


| Basic Information | |
|---|---|
| Family ID | F044309 |
| Family Type | Metagenome |
| Number of Sequences | 154 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLI |
| Number of Associated Samples | 11 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.20 % |
| % of genes near scaffold ends (potentially truncated) | 57.14 % |
| % of genes from short scaffolds (< 2000 bps) | 41.56 % |
| Associated GOLD sequencing projects | 6 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.299 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (96.753 % of family members) |
| Environment Ontology (ENVO) | Unclassified (96.753 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (96.753 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 16.67% Coil/Unstructured: 61.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF13585 | CHU_C | 3.90 |
| PF05572 | Peptidase_M43 | 2.60 |
| PF00468 | Ribosomal_L34 | 2.60 |
| PF08281 | Sigma70_r4_2 | 2.60 |
| PF00490 | ALAD | 2.60 |
| PF03050 | DDE_Tnp_IS66 | 1.95 |
| PF13289 | SIR2_2 | 1.95 |
| PF03061 | 4HBT | 1.95 |
| PF00501 | AMP-binding | 1.30 |
| PF02321 | OEP | 1.30 |
| PF00691 | OmpA | 1.30 |
| PF09996 | DUF2237 | 1.30 |
| PF00344 | SecY | 1.30 |
| PF13302 | Acetyltransf_3 | 1.30 |
| PF00271 | Helicase_C | 1.30 |
| PF16242 | Pyrid_ox_like | 1.30 |
| PF13519 | VWA_2 | 1.30 |
| PF09423 | PhoD | 1.30 |
| PF02421 | FeoB_N | 1.30 |
| PF03150 | CCP_MauG | 1.30 |
| PF05199 | GMC_oxred_C | 1.30 |
| PF01381 | HTH_3 | 1.30 |
| PF13450 | NAD_binding_8 | 1.30 |
| PF00106 | adh_short | 1.30 |
| PF04245 | NA37 | 1.30 |
| PF07876 | Dabb | 1.30 |
| PF04613 | LpxD | 1.30 |
| PF02322 | Cyt_bd_oxida_II | 1.30 |
| PF00825 | Ribonuclease_P | 0.65 |
| PF01979 | Amidohydro_1 | 0.65 |
| PF13412 | HTH_24 | 0.65 |
| PF00155 | Aminotran_1_2 | 0.65 |
| PF11138 | DUF2911 | 0.65 |
| PF13545 | HTH_Crp_2 | 0.65 |
| PF01593 | Amino_oxidase | 0.65 |
| PF10509 | GalKase_gal_bdg | 0.65 |
| PF00005 | ABC_tran | 0.65 |
| PF10035 | DUF2179 | 0.65 |
| PF01427 | Peptidase_M15 | 0.65 |
| PF04023 | FeoA | 0.65 |
| PF00144 | Beta-lactamase | 0.65 |
| PF13005 | zf-IS66 | 0.65 |
| PF10555 | MraY_sig1 | 0.65 |
| PF12951 | PATR | 0.65 |
| PF01053 | Cys_Met_Meta_PP | 0.65 |
| PF05971 | Methyltransf_10 | 0.65 |
| PF00474 | SSF | 0.65 |
| PF04397 | LytTR | 0.65 |
| PF02426 | MIase | 0.65 |
| PF13568 | OMP_b-brl_2 | 0.65 |
| PF13573 | SprB | 0.65 |
| PF07991 | IlvN | 0.65 |
| PF09298 | FAA_hydrolase_N | 0.65 |
| PF00805 | Pentapeptide | 0.65 |
| PF00270 | DEAD | 0.65 |
| PF02547 | Queuosine_synth | 0.65 |
| PF08669 | GCV_T_C | 0.65 |
| PF13517 | FG-GAP_3 | 0.65 |
| PF00313 | CSD | 0.65 |
| PF13460 | NAD_binding_10 | 0.65 |
| PF02776 | TPP_enzyme_N | 0.65 |
| PF01479 | S4 | 0.65 |
| PF07973 | tRNA_SAD | 0.65 |
| PF00083 | Sugar_tr | 0.65 |
| PF05685 | Uma2 | 0.65 |
| PF04166 | PdxA | 0.65 |
| PF04255 | DUF433 | 0.65 |
| PF04608 | PgpA | 0.65 |
| PF00486 | Trans_reg_C | 0.65 |
| PF03447 | NAD_binding_3 | 0.65 |
| PF13692 | Glyco_trans_1_4 | 0.65 |
| PF01176 | eIF-1a | 0.65 |
| PF13091 | PLDc_2 | 0.65 |
| PF00092 | VWA | 0.65 |
| PF04383 | KilA-N | 0.65 |
| PF13778 | DUF4174 | 0.65 |
| PF00953 | Glycos_transf_4 | 0.65 |
| PF01475 | FUR | 0.65 |
| PF09912 | DUF2141 | 0.65 |
| PF13435 | Cytochrome_C554 | 0.65 |
| PF01223 | Endonuclease_NS | 0.65 |
| PF13180 | PDZ_2 | 0.65 |
| PF00416 | Ribosomal_S13 | 0.65 |
| PF07715 | Plug | 0.65 |
| PF00933 | Glyco_hydro_3 | 0.65 |
| PF02706 | Wzz | 0.65 |
| PF05973 | Gp49 | 0.65 |
| PF13365 | Trypsin_2 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 2.60 |
| COG0230 | Ribosomal protein L34 | Translation, ribosomal structure and biogenesis [J] | 2.60 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.60 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.95 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 1.30 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 1.30 |
| COG0370 | Fe2+ transporter FeoB | Inorganic ion transport and metabolism [P] | 1.30 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.30 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 1.30 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.30 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 1.30 |
| COG3081 | dsDNA-binding nucleoid-associated protein YejK/NdpA | Replication, recombination and repair [L] | 1.30 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.65 |
| COG0099 | Ribosomal protein S13 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.65 |
| COG0179 | 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.65 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.65 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.65 |
| COG0594 | RNase P protein component | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.65 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1267 | Phosphatidylglycerophosphatase A | Lipid transport and metabolism [I] | 0.65 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.65 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.65 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.65 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.65 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.65 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.65 |
| COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.65 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.65 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.65 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.65 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.65 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG3129 | 23S rRNA A1618 N6-methylase RlmF | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.65 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.65 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.65 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.65 |
| COG4829 | Muconolactone delta-isomerase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.30 % |
| Unclassified | root | N/A | 48.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300007521|Ga0105044_10252438 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1719 | Open in IMG/M |
| 3300007521|Ga0105044_10270261 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1638 | Open in IMG/M |
| 3300007521|Ga0105044_10303731 | Not Available | 1508 | Open in IMG/M |
| 3300007521|Ga0105044_10303897 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300007521|Ga0105044_10563087 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 966 | Open in IMG/M |
| 3300007521|Ga0105044_10951820 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300007521|Ga0105044_11002695 | Not Available | 638 | Open in IMG/M |
| 3300007521|Ga0105044_11040549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 622 | Open in IMG/M |
| 3300007799|Ga0105049_10033429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5514 | Open in IMG/M |
| 3300007799|Ga0105049_10079918 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3178 | Open in IMG/M |
| 3300007799|Ga0105049_10125537 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2352 | Open in IMG/M |
| 3300007799|Ga0105049_10183923 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1816 | Open in IMG/M |
| 3300007799|Ga0105049_10246006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1489 | Open in IMG/M |
| 3300007799|Ga0105049_10360318 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1142 | Open in IMG/M |
| 3300007799|Ga0105049_10545075 | Not Available | 853 | Open in IMG/M |
| 3300007799|Ga0105049_10617939 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 781 | Open in IMG/M |
| 3300007799|Ga0105049_10674779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 734 | Open in IMG/M |
| 3300007799|Ga0105049_10713979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 705 | Open in IMG/M |
| 3300007799|Ga0105049_10797082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 653 | Open in IMG/M |
| 3300007799|Ga0105049_10994021 | Not Available | 560 | Open in IMG/M |
| 3300007799|Ga0105049_11110450 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 520 | Open in IMG/M |
| 3300009032|Ga0105048_10049543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6002 | Open in IMG/M |
| 3300009032|Ga0105048_10078559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4501 | Open in IMG/M |
| 3300009032|Ga0105048_10115525 | All Organisms → cellular organisms → Bacteria | 3489 | Open in IMG/M |
| 3300009032|Ga0105048_10163863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2754 | Open in IMG/M |
| 3300009032|Ga0105048_10182859 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ilyomonas → Ilyomonas limi | 2551 | Open in IMG/M |
| 3300009032|Ga0105048_10212325 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 2296 | Open in IMG/M |
| 3300009032|Ga0105048_10263402 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1970 | Open in IMG/M |
| 3300009032|Ga0105048_10306957 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1763 | Open in IMG/M |
| 3300009032|Ga0105048_10334019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1657 | Open in IMG/M |
| 3300009032|Ga0105048_10462201 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1300 | Open in IMG/M |
| 3300009032|Ga0105048_10625566 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1030 | Open in IMG/M |
| 3300009032|Ga0105048_10638611 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300009032|Ga0105048_10674837 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 971 | Open in IMG/M |
| 3300009032|Ga0105048_10699961 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300009032|Ga0105048_10864712 | Not Available | 799 | Open in IMG/M |
| 3300009032|Ga0105048_10972286 | All Organisms → cellular organisms → Bacteria → FCB group | 729 | Open in IMG/M |
| 3300009032|Ga0105048_11089353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 668 | Open in IMG/M |
| 3300009032|Ga0105048_11208818 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 617 | Open in IMG/M |
| 3300009032|Ga0105048_11225720 | Not Available | 611 | Open in IMG/M |
| 3300009032|Ga0105048_11453279 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Haliscomenobacter → Haliscomenobacter hydrossis → Haliscomenobacter hydrossis DSM 1100 | 538 | Open in IMG/M |
| 3300009083|Ga0105047_10029902 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales | 8059 | Open in IMG/M |
| 3300009083|Ga0105047_10071574 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 4587 | Open in IMG/M |
| 3300009083|Ga0105047_10113792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae | 3356 | Open in IMG/M |
| 3300009083|Ga0105047_10165370 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2587 | Open in IMG/M |
| 3300009083|Ga0105047_10207294 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300009083|Ga0105047_10229034 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 2050 | Open in IMG/M |
| 3300009083|Ga0105047_10436877 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Haliscomenobacter → Haliscomenobacter hydrossis → Haliscomenobacter hydrossis DSM 1100 | 1274 | Open in IMG/M |
| 3300009083|Ga0105047_10455942 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300009083|Ga0105047_10743940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 849 | Open in IMG/M |
| 3300009083|Ga0105047_11318528 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 553 | Open in IMG/M |
| 3300009084|Ga0105046_10184661 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 2432 | Open in IMG/M |
| 3300009084|Ga0105046_10252253 | Not Available | 1947 | Open in IMG/M |
| 3300009084|Ga0105046_10277344 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 1818 | Open in IMG/M |
| 3300009084|Ga0105046_10378227 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1446 | Open in IMG/M |
| 3300009084|Ga0105046_10406614 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300012044|Ga0136636_10075015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1644 | Open in IMG/M |
| 3300012044|Ga0136636_10149219 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012044|Ga0136636_10308167 | Not Available | 688 | Open in IMG/M |
| 3300027823|Ga0209490_10222914 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1225 | Open in IMG/M |
| 3300027823|Ga0209490_10253510 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1116 | Open in IMG/M |
| 3300027823|Ga0209490_10352381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 875 | Open in IMG/M |
| 3300027823|Ga0209490_10494509 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 674 | Open in IMG/M |
| 3300027878|Ga0209181_10024273 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6989 | Open in IMG/M |
| 3300027878|Ga0209181_10077442 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3342 | Open in IMG/M |
| 3300027878|Ga0209181_10096380 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2903 | Open in IMG/M |
| 3300027878|Ga0209181_10102096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Phaeodactylibacter → Phaeodactylibacter xiamenensis | 2795 | Open in IMG/M |
| 3300027878|Ga0209181_10130239 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2388 | Open in IMG/M |
| 3300027878|Ga0209181_10259710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1505 | Open in IMG/M |
| 3300027878|Ga0209181_10312353 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300027878|Ga0209181_10423661 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1061 | Open in IMG/M |
| 3300027878|Ga0209181_10498983 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae → Phaeodactylibacter → unclassified Phaeodactylibacter → Phaeodactylibacter sp. | 939 | Open in IMG/M |
| 3300027878|Ga0209181_10542976 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 881 | Open in IMG/M |
| 3300027878|Ga0209181_10659929 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 758 | Open in IMG/M |
| 3300027878|Ga0209181_10696807 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 726 | Open in IMG/M |
| 3300027878|Ga0209181_10953440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 563 | Open in IMG/M |
| 3300032420|Ga0335397_10044266 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Haliscomenobacteraceae | 4944 | Open in IMG/M |
| 3300032420|Ga0335397_10064124 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3951 | Open in IMG/M |
| 3300032420|Ga0335397_10131543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2511 | Open in IMG/M |
| 3300032420|Ga0335397_10140967 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
| 3300032420|Ga0335397_10166360 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ilyomonas → Ilyomonas limi | 2148 | Open in IMG/M |
| 3300032420|Ga0335397_10182559 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 2017 | Open in IMG/M |
| 3300032420|Ga0335397_10210417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1831 | Open in IMG/M |
| 3300032420|Ga0335397_10249828 | Not Available | 1626 | Open in IMG/M |
| 3300032420|Ga0335397_10266236 | Not Available | 1554 | Open in IMG/M |
| 3300032420|Ga0335397_10354642 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300032420|Ga0335397_10386408 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1186 | Open in IMG/M |
| 3300032420|Ga0335397_10466571 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1029 | Open in IMG/M |
| 3300032420|Ga0335397_10550425 | Not Available | 904 | Open in IMG/M |
| 3300032420|Ga0335397_10801683 | Not Available | 669 | Open in IMG/M |
| 3300032456|Ga0335394_10260334 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Lewinellaceae → Lewinella → Lewinella cohaerens | 1604 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 96.75% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.25% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007799 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300027823 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06 (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0105044_101130265 | 3300007521 | Freshwater | GKINRGYFCRNWLIIIAYPDKKPGCRFATFAFCNFAYLLNWPH* |
| Ga0105044_101314471 | 3300007521 | Freshwater | PDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILQINCFP* |
| Ga0105044_102524384 | 3300007521 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNIA |
| Ga0105044_102702611 | 3300007521 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLN* |
| Ga0105044_103037312 | 3300007521 | Freshwater | FWRNWLIFIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFA* |
| Ga0105044_103038973 | 3300007521 | Freshwater | VIAYPDKKPGCRFAPFAFPMNTGMLLRSFCNFAYLLIKAIS* |
| Ga0105044_103318122 | 3300007521 | Freshwater | AGKINRGYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLILAIA* |
| Ga0105044_103557863 | 3300007521 | Freshwater | AGKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLTFSHNHF* |
| Ga0105044_105630873 | 3300007521 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIFF* |
| Ga0105044_105924702 | 3300007521 | Freshwater | FCRNWLIVIAYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLNIVLLTRQQAD* |
| Ga0105044_106763501 | 3300007521 | Freshwater | YPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLICWNHL* |
| Ga0105044_107676952 | 3300007521 | Freshwater | YPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLISLLTY* |
| Ga0105044_109518203 | 3300007521 | Freshwater | NWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLTIHH* |
| Ga0105044_110026952 | 3300007521 | Freshwater | NWLIFIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIEGSMY* |
| Ga0105044_110405491 | 3300007521 | Freshwater | IAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNSE* |
| Ga0105049_1001783510 | 3300007799 | Freshwater | IAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIFF* |
| Ga0105049_100334291 | 3300007799 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLI |
| Ga0105049_100483471 | 3300007799 | Freshwater | AGKINRGYFCRNWLIINAYPDKKPGCRFAPFAFCNFAYLLMFL* |
| Ga0105049_100701091 | 3300007799 | Freshwater | TAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLID* |
| Ga0105049_100799181 | 3300007799 | Freshwater | WLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNY* |
| Ga0105049_101255373 | 3300007799 | Freshwater | IIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYVAACRFI* |
| Ga0105049_101839231 | 3300007799 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLLW* |
| Ga0105049_102115583 | 3300007799 | Freshwater | NWLIFIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNTLNSLLCAFSL* |
| Ga0105049_102460062 | 3300007799 | Freshwater | NWLIFIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIIRFNTS* |
| Ga0105049_102603861 | 3300007799 | Freshwater | MIACPDKKPGCRFAPFAFPMKTGMSLRSICNFAYL |
| Ga0105049_103030084 | 3300007799 | Freshwater | ACPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLI* |
| Ga0105049_103515951 | 3300007799 | Freshwater | AGKINRGYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLNWPH* |
| Ga0105049_103603183 | 3300007799 | Freshwater | GYFCYNWMIIIAYPDKKPGCRFAPFAFCNFAYLLRSSVSRVFWLFKA* |
| Ga0105049_104299941 | 3300007799 | Freshwater | AGKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLTCSSEQ* |
| Ga0105049_105450751 | 3300007799 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLRFQGT* |
| Ga0105049_105474311 | 3300007799 | Freshwater | AGKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLNKPRH* |
| Ga0105049_105820111 | 3300007799 | Freshwater | INRGYFCRNWLIIIAYPDKKPGCRFAPFAFPMKTGMLLRSICNFAYLLRP* |
| Ga0105049_106179392 | 3300007799 | Freshwater | ITYPDKKPGCRFASFAFPMKTGMSLRSICNFAYLLNQDEL* |
| Ga0105049_106747791 | 3300007799 | Freshwater | NWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLMWAMW* |
| Ga0105049_107139791 | 3300007799 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIESVVTVF* |
| Ga0105049_107485742 | 3300007799 | Freshwater | AGKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLIIP* |
| Ga0105049_107970822 | 3300007799 | Freshwater | PDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILVPRLAGA* |
| Ga0105049_109940212 | 3300007799 | Freshwater | NWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLICWNHL* |
| Ga0105049_111104501 | 3300007799 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNYLEPKV* |
| Ga0105048_100060631 | 3300009032 | Freshwater | AGKINRGYFCHNWLIIIAYPDKKPGCRFAPFAFCNFAYLLSEYTVT* |
| Ga0105048_100221121 | 3300009032 | Freshwater | AGKINRGYFCRNWLIIITYPDKKPGCRFAPFAFCNFAYLLSLLVIGY* |
| Ga0105048_100229561 | 3300009032 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLKA* |
| Ga0105048_100257721 | 3300009032 | Freshwater | NRGYFCRNWLIIIAYPDKKPGCCFAPFAFPMKTGMSLRSICNFAYLLKGA* |
| Ga0105048_100293697 | 3300009032 | Freshwater | AGKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLNIVLLTRQQAD* |
| Ga0105048_100430199 | 3300009032 | Freshwater | YFCRNWLIVIAYPDKKPGCRFAPFAFPMNTGMSLRSFCNFAYLLIKAIS* |
| Ga0105048_100431011 | 3300009032 | Freshwater | NWLIVITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIW* |
| Ga0105048_100495435 | 3300009032 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLN* |
| Ga0105048_100676028 | 3300009032 | Freshwater | CRNWLIVITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLFTLRAP* |
| Ga0105048_100776831 | 3300009032 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLRP* |
| Ga0105048_100785591 | 3300009032 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIGR* |
| Ga0105048_101010953 | 3300009032 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIGFHY* |
| Ga0105048_101071241 | 3300009032 | Freshwater | NWLIIITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLTQVTVIF* |
| Ga0105048_101155251 | 3300009032 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLHKPC* |
| Ga0105048_101566884 | 3300009032 | Freshwater | GKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLTCSSEQ* |
| Ga0105048_101638631 | 3300009032 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLS* |
| Ga0105048_101828591 | 3300009032 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNQDEL* |
| Ga0105048_102123251 | 3300009032 | Freshwater | NWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNI* |
| Ga0105048_102600784 | 3300009032 | Freshwater | NWLIIITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILQINCFP* |
| Ga0105048_102634024 | 3300009032 | Freshwater | FCRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYVLN* |
| Ga0105048_103069573 | 3300009032 | Freshwater | NWLIIIAYSDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLN* |
| Ga0105048_103340195 | 3300009032 | Freshwater | IAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNYLEPKV* |
| Ga0105048_104416564 | 3300009032 | Freshwater | NRGYFCRNWLIIIAYPDKKPGCCFAPFAFPMKTGMSLRSICNFAYLLNCSRSI* |
| Ga0105048_104622011 | 3300009032 | Freshwater | WLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLI* |
| Ga0105048_106255661 | 3300009032 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLS* |
| Ga0105048_106386111 | 3300009032 | Freshwater | WLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLISAH* |
| Ga0105048_106748372 | 3300009032 | Freshwater | IIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNYH* |
| Ga0105048_106999611 | 3300009032 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLSRI* |
| Ga0105048_107492241 | 3300009032 | Freshwater | GKINRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLT* |
| Ga0105048_108647122 | 3300009032 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLGFQGT* |
| Ga0105048_109722862 | 3300009032 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILVPRLAGA* |
| Ga0105048_110893533 | 3300009032 | Freshwater | NWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLTWAMW* |
| Ga0105048_112088182 | 3300009032 | Freshwater | IIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLICWNHL* |
| Ga0105048_112257202 | 3300009032 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLI* |
| Ga0105048_114532791 | 3300009032 | Freshwater | WLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLISLLTY* |
| Ga0105047_100299027 | 3300009083 | Freshwater | FCRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFA* |
| Ga0105047_100715747 | 3300009083 | Freshwater | NWLIIIAYPDKKPGCCFAPFAFPMKTGMSLRSICNFAYLLIFIVALIFL* |
| Ga0105047_100790701 | 3300009083 | Freshwater | KINRGYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLKASIGK* |
| Ga0105047_101137921 | 3300009083 | Freshwater | LIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLSRI* |
| Ga0105047_101653701 | 3300009083 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLTFCFGLN* |
| Ga0105047_102072943 | 3300009083 | Freshwater | YFWRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLK* |
| Ga0105047_102290345 | 3300009083 | Freshwater | MIIIAYPDKKPGCRFASFAFPMKTGMSLRSICNFA |
| Ga0105047_104076651 | 3300009083 | Freshwater | GKINRGYFCRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLHSICNFAYLLIGFHC* |
| Ga0105047_104368771 | 3300009083 | Freshwater | NWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLID* |
| Ga0105047_104559422 | 3300009083 | Freshwater | WLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNFGLVSFL* |
| Ga0105047_106474741 | 3300009083 | Freshwater | RNWLIINAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLGFQGT* |
| Ga0105047_107439401 | 3300009083 | Freshwater | WLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNYH* |
| Ga0105047_113185281 | 3300009083 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIIRFNTS* |
| Ga0105046_101401273 | 3300009084 | Freshwater | VGKINGGYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLL |
| Ga0105046_101672633 | 3300009084 | Freshwater | LIIITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNQDEL* |
| Ga0105046_101846611 | 3300009084 | Freshwater | NWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLISAH* |
| Ga0105046_102522531 | 3300009084 | Freshwater | WLIVIAYPDKKPGCRFAPFAFCNFAYLLNAFIGF* |
| Ga0105046_102773443 | 3300009084 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMETGMSLRSICNFAYLLIRRCALSFY |
| Ga0105046_102971591 | 3300009084 | Freshwater | KINRGYFCHNWLIIIAYPDKKPGCRFAPFAFCNFAYLLSEYTVT* |
| Ga0105046_103226764 | 3300009084 | Freshwater | GYFFRNWLIIITYPDKKPGCRFAPFAFCNFAYLLILQINCFP* |
| Ga0105046_103782273 | 3300009084 | Freshwater | WRNWLIIIAYPDKKPGCRFAPFVFPMKIGMSLRSICNFAYLLTIHH* |
| Ga0105046_104066141 | 3300009084 | Freshwater | PDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNYLEPKV* |
| Ga0105046_105177141 | 3300009084 | Freshwater | KPGCHFAPFAFPMKTGMSLRSICNFAYLLNLPLAFYF* |
| Ga0136636_100750151 | 3300012044 | Polar Desert Sand | GYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLILAIA* |
| Ga0136636_101492191 | 3300012044 | Polar Desert Sand | WLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNYLEPKV* |
| Ga0136636_103081671 | 3300012044 | Polar Desert Sand | GYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLTECTH* |
| Ga0136636_104027702 | 3300012044 | Polar Desert Sand | RNWLIVITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLFTLRAP* |
| Ga0136636_104781461 | 3300012044 | Polar Desert Sand | PDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLISLLTY* |
| Ga0209490_102229141 | 3300027823 | Freshwater | IIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYVAACRFI |
| Ga0209490_102535101 | 3300027823 | Freshwater | YNWMIIIAYPDKKPGCRFAPFAFCNFAYLLRSSVSRVFWLFKA |
| Ga0209490_103523812 | 3300027823 | Freshwater | RNWLIIVAYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLN |
| Ga0209490_104068641 | 3300027823 | Freshwater | GKINRDYFCRNWMIIIAYPDKKPGCRFAPFAFCNFAYLLRESSVRYIVV |
| Ga0209490_104810931 | 3300027823 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIESVVTVF |
| Ga0209490_104945092 | 3300027823 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILVPRLAGA |
| Ga0209490_105359891 | 3300027823 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLSLLVIGLQNPDNR |
| Ga0209490_106446101 | 3300027823 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIIRFNTS |
| Ga0209591_108559131 | 3300027850 | Freshwater | NWLIIITYPDKKPGCRFAPFAFCNFAYLLSGYHWSQIYITFK |
| Ga0209181_100242734 | 3300027878 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNI |
| Ga0209181_100252179 | 3300027878 | Freshwater | GKINRGYFCHNWLIIIAYPDKKPGCRFAPFAFCNFAYLLSEYTVT |
| Ga0209181_100710541 | 3300027878 | Freshwater | AGKINRGYFCHNWLIIIAYPDKKPGCRFAPFAYCNFAYLLTCGKLV |
| Ga0209181_100716936 | 3300027878 | Freshwater | INRGYFCRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLHKPC |
| Ga0209181_100774421 | 3300027878 | Freshwater | WLIIITYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLN |
| Ga0209181_100963801 | 3300027878 | Freshwater | RNWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNY |
| Ga0209181_101020963 | 3300027878 | Freshwater | CRNWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIESVVTVF |
| Ga0209181_101217191 | 3300027878 | Freshwater | INRGYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLSGQSQ |
| Ga0209181_101302393 | 3300027878 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILVPRLAGA |
| Ga0209181_102597101 | 3300027878 | Freshwater | IIFAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLN |
| Ga0209181_103123533 | 3300027878 | Freshwater | YFCRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYVLN |
| Ga0209181_104236611 | 3300027878 | Freshwater | CRNWMIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLTIHH |
| Ga0209181_104542911 | 3300027878 | Freshwater | VIISAYPDKKPGCHFAPFAFPMKTGMSLRSICNFAYLLNLPLAFYF |
| Ga0209181_104989832 | 3300027878 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIGR |
| Ga0209181_105429761 | 3300027878 | Freshwater | IIIAYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLIGFHY |
| Ga0209181_106599291 | 3300027878 | Freshwater | LIVIAYPDKKPGCRFAPFAFPMNTGMLLRSFCNFAYLLIKAIS |
| Ga0209181_106968071 | 3300027878 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLL |
| Ga0209181_107279481 | 3300027878 | Freshwater | CRNWLIVITYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLFTLRAP |
| Ga0209181_107849041 | 3300027878 | Freshwater | DKKPGCRFAPFAFPMKTGMSLRSICNFAYLLICWNHL |
| Ga0209181_109534401 | 3300027878 | Freshwater | CRNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFA |
| Ga0335397_100397871 | 3300032420 | Freshwater | YFCHNWLIIIAYPDKKPGCRFAPFAFCNFAYLLSEYTVT |
| Ga0335397_100442661 | 3300032420 | Freshwater | RNWLIVIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIESVVTVF |
| Ga0335397_100641243 | 3300032420 | Freshwater | FCRNWLIIVAYPDKKPGCRFAPFVFCNFAYLLIGYWFAKP |
| Ga0335397_100685211 | 3300032420 | Freshwater | YPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIGFHC |
| Ga0335397_101120533 | 3300032420 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLIYLLMKA |
| Ga0335397_101315434 | 3300032420 | Freshwater | SGIYKKKPGCRFAPFAFPMKTGMSLRSICNFAYLLILVPRLAGA |
| Ga0335397_101409671 | 3300032420 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLISAH |
| Ga0335397_101411522 | 3300032420 | Freshwater | INRGYFCRNWLIVIAYPDKKPGCRFAPFAFCNFAYLLIIP |
| Ga0335397_101663601 | 3300032420 | Freshwater | HNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLNQDEL |
| Ga0335397_101825591 | 3300032420 | Freshwater | MIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAPLL |
| Ga0335397_102104171 | 3300032420 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLINT |
| Ga0335397_102498281 | 3300032420 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLT |
| Ga0335397_102548604 | 3300032420 | Freshwater | VGKINRGYFCRNWLIIIAYPDKKPGCRFAPFAFCNFAYFLK |
| Ga0335397_102662361 | 3300032420 | Freshwater | LIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLTIYCLGRGFNCT |
| Ga0335397_103546421 | 3300032420 | Freshwater | RNWLIIIAYPDKKPGCCFAPFAFPMKTGMSLRSICNFAYLLNCSRSI |
| Ga0335397_103827983 | 3300032420 | Freshwater | STYPDKKPGCHFAPFAFPMKTGMSLRSICNFAYLLNLPLAFYF |
| Ga0335397_103864083 | 3300032420 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLI |
| Ga0335397_104665711 | 3300032420 | Freshwater | RNWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLMWAMW |
| Ga0335397_105504252 | 3300032420 | Freshwater | NWLIIIAYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLGFQGT |
| Ga0335397_108016831 | 3300032420 | Freshwater | FCRNWLIIIAYPDKKPGCRFAPFAFCNFAYLLTECTH |
| Ga0335397_108968421 | 3300032420 | Freshwater | NRGYFCRNWLIVIAYPDKKPGCRFAPFAFPMKTGMSLCSICNFAYLLNIVLLTRQQAD |
| Ga0335394_102603343 | 3300032456 | Freshwater | AYPDKKPGCRFAPFAFPMKTGMSLRSICNFAYLLN |
| Ga0335394_107162552 | 3300032456 | Freshwater | IAYPDKKPGYGFAPFAFPMKTGMSLRSICNFAYLLI |
| ⦗Top⦘ |