


| Basic Information | |
|---|---|
| Family ID | F044462 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MILCPNFVKRLATKLSLVVALQAVFIPGLKASSNWVGE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.65 % |
| % of genes near scaffold ends (potentially truncated) | 69.48 % |
| % of genes from short scaffolds (< 2000 bps) | 68.83 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.130 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.065 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (37.013 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 3.25 |
| PF14279 | HNH_5 | 2.60 |
| PF00959 | Phage_lysozyme | 1.30 |
| PF01391 | Collagen | 0.65 |
| PF03237 | Terminase_6N | 0.65 |
| PF02945 | Endonuclease_7 | 0.65 |
| PF13524 | Glyco_trans_1_2 | 0.65 |
| PF01464 | SLT | 0.65 |
| PF02434 | Fringe | 0.65 |
| PF03161 | LAGLIDADG_2 | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10004663 | Not Available | 7672 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10051573 | Not Available | 1105 | Open in IMG/M |
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10066738 | Not Available | 928 | Open in IMG/M |
| 3300000241|BS_KBA_SWE21_205mDRAFT_10095429 | Not Available | 644 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_106436138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 672 | Open in IMG/M |
| 3300004240|Ga0007787_10368824 | Not Available | 714 | Open in IMG/M |
| 3300004481|Ga0069718_14931239 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300004772|Ga0007791_10042627 | Not Available | 1507 | Open in IMG/M |
| 3300005527|Ga0068876_10012910 | Not Available | 5435 | Open in IMG/M |
| 3300005528|Ga0068872_10318582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 859 | Open in IMG/M |
| 3300005581|Ga0049081_10079140 | Not Available | 1234 | Open in IMG/M |
| 3300006637|Ga0075461_10141301 | Not Available | 741 | Open in IMG/M |
| 3300006790|Ga0098074_1182323 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 526 | Open in IMG/M |
| 3300006802|Ga0070749_10035645 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3077 | Open in IMG/M |
| 3300006802|Ga0070749_10153269 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300006810|Ga0070754_10247809 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006810|Ga0070754_10415076 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006868|Ga0075481_10042062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1764 | Open in IMG/M |
| 3300006868|Ga0075481_10263432 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006916|Ga0070750_10021664 | All Organisms → cellular organisms → Bacteria | 3259 | Open in IMG/M |
| 3300006916|Ga0070750_10118012 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1219 | Open in IMG/M |
| 3300007165|Ga0079302_1010417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2475 | Open in IMG/M |
| 3300007538|Ga0099851_1134573 | Not Available | 928 | Open in IMG/M |
| 3300007539|Ga0099849_1087944 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1250 | Open in IMG/M |
| 3300007539|Ga0099849_1096854 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300007541|Ga0099848_1090454 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300007541|Ga0099848_1091941 | Not Available | 1172 | Open in IMG/M |
| 3300007541|Ga0099848_1111958 | Not Available | 1039 | Open in IMG/M |
| 3300007541|Ga0099848_1284199 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300007542|Ga0099846_1029091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2128 | Open in IMG/M |
| 3300007544|Ga0102861_1000085 | Not Available | 24804 | Open in IMG/M |
| 3300007960|Ga0099850_1406041 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300008012|Ga0075480_10010030 | All Organisms → Viruses | 5930 | Open in IMG/M |
| 3300008012|Ga0075480_10460984 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 617 | Open in IMG/M |
| 3300008120|Ga0114355_1195526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 658 | Open in IMG/M |
| 3300008266|Ga0114363_1000647 | Not Available | 23547 | Open in IMG/M |
| 3300008339|Ga0114878_1208329 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 648 | Open in IMG/M |
| 3300008448|Ga0114876_1003114 | Not Available | 11256 | Open in IMG/M |
| 3300008448|Ga0114876_1054384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1788 | Open in IMG/M |
| 3300008448|Ga0114876_1116047 | Not Available | 1035 | Open in IMG/M |
| 3300008448|Ga0114876_1191474 | Not Available | 700 | Open in IMG/M |
| 3300009009|Ga0105105_10006537 | Not Available | 4615 | Open in IMG/M |
| 3300009085|Ga0105103_10005702 | Not Available | 6109 | Open in IMG/M |
| 3300009149|Ga0114918_10760127 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 506 | Open in IMG/M |
| 3300009165|Ga0105102_10496383 | Not Available | 662 | Open in IMG/M |
| 3300009165|Ga0105102_10662128 | Not Available | 582 | Open in IMG/M |
| 3300009169|Ga0105097_10332284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya | 841 | Open in IMG/M |
| 3300009466|Ga0126448_1075482 | Not Available | 767 | Open in IMG/M |
| 3300009466|Ga0126448_1110937 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 621 | Open in IMG/M |
| 3300009559|Ga0130029_1007412 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300010296|Ga0129348_1137397 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 850 | Open in IMG/M |
| 3300010299|Ga0129342_1008957 | All Organisms → cellular organisms → Bacteria | 4264 | Open in IMG/M |
| 3300010299|Ga0129342_1016649 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3035 | Open in IMG/M |
| 3300010299|Ga0129342_1136956 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010354|Ga0129333_10641193 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300010354|Ga0129333_10650978 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300010354|Ga0129333_10737883 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300010354|Ga0129333_11304650 | Not Available | 600 | Open in IMG/M |
| 3300010354|Ga0129333_11315318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya | 597 | Open in IMG/M |
| 3300010354|Ga0129333_11632532 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010370|Ga0129336_10032477 | Not Available | 3154 | Open in IMG/M |
| 3300010370|Ga0129336_10292786 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010885|Ga0133913_12244266 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1343 | Open in IMG/M |
| 3300010885|Ga0133913_12923820 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1144 | Open in IMG/M |
| 3300011335|Ga0153698_1165 | Not Available | 31612 | Open in IMG/M |
| 3300011984|Ga0119931_1051468 | Not Available | 503 | Open in IMG/M |
| 3300012000|Ga0119951_1087566 | Not Available | 772 | Open in IMG/M |
| 3300012666|Ga0157498_1047184 | Not Available | 661 | Open in IMG/M |
| 3300013004|Ga0164293_10416765 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300013087|Ga0163212_1018579 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2534 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1367022 | Not Available | 506 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10171301 | Not Available | 1403 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10132154 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1808 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10195615 | Not Available | 1382 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10494465 | Not Available | 746 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10743747 | Not Available | 614 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10647334 | Not Available | 675 | Open in IMG/M |
| 3300017723|Ga0181362_1060782 | Not Available | 776 | Open in IMG/M |
| 3300017747|Ga0181352_1006525 | All Organisms → cellular organisms → Bacteria | 3907 | Open in IMG/M |
| 3300017747|Ga0181352_1085753 | Not Available | 876 | Open in IMG/M |
| 3300017747|Ga0181352_1089755 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300017747|Ga0181352_1107011 | Not Available | 763 | Open in IMG/M |
| 3300017754|Ga0181344_1000021 | Not Available | 83650 | Open in IMG/M |
| 3300017766|Ga0181343_1000921 | All Organisms → Viruses | 12094 | Open in IMG/M |
| 3300017777|Ga0181357_1078154 | Not Available | 1267 | Open in IMG/M |
| 3300017785|Ga0181355_1128951 | Not Available | 1031 | Open in IMG/M |
| 3300017967|Ga0181590_10008396 | Not Available | 8421 | Open in IMG/M |
| 3300019724|Ga0194003_1004453 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300019784|Ga0181359_1090208 | Not Available | 1137 | Open in IMG/M |
| 3300020151|Ga0211736_10089162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1925 | Open in IMG/M |
| 3300020161|Ga0211726_10567668 | Not Available | 5779 | Open in IMG/M |
| 3300020172|Ga0211729_10032990 | Not Available | 719 | Open in IMG/M |
| 3300020183|Ga0194115_10207419 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 961 | Open in IMG/M |
| 3300020183|Ga0194115_10221748 | Not Available | 915 | Open in IMG/M |
| 3300020190|Ga0194118_10093849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1855 | Open in IMG/M |
| 3300020196|Ga0194124_10018585 | All Organisms → Viruses | 5017 | Open in IMG/M |
| 3300020204|Ga0194116_10028936 | Not Available | 4355 | Open in IMG/M |
| 3300021092|Ga0194122_10048949 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2559 | Open in IMG/M |
| 3300021961|Ga0222714_10005628 | Not Available | 11850 | Open in IMG/M |
| 3300022057|Ga0212025_1064542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7375 | 632 | Open in IMG/M |
| 3300022057|Ga0212025_1086812 | Not Available | 537 | Open in IMG/M |
| 3300022187|Ga0196899_1071081 | Not Available | 1085 | Open in IMG/M |
| 3300022198|Ga0196905_1005280 | Not Available | 4544 | Open in IMG/M |
| 3300022198|Ga0196905_1028778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1681 | Open in IMG/M |
| 3300022198|Ga0196905_1154208 | Not Available | 590 | Open in IMG/M |
| 3300022407|Ga0181351_1261097 | Not Available | 532 | Open in IMG/M |
| 3300023176|Ga0255772_10016624 | Not Available | 5998 | Open in IMG/M |
| 3300024262|Ga0210003_1251869 | Not Available | 697 | Open in IMG/M |
| 3300024505|Ga0255150_1067163 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 560 | Open in IMG/M |
| 3300025057|Ga0208018_102734 | All Organisms → cellular organisms → Bacteria | 3182 | Open in IMG/M |
| 3300025655|Ga0208795_1011504 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300025655|Ga0208795_1110340 | Not Available | 726 | Open in IMG/M |
| 3300025674|Ga0208162_1056575 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 1292 | Open in IMG/M |
| 3300027210|Ga0208802_1000001 | Not Available | 81321 | Open in IMG/M |
| 3300027608|Ga0208974_1067270 | Not Available | 999 | Open in IMG/M |
| 3300027683|Ga0209392_1001150 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 6725 | Open in IMG/M |
| 3300027785|Ga0209246_10103960 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1114 | Open in IMG/M |
| 3300027793|Ga0209972_10349771 | Not Available | 639 | Open in IMG/M |
| 3300027816|Ga0209990_10005838 | Not Available | 8272 | Open in IMG/M |
| 3300027816|Ga0209990_10037558 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 2551 | Open in IMG/M |
| 3300027917|Ga0209536_100055790 | Not Available | 5158 | Open in IMG/M |
| 3300031539|Ga0307380_10777571 | Not Available | 794 | Open in IMG/M |
| 3300031565|Ga0307379_10105227 | Not Available | 3054 | Open in IMG/M |
| 3300031565|Ga0307379_10356354 | Not Available | 1419 | Open in IMG/M |
| 3300031578|Ga0307376_10031176 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 4036 | Open in IMG/M |
| 3300031578|Ga0307376_10512047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 774 | Open in IMG/M |
| 3300031578|Ga0307376_10737449 | Not Available | 614 | Open in IMG/M |
| 3300031669|Ga0307375_10346240 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031673|Ga0307377_10046725 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3704 | Open in IMG/M |
| 3300031673|Ga0307377_10375905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1060 | Open in IMG/M |
| 3300031784|Ga0315899_10000485 | Not Available | 47604 | Open in IMG/M |
| 3300031784|Ga0315899_10077754 | Not Available | 3434 | Open in IMG/M |
| 3300031834|Ga0315290_10657265 | Not Available | 906 | Open in IMG/M |
| 3300031952|Ga0315294_10121479 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 2682 | Open in IMG/M |
| 3300031952|Ga0315294_10985558 | Not Available | 704 | Open in IMG/M |
| 3300031963|Ga0315901_10493656 | Not Available | 956 | Open in IMG/M |
| 3300031963|Ga0315901_10860906 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 649 | Open in IMG/M |
| 3300031963|Ga0315901_11183208 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 519 | Open in IMG/M |
| 3300031963|Ga0315901_11212865 | Not Available | 510 | Open in IMG/M |
| 3300032093|Ga0315902_10990587 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032143|Ga0315292_10285413 | Not Available | 1371 | Open in IMG/M |
| 3300032275|Ga0315270_10015775 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 4081 | Open in IMG/M |
| 3300032516|Ga0315273_10141342 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 3300 | Open in IMG/M |
| 3300033981|Ga0334982_0000064 | Not Available | 58337 | Open in IMG/M |
| 3300034061|Ga0334987_0007240 | Not Available | 10506 | Open in IMG/M |
| 3300034061|Ga0334987_0340336 | Not Available | 975 | Open in IMG/M |
| 3300034061|Ga0334987_0551053 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300034063|Ga0335000_0493912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya | 708 | Open in IMG/M |
| 3300034066|Ga0335019_0021414 | Not Available | 4464 | Open in IMG/M |
| 3300034066|Ga0335019_0871912 | Not Available | 502 | Open in IMG/M |
| 3300034072|Ga0310127_254557 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 622 | Open in IMG/M |
| 3300034073|Ga0310130_0087619 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 931 | Open in IMG/M |
| 3300034374|Ga0348335_012927 | All Organisms → cellular organisms → Bacteria | 4429 | Open in IMG/M |
| 3300034375|Ga0348336_006394 | Not Available | 7937 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.90% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.60% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 1.95% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.30% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.30% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.30% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.30% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.30% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.30% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.30% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.30% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.65% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.65% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.65% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.65% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.65% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.65% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.65% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.65% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009559 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 3m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019724 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100046639 | 3300000116 | Marine | MILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE* |
| BS_KBA_SWE12_21mDRAFT_100515733 | 3300000124 | Marine | LCPNFVKRLATKISLVAAVQAVFIPGLKADSNWVGE* |
| BS_KBA_SWE12_21mDRAFT_100667382 | 3300000124 | Marine | MGASVVAFKPMILCPNFVKRLATKISLVAAVQAVFIPGLKANSNWVGE* |
| BS_KBA_SWE21_205mDRAFT_100954291 | 3300000241 | Marine | FMGASVVAFKPMILCPNFVKRLATKISLVAALQAVFIPGLKADSNWVGE* |
| JGIcombinedJ13530_1064361382 | 3300001213 | Wetland | MILCPNFVKRLTTKLSLVVALQAVFVPGLRADSNWVG |
| Ga0007787_103688242 | 3300004240 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVAALQAVFIPGLKADSNWVGE* |
| Ga0069718_149312391 | 3300004481 | Sediment | PMILCRNFVRRLTAKLSLIVALQAVFVPGLKADSNWVGE* |
| Ga0007791_100426272 | 3300004772 | Freshwater | MILCPKFVKSVLTKLTLVLACQTVFIPGLKAESNWVGENG* |
| Ga0068876_100129104 | 3300005527 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVAAVQTVFIPGLKADSNWVGE* |
| Ga0068872_103185821 | 3300005528 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVVALQAVFIPGLKANSNWVGE* |
| Ga0049081_100791402 | 3300005581 | Freshwater Lentic | MGASVVAFKPMILCPNFVKRLATKISLVAALQAVFIPGLKANSNWVGE* |
| Ga0075461_101413011 | 3300006637 | Aqueous | MTLCPNFVRNLTTAVSLFISVQAVFTPGLKAESNWVGE* |
| Ga0098074_11823232 | 3300006790 | Marine | MILCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWV |
| Ga0070749_100356455 | 3300006802 | Aqueous | LNSMTLCPNFVKRLATAVSLCISVQAVFTPGLKAESNWVGE* |
| Ga0070749_101532691 | 3300006802 | Aqueous | PAGHGSLIHGSQCCCFITMILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE* |
| Ga0070754_102478092 | 3300006810 | Aqueous | SSMTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGE* |
| Ga0070754_104150761 | 3300006810 | Aqueous | LCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGE* |
| Ga0075481_100420623 | 3300006868 | Aqueous | LDTNLWIHGGQCCCFKPMILCPNFVKRLAAKLSLVVAVQAVFIPGLKADSNWVGD* |
| Ga0075481_102634321 | 3300006868 | Aqueous | CCFITMILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE* |
| Ga0070750_100216644 | 3300006916 | Aqueous | TMILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE* |
| Ga0070750_101180123 | 3300006916 | Aqueous | MILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAEE |
| Ga0079302_10104171 | 3300007165 | Deep Subsurface | ILCRNFLRRLTAKLSLVVALQAVFVPGLKADSNWVGE* |
| Ga0099851_11345732 | 3300007538 | Aqueous | MILCPNFVKRLAATVSLIAVVQPVFTPGLKADSNWVGEQTI* |
| Ga0099849_10879441 | 3300007539 | Aqueous | GDQCCRKNPMILCRNFLRRLTAKLSLVVALQAVFVPGLKADSNWVGE* |
| Ga0099849_10968541 | 3300007539 | Aqueous | GQCCCFSSMTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGE* |
| Ga0099848_10904541 | 3300007541 | Aqueous | IYGGQCCCFSSMTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGE* |
| Ga0099848_10919413 | 3300007541 | Aqueous | LIHGGQCCCFSSMILCPNFVKRLAAKLSLVVAVQAVFTPGLKADSNWVGE* |
| Ga0099848_11119581 | 3300007541 | Aqueous | ESLIHGGQCCCFKTMILCPNFVKRLTTKLSLVVALQAVFIPGLKASSNWVGE* |
| Ga0099848_12841991 | 3300007541 | Aqueous | LFGIALHVSPNQLDTNLLIHGGQCCCFNPMILCPNFVKRLATAVSLVVSVQTVFTPGLKAESNWVGE* |
| Ga0099846_10290914 | 3300007542 | Aqueous | IYGGQCCCFSSMTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGEHTT* |
| Ga0102861_100008522 | 3300007544 | Estuarine | MILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGES* |
| Ga0099850_14060412 | 3300007960 | Aqueous | FCCFSSMTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGE* |
| Ga0075480_100100309 | 3300008012 | Aqueous | MTLCPNFVRSLTTAVSLFISVQAVFTPGLKAESNWVGE* |
| Ga0075480_104609842 | 3300008012 | Aqueous | MLLCPNFVKRLATVVSLLTATQAVFIPGLKANSNWVGE |
| Ga0114355_11955261 | 3300008120 | Freshwater, Plankton | MILCPKFVKRTLTHLAAALTLQTVFIPGLKASSNWVGD* |
| Ga0114363_100064725 | 3300008266 | Freshwater, Plankton | MILCPKFVKRTLTHLAVALTLQTVFIPGLRASSNWVGG* |
| Ga0114878_12083291 | 3300008339 | Freshwater Lake | MILCPKFVKRTLTHLAAALTLQTVFIPGLKASSNWVGEN* |
| Ga0114876_10031147 | 3300008448 | Freshwater Lake | MILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGARG* |
| Ga0114876_10543841 | 3300008448 | Freshwater Lake | GQCCCFKPMILCPNFVKRLAAKLSLVVAVQAVFIPGLKASSNWVGE* |
| Ga0114876_11160471 | 3300008448 | Freshwater Lake | CPKFVKSLATYLATTLALQTVFIPGLRASSNWVGE* |
| Ga0114876_11914742 | 3300008448 | Freshwater Lake | KPMILCPNFVKRLATKISLVAALQAVFIPGLKADSNWVGE* |
| Ga0105105_100065376 | 3300009009 | Freshwater Sediment | MILCPNLVKRTLVYLATTLALQTVFIPGLKASSNWVGEQN* |
| Ga0105103_100057029 | 3300009085 | Freshwater Sediment | MILCPKFVKRTLTYLATALSLQTVFIPGLKASSNWVGE* |
| Ga0114918_107601272 | 3300009149 | Deep Subsurface | MTLCPNFVKRLATTVSLIVSVQAVFTPGLKAESNWV |
| Ga0105102_104963832 | 3300009165 | Freshwater Sediment | PNFVKRLATKISLVAAVQTVFIPGLKADSNWVGE* |
| Ga0105102_106621281 | 3300009165 | Freshwater Sediment | KPMILCPNFVKRLATKISLVAAVQTVFIPGLKADSNWVGE* |
| Ga0105097_103322842 | 3300009169 | Freshwater Sediment | MILCPNFVKRLTTKLSLVVALQAVFVPGLKADSNWVGEYLHASSDV* |
| Ga0126448_10754822 | 3300009466 | Meromictic Pond | NFVKRLAAKLSLVVAVQTVFTPGLKADSNWVGEHTT* |
| Ga0126448_11109371 | 3300009466 | Meromictic Pond | MILCPNFVKRLAAKLSLVVAVQTVFTPGLKADSNWVGE |
| Ga0130029_10074123 | 3300009559 | Meromictic Pond | FSSMILCPNFVKRLAAKLSLVVAVQTVFTPGLKADSNWVGE* |
| Ga0129348_11373971 | 3300010296 | Freshwater To Marine Saline Gradient | PKFVKRTLAYLATTLALQTVFVPGLRASSNWVGE* |
| Ga0129342_10089572 | 3300010299 | Freshwater To Marine Saline Gradient | MILCPNFVKRLTTKLSLVLVLQTVFTPGLKADSNWVGDYA* |
| Ga0129342_10166492 | 3300010299 | Freshwater To Marine Saline Gradient | MTLCPNFVKRLAAAVSLAVSVQAVFTPGLKADSNWVGE* |
| Ga0129342_11369561 | 3300010299 | Freshwater To Marine Saline Gradient | MILCPNFVKRLTTKLSLVLALQTVFTPGLKAESNWVGE* |
| Ga0129333_106411931 | 3300010354 | Freshwater To Marine Saline Gradient | FRTMILCPNFVKHLTTKLSLVAVLQAVFIPGLKASSNWVGA* |
| Ga0129333_106509781 | 3300010354 | Freshwater To Marine Saline Gradient | LCPNFVKHLTTKLSLVAVLQAVFIPGLKASSNWVGE* |
| Ga0129333_107378832 | 3300010354 | Freshwater To Marine Saline Gradient | CPNFVKRLAATVSLVASVQTVFTPGLKAESNWVGE* |
| Ga0129333_113046501 | 3300010354 | Freshwater To Marine Saline Gradient | MILCPNFVKHLTTKLSLVAVLQAVFIPGLKASSNWVG |
| Ga0129333_113153181 | 3300010354 | Freshwater To Marine Saline Gradient | PNFVKRLATAVSLVVSVQTVFTPGLKAESNWVGE* |
| Ga0129333_116325322 | 3300010354 | Freshwater To Marine Saline Gradient | PMILCPNFVKRLTTKLSLVVALQAVFIPGLKASSNWVGE* |
| Ga0129336_100324774 | 3300010370 | Freshwater To Marine Saline Gradient | PMILCPNLVKRTLVYLATTLALQTVFIPGLKASSNWVGE* |
| Ga0129336_102927861 | 3300010370 | Freshwater To Marine Saline Gradient | FRTMILCPNFVKHLTTKLSLVAVLQAVFIPGLKASSNWVGE* |
| Ga0133913_122442664 | 3300010885 | Freshwater Lake | IKPMILCPKFVKRLATTVSLFLVSQTVFTPGLKAESNWVGERG* |
| Ga0133913_129238203 | 3300010885 | Freshwater Lake | LIHGDQCCCINPMILCPKFVKRLATTVSLFLVSQTVFTPGLKAESNWVGERG* |
| Ga0153698_11658 | 3300011335 | Freshwater | MILCRNFVRRLTAKLSLVVALQAVFVPGLKAESNWVGE* |
| Ga0119931_10514681 | 3300011984 | Drinking Water Treatment Plant | MILCPNFVKRLAATISLVASVQTVFAPGLKAESNWVG |
| Ga0119951_10875662 | 3300012000 | Freshwater | VQAPAGINPWVCGGQCCCIKPMILCPNFVKRLAAQLSLVVGLQTFFIPGLKADSNWVGE* |
| Ga0157498_10471841 | 3300012666 | Freshwater, Surface Ice | MILCRNFLRRLTAKLSLVVALQAVFVPGLKANSNWVG |
| Ga0164293_104167652 | 3300013004 | Freshwater | FKPMILCPKFVKRTLTYLASTLVLQTVFIPGLRASSNWVGAES* |
| Ga0163212_10185791 | 3300013087 | Freshwater | MLLCPNFVKRLAAVISLVTSVQTVFAPGLKAESNWVGE* |
| (restricted) Ga0172374_13670222 | 3300013122 | Freshwater | PNFVKRLAAVISLVTSVQTVFAPGLKAESNWVGE* |
| (restricted) Ga0172367_101713014 | 3300013126 | Freshwater | NPMILCPNFVKRLAATVSLVASVQTVFAPGLKADSNWVGE* |
| (restricted) Ga0172373_101321544 | 3300013131 | Freshwater | VAFDLMLLCPNFVKRLAAVISLVTSVQTVFAPGLKAESNWVGE* |
| (restricted) Ga0172373_101956154 | 3300013131 | Freshwater | CPNFVKRLAATVSLVASVQTVFAPGLKADSNWVGE* |
| (restricted) Ga0172373_104944652 | 3300013131 | Freshwater | MILCPNFVKRLAATVSLVASVQTVFAPGLKADSNWVG |
| (restricted) Ga0172372_107437471 | 3300013132 | Freshwater | LCRNFVRRLTAKLSLIVALQAVFVPGLKAESNWVGK* |
| (restricted) Ga0172375_106473342 | 3300013137 | Freshwater | MGASVVAFDLMLLCPNFVKRLAAVISLVTSVQTVFAPGLKAESNWVGE* |
| Ga0181362_10607821 | 3300017723 | Freshwater Lake | MILCPNFVKRLAVTVSLITSVQAVFAPGLKADSNWV |
| Ga0181352_10065251 | 3300017747 | Freshwater Lake | MILCRNFLRRLTAKLSLVVALQAVFVPGLKANSNWVGE |
| Ga0181352_10857532 | 3300017747 | Freshwater Lake | MILCPKFVKNFATYLATTLALQTVFIPGLKASSNWVGE |
| Ga0181352_10897551 | 3300017747 | Freshwater Lake | TDQLIYGDQRPRSNPMILCRNFLRRLTAKLSLVVALQAVFVPGLKANSNWVGE |
| Ga0181352_11070112 | 3300017747 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVAAVQTVFIPGLKA |
| Ga0181344_100002192 | 3300017754 | Freshwater Lake | MILCPKFVKRTLTYLATTLALQTVFIPGLKASSNWVGE |
| Ga0181343_100092112 | 3300017766 | Freshwater Lake | GGEPMILCPKFVKRTLTHLAAALTLQTVFIPGLKASSNWVGEN |
| Ga0181357_10781541 | 3300017777 | Freshwater Lake | FIQAPTGINLWVCGGQCCCIIPKTLGANIDKRLAAQLSLVVGLQTFFIPGLKADSNWVGE |
| Ga0181355_11289511 | 3300017785 | Freshwater Lake | NLWVCGGQCCCIKPMTLCPNFVKRLAAQLSLVVGLQTFFIPGLKADSNWVGE |
| Ga0181590_100083961 | 3300017967 | Salt Marsh | AGHESLIHGSQCCCLNSMTLCPNFVKRLATAVSLCISVQAVFTPGLKAESNWVGE |
| Ga0194003_10044533 | 3300019724 | Sediment | PAGHGSLIHGSQCCCFITMILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE |
| Ga0181359_10902082 | 3300019784 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVAALQAVFIPGLKADSNWVGE |
| Ga0211736_100891623 | 3300020151 | Freshwater | ILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGARG |
| Ga0211726_105676684 | 3300020161 | Freshwater | MILCRNFVRRLTAKLSLVVALQAVFVPGLKAESNWVGE |
| Ga0211729_100329902 | 3300020172 | Freshwater | CPNFVKRLATKISLVAALQAVFIPGLKANSNWVGE |
| Ga0194115_102074191 | 3300020183 | Freshwater Lake | FKPMILCPNFVKRLTTKLSLVLALQAVFTPGLKAESNWVRE |
| Ga0194115_102217481 | 3300020183 | Freshwater Lake | AFDLMLLCPNFVKRLAASLSIVASLQAVFIPGLKAESNWVGE |
| Ga0194118_100938494 | 3300020190 | Freshwater Lake | KPMILCPNFVKRLTTKLSLVLALQAVFTPGLKAESNWVRE |
| Ga0194124_100185858 | 3300020196 | Freshwater Lake | MLLCPNFVKRLAAVISLVTSVQTVFAPGLKAESNWVGE |
| Ga0194116_100289361 | 3300020204 | Freshwater Lake | ILCPNFVKRLTTKLSLVLALQAVFTPGLRANSNWVGE |
| Ga0194122_100489495 | 3300021092 | Freshwater Lake | YGGQCCCINQMILCRNFVRRLTAKLSLVLALQAVFIPGLKAESNWVGD |
| Ga0222714_100056286 | 3300021961 | Estuarine Water | MILCPNFVKRTLTHLAVALTLQTVFIPGLRASSNWVGG |
| Ga0212025_10645421 | 3300022057 | Aqueous | CFITMILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE |
| Ga0212025_10868121 | 3300022057 | Aqueous | TLCPNFVRSLTTAVSLFISVQAVFTPGLKAESNWVGE |
| Ga0196899_10710811 | 3300022187 | Aqueous | MTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGEHTT |
| Ga0196905_10052808 | 3300022198 | Aqueous | GYRSLIYGGQCCCFSSMTLCPNFVKRLAAKLSLVVAVQAVFTPGLKAESNWVGEHTT |
| Ga0196905_10287784 | 3300022198 | Aqueous | NQLDTNLLIHGGQCCCFNPMILCPNFVKRLATAVSLVVSVQTVFTPGLKAESNWVGE |
| Ga0196905_11542081 | 3300022198 | Aqueous | GYESLIHGGQCCCFSSMILCPNFVKRLAAKLSLVVAVQAVFTPGLKADSNWVGE |
| Ga0181351_12610971 | 3300022407 | Freshwater Lake | ILCPNFVRRLIAKLSVIVTLQAVFSPALQAASNWVGEN |
| Ga0255772_100166242 | 3300023176 | Salt Marsh | MTLCPNFVRSLTTAVSLFISVQAVFTPGLKAESNWVGE |
| Ga0210003_12518691 | 3300024262 | Deep Subsurface | LCRNFVRRLTAKLSLVVALQSVFVPGLKADSNWVGE |
| Ga0255150_10671631 | 3300024505 | Freshwater | VKRTLTTLATTLVLQTVFIPGLRASSNWVGDYAAI |
| Ga0208018_1027344 | 3300025057 | Marine | SMILCPNFVKRLTTKLSLVLALQTVFTPGLKAESNWVGE |
| Ga0208795_10115045 | 3300025655 | Aqueous | MILCPNFVKRLATAVSLVVSVQTVFTPGLKAESNWVGE |
| Ga0208795_11103402 | 3300025655 | Aqueous | CFSSMILCPNFVKRLAAKLSLVVAVQAVFTPGLKADSNWVGE |
| Ga0208162_10565754 | 3300025674 | Aqueous | IYGDQCCRKNPMILCRNFLRRLTAKLSLVVALQAVFVPGLKADSNWVGE |
| Ga0208802_1000001129 | 3300027210 | Estuarine | MILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGES |
| Ga0208974_10672701 | 3300027608 | Freshwater Lentic | WVIDLLIYGDQCSCINLMIICRNFLRRLTAKLSLVVALQAVFVPGLKADSNWVGE |
| Ga0209392_10011507 | 3300027683 | Freshwater Sediment | MILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGARG |
| Ga0209246_101039601 | 3300027785 | Freshwater Lake | LMILCPNFVRRLIAKLSVIVTLQAVFSPALQAASNWVGEN |
| Ga0209972_103497712 | 3300027793 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVVALQAVFIPGLKANSNWVGE |
| Ga0209990_100058384 | 3300027816 | Freshwater Lake | MGASVVAFKPMILCPNFVKRLATKISLVAAVQTVFIPGLKADSNWVGE |
| Ga0209990_100375581 | 3300027816 | Freshwater Lake | CFKPMILCPKFVKRTLTHLAAALTLQTVFIPGLKASSNWVGD |
| Ga0209536_1000557902 | 3300027917 | Marine Sediment | MILCPNFVKRFTTKLSVLLLLQTVFTPGLKAESNWVGE |
| Ga0307380_107775712 | 3300031539 | Soil | MGASVVAFKPMILCPNFVKRLATKISLVAALQAVFIPGLKANSNWVGE |
| Ga0307379_101052273 | 3300031565 | Soil | MILCPNFVRRLSAKLSLVVALQAVFVPGLKANSNWVGE |
| Ga0307379_103563543 | 3300031565 | Soil | MGASVVAFKPMILCPNFVKRLATKISLVAALQAVFIP |
| Ga0307376_100311761 | 3300031578 | Soil | MTLCPNFVKRLATAVSLCISVQAVFTPGLKAESNWVGE |
| Ga0307376_105120472 | 3300031578 | Soil | PNYVKRLATVVSLIAATQAVFIPGLRANSNWVGERENQCDVF |
| Ga0307376_107374492 | 3300031578 | Soil | LCRNFVRRLTAKLSLVVALQAVFVPGLKADSNWVGE |
| Ga0307375_103462402 | 3300031669 | Soil | PMILCRNFVRRLTAKLSLVVALQAVFVPGLKADSNWVGE |
| Ga0307377_100467252 | 3300031673 | Soil | MILCRNFVRRLTAKLSLVVALQAVFVPGLKADSNWVGE |
| Ga0307377_103759053 | 3300031673 | Soil | ILCPNFVRRLTAKLSLVVALQAVFVPGLKANSNWVGEYGT |
| Ga0315899_1000048526 | 3300031784 | Freshwater | MILCPKFVKRTLTHLAVALTLQTVFIPGLRASSNWVGG |
| Ga0315899_100777541 | 3300031784 | Freshwater | NLVKRTLVYLATTLALQTVFIPGLKASSNWVGEQS |
| Ga0315290_106572651 | 3300031834 | Sediment | LIPGDQCCCIKPMILCPKFVKRLATAVSLFLVSQTVFTPGLKAESNWVSE |
| Ga0315294_101214791 | 3300031952 | Sediment | MILCPNFVRRLIAKLSVIVTLQAVFSPALQAASNWVGEN |
| Ga0315294_109855581 | 3300031952 | Sediment | MILCPNFVRRLIAKLSVIVTLQAVFSPALQAASNWVGE |
| Ga0315901_104936561 | 3300031963 | Freshwater | TMILCPKFVKSLATYLATTLALQTVFIPGLRASSNWVGE |
| Ga0315901_108609061 | 3300031963 | Freshwater | CFKPMILCPKFVKRTLTHLAAALTLQTVFIPGLKASSNWVGEN |
| Ga0315901_111832082 | 3300031963 | Freshwater | TMILCPKFVKNFATYLATTLALQTVFIPGLKASSNWVGE |
| Ga0315901_112128652 | 3300031963 | Freshwater | MILCPKFVKRTLTYLASTLVLQTVFIPGLRASSNWVGAES |
| Ga0315902_109905871 | 3300032093 | Freshwater | CFKPMILCPNFVKRLAAKLSLVVAVQAVFIPGLKASSNWVGE |
| Ga0315292_102854131 | 3300032143 | Sediment | IKPMTLCPNFVKRLAAQLSLVVGLQTVFIPGLKADSNWVGE |
| Ga0315270_100157754 | 3300032275 | Sediment | MILCPNFVRRLTAKLSLVVALQAVFVPGLKANSNWVGE |
| Ga0315273_101413425 | 3300032516 | Sediment | IMILCPNFVRRLIAKLSVIVTLQAVFSPALQAASNWVGE |
| Ga0334982_0000064_16933_17049 | 3300033981 | Freshwater | MILCPNFVKRLAATVSLVASVQTVFTPGLKAESNWVGE |
| Ga0334987_0007240_4740_4856 | 3300034061 | Freshwater | MILCPNFVKRLATKLSLVVALQAVFIPGLKASSNWVGE |
| Ga0334987_0340336_1_144 | 3300034061 | Freshwater | GASVVAFKPMILCPNFVKRLATKISLVAAVQTVFIPGLKANSNWVGE |
| Ga0334987_0551053_571_690 | 3300034061 | Freshwater | PMILCPNFVKRTLAYLATTLALQTVFVPGLKASSNWVGE |
| Ga0335000_0493912_2_124 | 3300034063 | Freshwater | KPMILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGE |
| Ga0335019_0021414_240_356 | 3300034066 | Freshwater | MILCPKFVKRTLTYLATALALQTVFIPGLKASSNWVGE |
| Ga0335019_0871912_2_151 | 3300034066 | Freshwater | STGASVVAFKPMILCPNFVKRLATKISLVAAVQTVFIPGLKADSNWVGE |
| Ga0310127_254557_24_170 | 3300034072 | Fracking Water | MGASVVAFKTMILCPKFVKNFATYLATTLALQTVFIPGLKASSNWVGE |
| Ga0310130_0087619_36_152 | 3300034073 | Fracking Water | MILCPNFVKRLAAKLSLVIAVQAVFIPGLKAQSNWVGA |
| Ga0348335_012927_3271_3387 | 3300034374 | Aqueous | MILCPNFVKRLAATVSLVAITQTVFTPGLKAQSNWVAE |
| Ga0348336_006394_7344_7460 | 3300034375 | Aqueous | MILCPNFVKRLAAKLSLVVAVQAVFIPGLKADSNWVGD |
| ⦗Top⦘ |