300003271 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300006382 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006399 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006419 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006621 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time point | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300024180 | Seawater microbial communities from Monterey Bay, California, United States - 82D | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024223 | Seawater microbial communities from Monterey Bay, California, United States - 1D | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027367 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027406 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100279835 | 3300000101 | Marine | MNITMIIDGLAMALFALAAIHLPEIIVXLDTIINANLGE* |
| DelMOSum2010_100751224 | 3300000101 | Marine | MNASMIIDGLAMALFALAAVHLPEIIVYLDYLININLGE* |
| DelMOSum2010_100803493 | 3300000101 | Marine | MNITMIIDGLAIALFAVAAVHLPEIIVFLDQFINAK* |
| DelMOSum2010_100842153 | 3300000101 | Marine | MNASMIIDGLAMALFALAAVHLPXIIVYLDXLINIXLGE* |
| DelMOSum2010_101032612 | 3300000101 | Marine | MNITMIXDGFAMALFAVAAVHLPEIIVFLDQFINVWGK* |
| DelMOSum2010_101072075 | 3300000101 | Marine | MNISMIIDGLAMALFALAAIHLPEIIVYLDTIINANLGE* |
| DelMOSum2010_101108783 | 3300000101 | Marine | MNITMIKDGLAMALFALACIHLPEIIVFLDTIINANLGE* |
| DelMOSum2010_101197242 | 3300000101 | Marine | MNTTMIIDGLAIALFAVAAVHLPEIIVFLDQYINVWGR* |
| DelMOSum2010_101213081 | 3300000101 | Marine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVW |
| DelMOSum2010_101932311 | 3300000101 | Marine | MNITMIGDGLAMALFALAAVHLPEIIVYLDYLININLGE* |
| DelMOSum2010_102577351 | 3300000101 | Marine | MNTTMITDGLAMALFAVAAVHLPEIIVFLDQFVNVWGR* |
| DelMOSum2010_102615751 | 3300000101 | Marine | MNITMIIDGFAMALFAVAAVHLPEIIVFLDQFINIK* |
| DelMOSpr2010_100107505 | 3300000116 | Marine | MNASMIIDGLAMALFALAAXXLPEIIVYLDYLININLGE* |
| DelMOSpr2010_100309024 | 3300000116 | Marine | MNTSMIIDGLAMALFALAAVHLPEIIVYLDTIINANLGE* |
| DelMOSpr2010_101579492 | 3300000116 | Marine | MIKDGLAMALFAVAAVHLPEIIVFLDQFINVWGR* |
| DelMOSpr2010_101619641 | 3300000116 | Marine | IMNTTMIIDGFAMALFAVAAVHLPEIIVFLDQYINI* |
| DelMOSpr2010_101697171 | 3300000116 | Marine | MNTTMIIDGFAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| DelMOSpr2010_101850382 | 3300000116 | Marine | MNTTMIIDGFAMALFAVAAVHLPEIIVFLDQFVNVWGR* |
| NpDRAFT_100758921 | 3300000929 | Freshwater And Marine | MNASMIIDGLAMALFALAAVHLPEIIVYLDTIINANLGE* |
| JGI26114J46594_10035077 | 3300003271 | Marine | MNTSMIIDGLVMALFALAAVHLPEIIVYLDTIININLGE* |
| Ga0065861_10099068 | 3300004448 | Marine | HCKRIKKAGSGMNITMIIDGLAMALFALAAVHLPEIIVYLDYLININLGE* |
| Ga0065861_10139335 | 3300004448 | Marine | MNITMIIDGLAMALFALAAVHLPEIIVYLDTIININLGE* |
| Ga0066222_10559742 | 3300004460 | Marine | MNITMIIDGLAMALFALAAVHLPEIIVYLDYLININLGE* |
| Ga0072334_101447341 | 3300005086 | Water | MRKYIMNITMIIDGFAMALFAVAAVHLPEIIVFLDQFINVWGR* |
| Ga0075494_11869663 | 3300006382 | Aqueous | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQFINVWGR* |
| Ga0075495_14669011 | 3300006399 | Aqueous | KYIMNTTMIIDGFAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0075496_14593262 | 3300006419 | Aqueous | MNITMIKDGLAMALFAVSAVHLPEIIVFLDQFINVWGR* |
| Ga0070744_1000010810 | 3300006484 | Estuarine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQFINAK* |
| Ga0070744_100024484 | 3300006484 | Estuarine | MIIDGLAMALFALAAVHLPEIIVYLDHLININLGE* |
| Ga0070744_100129923 | 3300006484 | Estuarine | MDQMNASMIIDGLAMALFALAAVHLPEIIVFLDTIINAN* |
| Ga0101441_1295822 | 3300006621 | Marine Surface Water | MNITMIIDGLAIALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0098048_10332334 | 3300006752 | Marine | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQLINVWGR* |
| Ga0098048_12348852 | 3300006752 | Marine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0098045_10003048 | 3300006922 | Marine | MNITMIKDGLAMALFALACIHLPEIIVFLDTIINAN* |
| Ga0098045_10833443 | 3300006922 | Marine | YVGGSIMNITMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0098051_11737532 | 3300006924 | Marine | MNITMIKDGLAMATFAVAAVHLPEIIVFLDQFINV* |
| Ga0098046_10778023 | 3300006990 | Marine | IMNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0098046_11456441 | 3300006990 | Marine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQYINVW |
| Ga0075468_100143583 | 3300007229 | Aqueous | MNASMIIDGLAMALFALAAVHLPEIIVYLDHLININLGE* |
| Ga0075469_101996122 | 3300007231 | Aqueous | MNITMIGDGLAMALFALAAVHLPEIIVYLDHLININLGE* |
| Ga0070747_10259146 | 3300007276 | Aqueous | MNITMIKDGLAMALFALAATHLPEIIVFLDHLININLGE* |
| Ga0102853_10001777 | 3300007543 | Estuarine | MDQMNASMIIDGLVMALFALAAVHLPEIIVYLDTIINANLGE* |
| Ga0102817_10018018 | 3300007555 | Estuarine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGR* |
| Ga0102856_10043725 | 3300007636 | Estuarine | MNASMIIDGLVMALFALAAVHLPEIIVYLDTIININLGE* |
| Ga0070751_11750312 | 3300007640 | Aqueous | MRKYIMNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0102855_11185382 | 3300007647 | Estuarine | MDQMNASMIIDGLVMALFALAAVHLPEIIVYLDTIININLGE* |
| Ga0105737_11753092 | 3300007862 | Estuary Water | MNASMIIDGLVMALFALAAVHLPEIIVYLDTIINANLGE* |
| Ga0105739_11451881 | 3300007954 | Estuary Water | MNTSMIIDGLAMALFALAAVHLPEIIVYLDHLININLGE* |
| Ga0075480_104463501 | 3300008012 | Aqueous | NMRKYIMNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0102811_11212663 | 3300009024 | Estuarine | MNTTMIIDGLAMALFAVAAVHLPEIIAFLDQYINVWGR* |
| Ga0102814_107455191 | 3300009079 | Estuarine | MNTSMIIDGLDMALFALAAVHLPEIIVYLDTIINANLGE* |
| Ga0115008_1000111637 | 3300009436 | Marine | MQMNMTMIIDGIAMALFAIAVIHLPEIIVFLDQLITTN* |
| Ga0115008_100184733 | 3300009436 | Marine | MNTSMIIDGLAMALFALAAVHLPEIIVYLDYLININLGE* |
| Ga0115008_105936212 | 3300009436 | Marine | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQFINAK* |
| Ga0115008_108877724 | 3300009436 | Marine | MQNMRKYIMNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0115008_115566262 | 3300009436 | Marine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVN* |
| Ga0115565_105426591 | 3300009467 | Pelagic Marine | RQSYKRGANMNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0115571_10090646 | 3300009495 | Pelagic Marine | MIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0115571_10094529 | 3300009495 | Pelagic Marine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0115571_11090233 | 3300009495 | Pelagic Marine | MNTTMIIEGLAMALFALAAVHLPEIIVFLDQYINVWGR* |
| Ga0115570_100067812 | 3300009496 | Pelagic Marine | MIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGR* |
| Ga0115572_100098256 | 3300009507 | Pelagic Marine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGR* |
| Ga0115572_100531665 | 3300009507 | Pelagic Marine | MNITMIKDGLAMALFALACIHLPEIIVFLDHLININLGE* |
| Ga0115572_101794313 | 3300009507 | Pelagic Marine | MNITMIKDGLAMALFALAAIHLPEIIVFLDHLININLGE* |
| Ga0115572_106140033 | 3300009507 | Pelagic Marine | NTTMIIEGLAMALFALAAVHLPEIIVFLDQYINVN* |
| Ga0098056_13138942 | 3300010150 | Marine | NMRKYIMNITMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0129351_12205801 | 3300010300 | Freshwater To Marine Saline Gradient | IMNTTMIIDGFAMALFAVAAVHLPEIIVFLDQYINVWGR* |
| Ga0151671_10194855 | 3300011253 | Marine | MNVSMIIDGLAMALFALAAVHLPEIIVYLDTIININLGE* |
| Ga0181387_10451752 | 3300017709 | Seawater | MNTSMIIDGLAMALFALAAVHLPEIIVFLDTIINANLGE |
| Ga0181390_10032862 | 3300017719 | Seawater | MQMNMTMIIDGIAMALFAIAVIHLPEIIVFLDQLITTN |
| Ga0181388_10073004 | 3300017724 | Seawater | MNTSMIIDGLVMALFALAAVHLPEIIVYLDTIINANLGE |
| Ga0181401_10423353 | 3300017727 | Seawater | MNITMIKDGLAMAIFAVAAVHLPEIIVFLDQFIRDFTIMK |
| Ga0181417_10042315 | 3300017730 | Seawater | MNITMIKDGLAMAGFALACIHLPEIIVFLDTIINAN |
| Ga0181431_100013227 | 3300017735 | Seawater | MQMNMTMIIDGIAMALFAIAVIHLPEIIVFLDQLITNN |
| Ga0181382_10222502 | 3300017756 | Seawater | MNITMIKDGLAMAIFAVAAVHLPEIIVFLDQFINVWGR |
| Ga0181385_10110351 | 3300017764 | Seawater | RRKESKIMNTSMIIDGLAMALFALAAVHLPEIIVFLDTIINANLGE |
| Ga0187217_10746335 | 3300017770 | Seawater | VVMNITMIKDGLAIALFAVAAVHLPEIIVFLDQFINAK |
| Ga0187217_11873691 | 3300017770 | Seawater | NITMIKDGLAMALFAVAAVHLPEIIVFLDQLINVWGR |
| Ga0181430_10204243 | 3300017772 | Seawater | MIKDGVAMALFALAAIHLPEIIVFLDQFININLGE |
| Ga0181394_12643152 | 3300017776 | Seawater | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGK |
| Ga0181424_100073936 | 3300017786 | Seawater | MNTTMIIDGFAMALFAVAAVHLPEIIVFLDQFINVWGK |
| Ga0181424_100508441 | 3300017786 | Seawater | MNASMIIDGLAMALFDLAAVHLPEIIVYLDHLININLGE |
| Ga0181424_102424742 | 3300017786 | Seawater | MNASMIIDGLAMALFALAAVHLPEIIVYLDTIINANLGE |
| Ga0206125_100151025 | 3300020165 | Seawater | MNTTMIIDGLAIALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0206125_100386444 | 3300020165 | Seawater | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0206129_103482452 | 3300020182 | Seawater | MNITMIIDGLAIALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0206130_100568442 | 3300020187 | Seawater | MNITMIKDGLAMALFALAATHIPEIIVFLDTIINANLGE |
| Ga0206677_1001515910 | 3300021085 | Seawater | MNITMIKDGVAMALFALACIHLPEIIVFLDTIINANLGK |
| Ga0206682_1001515111 | 3300021185 | Seawater | MNASMIIDGLAMALFALAAVHLPEIIVYLDHLININLGE |
| Ga0213865_100471312 | 3300021373 | Seawater | MNTTMISDGLAMALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0213869_1000286325 | 3300021375 | Seawater | MNITMIKDGLAMALFALACIHLPEIIVFLDTIINANLGE |
| Ga0222717_100489996 | 3300021957 | Estuarine Water | MNITMIKDGLAIALFAVAAVHLPEIIVFLDQFINAK |
| Ga0222717_101359332 | 3300021957 | Estuarine Water | MNITMIKDGLVIALFAVAAVHLPEIIVFLDQFINAK |
| Ga0212030_10239583 | 3300022053 | Aqueous | MNTTMIIDGFAMALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0212023_10384731 | 3300022061 | Aqueous | MNTTMIIDGFAMALFAVAAVHLPEIIVFLDQYINVS |
| Ga0212022_100003913 | 3300022164 | Aqueous | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQFINVWGR |
| Ga0196887_10200134 | 3300022178 | Aqueous | MNITMIKDGLAMALFALAATHLPEIIVFLDHLININLGE |
| Ga0196887_10309783 | 3300022178 | Aqueous | MNASMIIDGLAMALFALAAIHLPEIIVYLDHLININLGE |
| Ga0196887_10989161 | 3300022178 | Aqueous | MNASMIIDGLAMALFALAAIHLPEIIVYLDTIINANLGE |
| Ga0224506_102640112 | 3300022221 | Sediment | MNASMIIDGLVMALFALAAVHLPEIIVYLDTIINANLGE |
| (restricted) Ga0233426_100426285 | 3300022920 | Seawater | MNTSMIIDGLAMALFALAAVHLPEIIVYLDHLININLGE |
| Ga0228668_10071694 | 3300024180 | Seawater | MNITMIKDGLAMALFAVAAVLLPEIIVFLDQFINVWGR |
| Ga0228666_10527103 | 3300024221 | Seawater | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQFINAK |
| Ga0228601_10184563 | 3300024223 | Seawater | MNITMIKDGLAMALFAVAAVLLPEIIVFLDQFINIWGR |
| Ga0228667_11074411 | 3300024226 | Seawater | QSTSVPQIGGGMNASMIIDGLAMALFALAAVHLPEIIVYLDHLININLGE |
| Ga0233399_10681892 | 3300024231 | Seawater | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQLINVWGR |
| Ga0228655_10212062 | 3300024236 | Seawater | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGR |
| Ga0228655_10989843 | 3300024236 | Seawater | TSVPQIGGGMNASMIIDGLAMALFALAAVHLPEIIVYLDHLININLGE |
| (restricted) Ga0233444_100683552 | 3300024264 | Seawater | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQFINVWGR |
| Ga0244775_1000915013 | 3300024346 | Estuarine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQFINAK |
| Ga0244775_100533896 | 3300024346 | Estuarine | MNASMIIDGLAMALFALAAVHLPEIIVFLDTIINAN |
| Ga0244775_101407704 | 3300024346 | Estuarine | MNMTMIIDGIAMALFAIAVIHLPEIIVFLDQLITTN |
| Ga0244775_101826515 | 3300024346 | Estuarine | MNTTMIIDGLAMALFAVAAVHLPEIIAFLDQYINVWGR |
| Ga0244776_100086333 | 3300024348 | Estuarine | MNASMIIDGLVMALFALAAVHLPEIIVYLDTIININLGE |
| Ga0208667_10102686 | 3300025070 | Marine | MQNMRKYIMNITMIIDGLAMALFAVAAVHLPEIIVFLDQYINVQ |
| Ga0208667_10615391 | 3300025070 | Marine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0208298_10216713 | 3300025084 | Marine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQLINV |
| Ga0208792_10071236 | 3300025085 | Marine | MQNMRKYIMNTTMIIDGLAMALFAVAAVHLPEIIVFLDQLINV |
| Ga0209716_10251145 | 3300025626 | Pelagic Marine | MNTTMIIEGLAMALFALAAVHLPEIIVFLDQYINVWGR |
| Ga0209307_10888631 | 3300025832 | Pelagic Marine | MNTTMIIDGLAMALFAVAAVHLPEIIVFLDQYINVN |
| Ga0209603_10938905 | 3300025849 | Pelagic Marine | MNITMIKDGLAMALFALACIHLPEIIVFLDHLININLGE |
| Ga0208801_10403293 | 3300027367 | Estuarine | MDQMNASMIIDGLVMALFALAAVHLPEIIVYLDTIINANLGE |
| Ga0208965_10005982 | 3300027406 | Marine | MNTSMIIDGLAIALFALATIHLPEIIVYLDTIININLGE |
| Ga0208950_10204796 | 3300027413 | Marine | MNASMIIDGLVMALFALAAVHLPEIIVYLDHLININLGE |
| Ga0208971_100126723 | 3300027582 | Marine | MNTSMIIDGLVMALFALAAVHLPEIIVYLDTIININLGE |
| Ga0208133_10046366 | 3300027631 | Estuarine | MIIDGLAMALFALAAVHLPEIIVYLDHLININLGE |
| Ga0208133_10141343 | 3300027631 | Estuarine | MDQMNASMIIDGLAMALFALAAVHLPEIIVFLDTIINAN |
| Ga0208304_101959612 | 3300027751 | Estuarine | MNTSMIIDGLAMALFAVAAVHLPEIIAFLDQYINVWGR |
| Ga0209092_100025287 | 3300027833 | Marine | MQMNMTMIIDGIAMALFAIAAIHLPEIIVFLDQLITTN |
| Ga0209092_100362336 | 3300027833 | Marine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQLINAK |
| Ga0209092_102999202 | 3300027833 | Marine | MNTSMIIDGLAMALFALAAVHLPEIIVYLDYLININLGE |
| (restricted) Ga0233415_103062992 | 3300027861 | Seawater | WWGVVMNITMIKDGLAIALFAVAAVHLPEIIVFLDQFINDFTIMK |
| Ga0256368_10205002 | 3300028125 | Sea-Ice Brine | MNTTMIIDGLAIALFAVAAVHLPEIIVFLDQFINAK |
| Ga0256368_10398662 | 3300028125 | Sea-Ice Brine | MNITMIIDGFAMALFAVAAVHLPEIIVFLDYLININLGEXNANNR |
| Ga0256368_10910902 | 3300028125 | Sea-Ice Brine | MNITMIIDGLAMALFAVAAVHLPEIIVYLDYLININLGE |
| Ga0257126_12490241 | 3300028287 | Marine | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQFINIWGR |
| Ga0228627_11295542 | 3300028414 | Seawater | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQFINIWGR |
| Ga0307488_100036442 | 3300031519 | Sackhole Brine | MNITMIKDGLAMALFALAAVHLPEIIVYLDYLININLGE |
| Ga0307488_101309002 | 3300031519 | Sackhole Brine | MNITMIIDGFAMALFAVAAVHLPEIIVFLDYLININLGE |
| Ga0307488_103420571 | 3300031519 | Sackhole Brine | MNASMIIDGLAMALFAVAAVHLPEIIVYLDYLININLGE |
| Ga0307488_104104882 | 3300031519 | Sackhole Brine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDQFINKEKL |
| Ga0307488_104558283 | 3300031519 | Sackhole Brine | MNITMIKDGLAMALFAVAAVHLPEIIVFLDQFINIWGK |
| Ga0307488_106174152 | 3300031519 | Sackhole Brine | MNITMIIDGFAMALFAVAAVHLPEIIVFLDQFINIWGR |
| Ga0307488_107471112 | 3300031519 | Sackhole Brine | MNITMIIDGFAMALFAVAAVHLPEIIVFLDQFINVWGR |
| Ga0307489_102983434 | 3300031569 | Sackhole Brine | MQNMRKYIMNITMIIDGLAMALFALAAVHLPEIIVYLDQFINVWGR |
| Ga0307489_107835552 | 3300031569 | Sackhole Brine | MNITMIIDGFAMALFAVAAVHLPEIIVYLDYLININLGK |
| Ga0307489_110547851 | 3300031569 | Sackhole Brine | MNITMIIDGFAMALFAVAAVHLPEIIVYLDQFINVWGR |
| Ga0307489_114413581 | 3300031569 | Sackhole Brine | MNITMIIDGLAMALFAVAAVHLPEIIVFLDYLININLGK |
| Ga0315322_102251734 | 3300031766 | Seawater | MNITMIIDGLAMAIFALACIHLPEIIVFLDQFININLGE |
| Ga0315321_101690101 | 3300032088 | Seawater | MNASMIIDGLVMALFALAAVHLPEIIVYLDTIINANL |
| Ga0316202_104231163 | 3300032277 | Microbial Mat | TMIIDGLAMALFAVAAVHLPEIIVFLDQYINVWGR |
| Ga0314858_042047_631_738 | 3300033742 | Sea-Ice Brine | MIIDGFAMALFAVAAVHLPEIIVFLDYLININLGE |
| Ga0314858_103663_137_244 | 3300033742 | Sea-Ice Brine | MIIDGLAMALFALAAVHLPEIIVYLDYLININLGE |
| Ga0314858_121947_83_217 | 3300033742 | Sea-Ice Brine | MQNMRKYIMSITMIIDGLAMALFAVAAVHLPEIIVFLDQFINIK |
| ⦗Top⦘ |