


| Basic Information | |
|---|---|
| Family ID | F044279 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 154 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRI |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.87 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.494 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (77.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.221 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (99.351 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.26% β-sheet: 2.33% Coil/Unstructured: 74.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF03977 | OAD_beta | 51.30 |
| PF06293 | Kdo | 5.19 |
| PF02436 | PYC_OADA | 3.90 |
| PF04277 | OAD_gamma | 3.25 |
| PF00364 | Biotin_lipoyl | 1.95 |
| PF02567 | PhzC-PhzF | 1.95 |
| PF02887 | PK_C | 1.30 |
| PF02800 | Gp_dh_C | 1.30 |
| PF01182 | Glucosamine_iso | 1.30 |
| PF05222 | AlaDh_PNT_N | 0.65 |
| PF02836 | Glyco_hydro_2_C | 0.65 |
| PF07715 | Plug | 0.65 |
| PF14219 | DUF4328 | 0.65 |
| PF00224 | PK | 0.65 |
| PF13533 | Biotin_lipoyl_2 | 0.65 |
| PF00265 | TK | 0.65 |
| PF00743 | FMO-like | 0.65 |
| PF00474 | SSF | 0.65 |
| PF01380 | SIS | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG1883 | Na+-transporting oxaloacetate/methylmalonyl-CoA decarboxylase, beta subunit | Energy production and conversion [C] | 51.30 |
| COG3630 | Na+-transporting oxaloacetate/methylmalonyl-CoA decarboxylase, gamma subunit | Energy production and conversion [C] | 3.25 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.95 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.95 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 1.30 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 1.30 |
| COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 0.65 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.65 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.49 % |
| Unclassified | root | N/A | 43.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001802|RCM38_10012 | Not Available | 649 | Open in IMG/M |
| 3300003477|nap3_10053450 | Not Available | 914 | Open in IMG/M |
| 3300009132|Ga0118730_1024056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 5056 | Open in IMG/M |
| 3300009132|Ga0118730_1106176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1850 | Open in IMG/M |
| 3300009132|Ga0118730_1296463 | Not Available | 839 | Open in IMG/M |
| 3300009339|Ga0117928_1016042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4145 | Open in IMG/M |
| 3300009339|Ga0117928_1051726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1847 | Open in IMG/M |
| 3300012394|Ga0123365_1036872 | Not Available | 635 | Open in IMG/M |
| 3300013116|Ga0171646_1013926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 4767 | Open in IMG/M |
| 3300016735|Ga0182074_1153008 | Not Available | 1038 | Open in IMG/M |
| 3300016743|Ga0182083_1074649 | Not Available | 1049 | Open in IMG/M |
| 3300016797|Ga0182090_1297919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300017818|Ga0181565_10091034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 2168 | Open in IMG/M |
| 3300017818|Ga0181565_10309410 | Not Available | 1059 | Open in IMG/M |
| 3300017818|Ga0181565_10446846 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300017818|Ga0181565_10752662 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300017824|Ga0181552_10080501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 1843 | Open in IMG/M |
| 3300017824|Ga0181552_10365601 | Not Available | 697 | Open in IMG/M |
| 3300017824|Ga0181552_10511262 | Not Available | 565 | Open in IMG/M |
| 3300017950|Ga0181607_10065889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 2386 | Open in IMG/M |
| 3300017950|Ga0181607_10231238 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300017950|Ga0181607_10359617 | Not Available | 803 | Open in IMG/M |
| 3300017950|Ga0181607_10452916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300017950|Ga0181607_10726258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 514 | Open in IMG/M |
| 3300017957|Ga0181571_10415002 | Not Available | 832 | Open in IMG/M |
| 3300017962|Ga0181581_10180643 | Not Available | 1406 | Open in IMG/M |
| 3300017964|Ga0181589_10440497 | Not Available | 852 | Open in IMG/M |
| 3300017985|Ga0181576_10035544 | Not Available | 3423 | Open in IMG/M |
| 3300017985|Ga0181576_10281284 | Not Available | 1064 | Open in IMG/M |
| 3300017985|Ga0181576_10554201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 700 | Open in IMG/M |
| 3300017985|Ga0181576_10716090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 597 | Open in IMG/M |
| 3300017985|Ga0181576_10763308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300017986|Ga0181569_10202359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1397 | Open in IMG/M |
| 3300017986|Ga0181569_10265454 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300017986|Ga0181569_10519817 | Not Available | 803 | Open in IMG/M |
| 3300017986|Ga0181569_10666116 | Not Available | 691 | Open in IMG/M |
| 3300017986|Ga0181569_10891246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 579 | Open in IMG/M |
| 3300018036|Ga0181600_10302750 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300018041|Ga0181601_10086066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 2076 | Open in IMG/M |
| 3300018041|Ga0181601_10332732 | Not Available | 830 | Open in IMG/M |
| 3300018048|Ga0181606_10321363 | Not Available | 848 | Open in IMG/M |
| 3300018048|Ga0181606_10321365 | Not Available | 848 | Open in IMG/M |
| 3300018410|Ga0181561_10195743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 995 | Open in IMG/M |
| 3300018410|Ga0181561_10252847 | Not Available | 837 | Open in IMG/M |
| 3300018410|Ga0181561_10424827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300018410|Ga0181561_10441915 | Not Available | 587 | Open in IMG/M |
| 3300018413|Ga0181560_10208167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 949 | Open in IMG/M |
| 3300018416|Ga0181553_10321823 | Not Available | 856 | Open in IMG/M |
| 3300018417|Ga0181558_10094487 | Not Available | 1873 | Open in IMG/M |
| 3300018417|Ga0181558_10095362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 1861 | Open in IMG/M |
| 3300018418|Ga0181567_10970254 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300018424|Ga0181591_10518909 | Not Available | 866 | Open in IMG/M |
| 3300018426|Ga0181566_10308124 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300018426|Ga0181566_10393792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 986 | Open in IMG/M |
| 3300018426|Ga0181566_10538108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300018426|Ga0181566_10709050 | Not Available | 691 | Open in IMG/M |
| 3300018428|Ga0181568_10170877 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300018428|Ga0181568_10243124 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300018428|Ga0181568_10591112 | Not Available | 876 | Open in IMG/M |
| 3300018428|Ga0181568_10977607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300018428|Ga0181568_11137335 | Not Available | 588 | Open in IMG/M |
| 3300018876|Ga0181564_10156795 | Not Available | 1357 | Open in IMG/M |
| 3300018876|Ga0181564_10550748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
| 3300019261|Ga0182097_1107743 | Not Available | 3434 | Open in IMG/M |
| 3300019262|Ga0182066_1514546 | Not Available | 688 | Open in IMG/M |
| 3300019272|Ga0182059_1606733 | Not Available | 672 | Open in IMG/M |
| 3300019277|Ga0182081_1559706 | Not Available | 586 | Open in IMG/M |
| 3300019283|Ga0182058_1756899 | Not Available | 641 | Open in IMG/M |
| 3300019459|Ga0181562_10474166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 596 | Open in IMG/M |
| 3300020053|Ga0181595_10145463 | Not Available | 1096 | Open in IMG/M |
| 3300020053|Ga0181595_10219531 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300020053|Ga0181595_10221057 | Not Available | 819 | Open in IMG/M |
| 3300020053|Ga0181595_10332687 | Not Available | 611 | Open in IMG/M |
| 3300020053|Ga0181595_10376980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 556 | Open in IMG/M |
| 3300020055|Ga0181575_10036340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 3185 | Open in IMG/M |
| 3300020055|Ga0181575_10072063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 2164 | Open in IMG/M |
| 3300020055|Ga0181575_10647145 | Not Available | 545 | Open in IMG/M |
| 3300020056|Ga0181574_10128984 | Not Available | 1693 | Open in IMG/M |
| 3300020173|Ga0181602_10002334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 15977 | Open in IMG/M |
| 3300020173|Ga0181602_10025894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3532 | Open in IMG/M |
| 3300020173|Ga0181602_10109925 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300020173|Ga0181602_10175650 | Not Available | 968 | Open in IMG/M |
| 3300020173|Ga0181602_10302936 | Not Available | 660 | Open in IMG/M |
| 3300020174|Ga0181603_10007446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 7359 | Open in IMG/M |
| 3300020177|Ga0181596_10198463 | Not Available | 878 | Open in IMG/M |
| 3300020177|Ga0181596_10210088 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300020188|Ga0181605_10123988 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300020191|Ga0181604_10431233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
| 3300020191|Ga0181604_10477635 | Not Available | 518 | Open in IMG/M |
| 3300020194|Ga0181597_10350854 | Not Available | 638 | Open in IMG/M |
| 3300020207|Ga0181570_10446455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300020238|Ga0211492_1045485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 821 | Open in IMG/M |
| 3300020381|Ga0211476_10000322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 32343 | Open in IMG/M |
| 3300020440|Ga0211518_10001738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 17351 | Open in IMG/M |
| 3300020440|Ga0211518_10008665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 7120 | Open in IMG/M |
| 3300020459|Ga0211514_10292139 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300020469|Ga0211577_10357936 | Not Available | 911 | Open in IMG/M |
| 3300020601|Ga0181557_1310145 | Not Available | 512 | Open in IMG/M |
| 3300020810|Ga0181598_1004499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 11517 | Open in IMG/M |
| 3300020810|Ga0181598_1039546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 2418 | Open in IMG/M |
| 3300020810|Ga0181598_1355907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 503 | Open in IMG/M |
| 3300021335|Ga0213867_1028145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2248 | Open in IMG/M |
| 3300021335|Ga0213867_1068908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1315 | Open in IMG/M |
| 3300021335|Ga0213867_1107335 | Not Available | 993 | Open in IMG/M |
| 3300021356|Ga0213858_10241009 | Not Available | 872 | Open in IMG/M |
| 3300021356|Ga0213858_10261840 | Not Available | 831 | Open in IMG/M |
| 3300021364|Ga0213859_10428756 | Not Available | 582 | Open in IMG/M |
| 3300021368|Ga0213860_10512712 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021373|Ga0213865_10017131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 4108 | Open in IMG/M |
| 3300021373|Ga0213865_10118326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1391 | Open in IMG/M |
| 3300021373|Ga0213865_10249825 | Not Available | 850 | Open in IMG/M |
| 3300021373|Ga0213865_10256918 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300021373|Ga0213865_10507489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 513 | Open in IMG/M |
| 3300021379|Ga0213864_10256506 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300021425|Ga0213866_10007618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 6819 | Open in IMG/M |
| 3300021425|Ga0213866_10038852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 2744 | Open in IMG/M |
| 3300021425|Ga0213866_10585296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300021425|Ga0213866_10599069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 514 | Open in IMG/M |
| 3300021958|Ga0222718_10364887 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300022907|Ga0255775_1009166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 6826 | Open in IMG/M |
| 3300022907|Ga0255775_1267784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300022909|Ga0255755_1040560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2389 | Open in IMG/M |
| 3300022909|Ga0255755_1072680 | Not Available | 1591 | Open in IMG/M |
| 3300022909|Ga0255755_1125769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1075 | Open in IMG/M |
| 3300022909|Ga0255755_1341295 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300022921|Ga0255765_1014561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 5914 | Open in IMG/M |
| 3300022921|Ga0255765_1184954 | Not Available | 941 | Open in IMG/M |
| 3300022921|Ga0255765_1280617 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300022921|Ga0255765_1324116 | Not Available | 600 | Open in IMG/M |
| 3300022923|Ga0255783_10006514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 10055 | Open in IMG/M |
| 3300022923|Ga0255783_10036553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 3182 | Open in IMG/M |
| 3300022923|Ga0255783_10353123 | Not Available | 571 | Open in IMG/M |
| 3300022925|Ga0255773_10103450 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300022925|Ga0255773_10133407 | Not Available | 1235 | Open in IMG/M |
| 3300022926|Ga0255753_1097868 | Not Available | 1449 | Open in IMG/M |
| 3300022926|Ga0255753_1195770 | Not Available | 861 | Open in IMG/M |
| 3300022927|Ga0255769_10130483 | Not Available | 1213 | Open in IMG/M |
| 3300022927|Ga0255769_10314488 | Not Available | 629 | Open in IMG/M |
| 3300022927|Ga0255769_10388975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 534 | Open in IMG/M |
| 3300022928|Ga0255758_10005206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 10695 | Open in IMG/M |
| 3300022928|Ga0255758_10301336 | Not Available | 681 | Open in IMG/M |
| 3300022929|Ga0255752_10179479 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300022939|Ga0255754_10244671 | Not Available | 876 | Open in IMG/M |
| 3300022939|Ga0255754_10395134 | Not Available | 621 | Open in IMG/M |
| 3300023081|Ga0255764_10370517 | Not Available | 630 | Open in IMG/M |
| 3300023116|Ga0255751_10092969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | 1898 | Open in IMG/M |
| 3300023119|Ga0255762_10030636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 3516 | Open in IMG/M |
| 3300023119|Ga0255762_10198626 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300023119|Ga0255762_10465606 | Not Available | 603 | Open in IMG/M |
| 3300023178|Ga0255759_10013746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6544 | Open in IMG/M |
| 3300023178|Ga0255759_10198309 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300023178|Ga0255759_10424326 | Not Available | 800 | Open in IMG/M |
| 3300027830|Ga0209359_10006299 | Not Available | 3617 | Open in IMG/M |
| 3300027830|Ga0209359_10058382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium | 1526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 77.27% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 11.04% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.90% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.95% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.65% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001802 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009339 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300012394 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013116 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300016735 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016743 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019261 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019272 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020238 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM38_100122 | 3300001802 | Marine Plankton | RIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFITLEI* |
| nap3_100534502 | 3300003477 | Estuarine | VQEKELKEPEKISLWTPKDLELKETELVSVFFRLKFNPRI* |
| Ga0118730_10240561 | 3300009132 | Marine | IQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRL* |
| Ga0118730_11061761 | 3300009132 | Marine | SNPPRVQEKELKEPEKISLWTPKDLELKETELVSVFFRLEFSLRT* |
| Ga0118730_12964632 | 3300009132 | Marine | IQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI* |
| Ga0117928_10160421 | 3300009339 | Marine | VQEKELKEPEKISLWTPKDLELKETELVSVFFRLEFSLRL* |
| Ga0117928_10517261 | 3300009339 | Marine | VQEKELKEPEKISLWTPKDLELKETELVSVFFRLEFSLRT* |
| Ga0123365_10368722 | 3300012394 | Marine | KEPEKISLWTPKDLELKETELVSVFFRLEFSLRI* |
| Ga0171646_10139261 | 3300013116 | Marine | NPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRL* |
| Ga0182074_11530081 | 3300016735 | Salt Marsh | VQEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0182083_10746491 | 3300016743 | Salt Marsh | NPPRVQEKELKEPERISLRTPKDLELKETELVSVFFCLK |
| Ga0182090_12979191 | 3300016797 | Salt Marsh | LSNPPRVQEKELKEPERISLRTPKELELKETELASVFFRLKFSLRL |
| Ga0181565_100910343 | 3300017818 | Salt Marsh | PPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFDFASLRI |
| Ga0181565_103094103 | 3300017818 | Salt Marsh | ELSNPPRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRL |
| Ga0181565_104468461 | 3300017818 | Salt Marsh | EFKEPEKISLRTPKELELKETELVSVFFRLKFTNLKI |
| Ga0181565_107526621 | 3300017818 | Salt Marsh | EKELEEPERISLRTPKDLDLKETELASVFFRLKFTLRI |
| Ga0181552_100805011 | 3300017824 | Salt Marsh | PPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181552_103656011 | 3300017824 | Salt Marsh | RIQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181552_105112621 | 3300017824 | Salt Marsh | RVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFGL |
| Ga0181607_100658891 | 3300017950 | Salt Marsh | NPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFEITSLKI |
| Ga0181607_102312381 | 3300017950 | Salt Marsh | PRVQEKELEEPERISLRTPKDLELKETELASVFFRLEFSLSI |
| Ga0181607_103596172 | 3300017950 | Salt Marsh | PRIQEKEFKEPERISLRTPKDLELKETELVSVFFRLKFSLRI |
| Ga0181607_104529163 | 3300017950 | Salt Marsh | PRIQEKEFKEPERISLRTPKDLELKETELVSVFFRLKFSLRL |
| Ga0181607_107262581 | 3300017950 | Salt Marsh | PRVQEKELEEPERISLRTPKDLELKETELASVFFRLEFSLRL |
| Ga0181571_104150022 | 3300017957 | Salt Marsh | EKELKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0181581_101806431 | 3300017962 | Salt Marsh | VQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181589_104404971 | 3300017964 | Salt Marsh | NPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0181576_100355441 | 3300017985 | Salt Marsh | INPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFDFASLRI |
| Ga0181576_102812841 | 3300017985 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKELELKETELVSVFFCLK |
| Ga0181576_105542011 | 3300017985 | Salt Marsh | INPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFTNLKI |
| Ga0181576_107160901 | 3300017985 | Salt Marsh | DPPRVQEKELKEPEKISLWTPKDLELKETELVSVFFRLEFSLRL |
| Ga0181576_107633083 | 3300017985 | Salt Marsh | KEFKEPERISLRTPKDLELKETELVSVFFRLEFSLRL |
| Ga0181569_102023591 | 3300017986 | Salt Marsh | ELSNPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRL |
| Ga0181569_102654542 | 3300017986 | Salt Marsh | IQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFTNLKI |
| Ga0181569_105198171 | 3300017986 | Salt Marsh | ELSNPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181569_106661161 | 3300017986 | Salt Marsh | KELSNPPRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0181569_108912462 | 3300017986 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKDLELKETELASVFFRLEFGL |
| Ga0181600_103027502 | 3300018036 | Salt Marsh | PRVQEKELKEPERISLRTPKDLELKETELVSVFFRL |
| Ga0181601_100860661 | 3300018041 | Salt Marsh | INPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFEITSLKI |
| Ga0181601_103327321 | 3300018041 | Salt Marsh | RIQEKEFKEPERISLRTPKDLELKETELVSVFFRLEFNLRI |
| Ga0181606_103213632 | 3300018048 | Salt Marsh | ELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFNLRI |
| Ga0181606_103213652 | 3300018048 | Salt Marsh | ELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRL |
| Ga0181561_101957431 | 3300018410 | Salt Marsh | PPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRL |
| Ga0181561_102528471 | 3300018410 | Salt Marsh | KELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFCLK |
| Ga0181561_104248271 | 3300018410 | Salt Marsh | ELSNPPRVQEKELKEPERISLRTPKELELKETELASVFFRLEFSIKLQLFY |
| Ga0181561_104419151 | 3300018410 | Salt Marsh | LKEPEKISLWTPKDLELKETELVSVFFRLKFNPRI |
| Ga0181560_102081673 | 3300018413 | Salt Marsh | NPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFGL |
| Ga0181553_103218233 | 3300018416 | Salt Marsh | ELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLKFSLRL |
| Ga0181558_100944871 | 3300018417 | Salt Marsh | KELSNPPRVQEKELKEPEKISLWTPKDLELKETELVSVFFCL |
| Ga0181558_100953623 | 3300018417 | Salt Marsh | KELKEPEKISLWTPKDLELKETELVSVFFRLKFNPRI |
| Ga0181567_109702542 | 3300018418 | Salt Marsh | KEPEKISLRTPKELELKETELVSVFFRLKFITLEI |
| Ga0181591_105189091 | 3300018424 | Salt Marsh | KKELSNPPRVQEKELKEPEIISLRTPKELELKETELVSVFFCLK |
| Ga0181566_103081241 | 3300018426 | Salt Marsh | NPPRIQEKEFKEPERISLRTPKDLELKETELVSVFFRL |
| Ga0181566_103937921 | 3300018426 | Salt Marsh | KELSNPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRL |
| Ga0181566_105381081 | 3300018426 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRL |
| Ga0181566_107090501 | 3300018426 | Salt Marsh | IQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181568_101708771 | 3300018428 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKELELKETELASVFFCLK |
| Ga0181568_102431241 | 3300018428 | Salt Marsh | PPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFTNLKI |
| Ga0181568_105911122 | 3300018428 | Salt Marsh | LINPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLEFAILKT |
| Ga0181568_109776071 | 3300018428 | Salt Marsh | KELSDPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRL |
| Ga0181568_111373351 | 3300018428 | Salt Marsh | KELSDPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181564_101567952 | 3300018876 | Salt Marsh | LSNPPRVQEKELKEPEKISLWTPKDLELKETELVSVFFRLKFNPRI |
| Ga0181564_105507481 | 3300018876 | Salt Marsh | NPPRVQEKELKEPERISLRTPKELELKETELASVFFRLEFSIKLQLFY |
| Ga0182097_11077431 | 3300019261 | Salt Marsh | ELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0182066_15145461 | 3300019262 | Salt Marsh | RVQEKELKEPERISLRTPKELELKETELVSVFFRLKKLA |
| Ga0182059_16067331 | 3300019272 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKDLELKETELASVFFCLK |
| Ga0182081_15597061 | 3300019277 | Salt Marsh | PRVQEKELKEPERISLRTPKELELKETELVSVFFCLK |
| Ga0182058_17568992 | 3300019283 | Salt Marsh | SNPPRVQEKELKEPEKISLRTPKELELKETELVSVFFRLKKLA |
| Ga0181562_104741663 | 3300019459 | Salt Marsh | EKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLTL |
| Ga0181595_101454631 | 3300020053 | Salt Marsh | PRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRL |
| Ga0181595_102195312 | 3300020053 | Salt Marsh | SPPRVQEKELKEPERISLRTPKDLELKETELASVFFRL |
| Ga0181595_102210571 | 3300020053 | Salt Marsh | SNPPRVQEKELKEPERISLRTPKDLELKETELASVFFRLEFNLRI |
| Ga0181595_103326872 | 3300020053 | Salt Marsh | INPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFDFTNLRI |
| Ga0181595_103769802 | 3300020053 | Salt Marsh | QEKELKEPERISLRTPKDLELKETELASVFFRLEFGL |
| Ga0181575_100363401 | 3300020055 | Salt Marsh | LINPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFDFASLRI |
| Ga0181575_100720633 | 3300020055 | Salt Marsh | LINPPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFTNLKI |
| Ga0181575_106471452 | 3300020055 | Salt Marsh | PRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181574_101289843 | 3300020056 | Salt Marsh | LSNPPRVQEKELKEPERISLRTPKELELKETELASVFFWLKLTK |
| Ga0181602_1000233413 | 3300020173 | Salt Marsh | KELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0181602_100258941 | 3300020173 | Salt Marsh | PPRVQEKELEEPERISLRTPKDLELKETELASVFFRLEFSLRL |
| Ga0181602_101099252 | 3300020173 | Salt Marsh | PPRVQEKELEEPERISLRTPKDLELKETELASVFFRLEFSLSI |
| Ga0181602_101756501 | 3300020173 | Salt Marsh | QEKEFKEPEKISLRTPKELELKETELVSVFFRLKFDFASLRI |
| Ga0181602_103029362 | 3300020173 | Salt Marsh | SNTPRIQEKEFKEPERISLRTPKDLELKETELVSVFFRLKFSLRI |
| Ga0181603_100074461 | 3300020174 | Salt Marsh | LSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0181596_101984631 | 3300020177 | Salt Marsh | EKELKEPERISLRTPKDLELKETELASVFFRLEFNLRI |
| Ga0181596_102100882 | 3300020177 | Salt Marsh | ELSNPPRIQEKEFKEPERISLRTPKDLELKETELASVFFRL |
| Ga0181605_101239881 | 3300020188 | Salt Marsh | RVQEKELEEPERISLRTPKDLELKETELASVFFRLEFSLSI |
| Ga0181604_104312331 | 3300020191 | Salt Marsh | QEKEFKEPEKISLWTPKDLELKETELVSVFFRLKFSLRL |
| Ga0181604_104776351 | 3300020191 | Salt Marsh | LSKPPRVQEKELKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181597_103508542 | 3300020194 | Salt Marsh | VQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0181570_104464551 | 3300020207 | Salt Marsh | KKELSDPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFSLRL |
| Ga0211492_10454852 | 3300020238 | Marine | PRIQEKGFEELKKISLWTPEELELKETELVSVFFRLA |
| Ga0211476_1000032225 | 3300020381 | Marine | KEFKEPEKISLRTPKELELKETELVSVFFRLKFANLKT |
| Ga0211518_100017381 | 3300020440 | Marine | PPRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFTNLKT |
| Ga0211518_100086658 | 3300020440 | Marine | KEPEKISLRTPKELELKETELDSVFFRLKFEITSLRI |
| Ga0211514_102921392 | 3300020459 | Marine | KELKEPEKISLWTPKELELKETELVSVFFRLEFSLRI |
| Ga0211577_103579361 | 3300020469 | Marine | DKKELTNPPRIQEKEFKEPEKISLRTPKELELKETELASVFFRLKLT |
| Ga0181557_13101451 | 3300020601 | Salt Marsh | SNPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI |
| Ga0181598_10044991 | 3300020810 | Salt Marsh | KELKEPERISLRTPKDLELKETELVSVFFRLKFSLRL |
| Ga0181598_10395461 | 3300020810 | Salt Marsh | EKELKEPERISLRTPKDLELKETELVSVFFRLEFNLRI |
| Ga0181598_13559071 | 3300020810 | Salt Marsh | QEKEFKEPERISLRTPKDLELKETELASVFFRLEFGL |
| Ga0213867_10281451 | 3300021335 | Seawater | QEKELKEPERISLRTPKDLELKETELVSVFFRLKFSLRL |
| Ga0213867_10689084 | 3300021335 | Seawater | LSKPPRVQEKELKEPERISLRTPKELELKETELASVFFRLEFSIKLQLFY |
| Ga0213867_11073352 | 3300021335 | Seawater | DKKELSNPPRIQEKEFKEPERISLRTPKDLELKETELVSVFFRLKFSLRI |
| Ga0213858_102410091 | 3300021356 | Seawater | SKPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRL |
| Ga0213858_102618402 | 3300021356 | Seawater | KELSNPPRVQEKELKEPERISLRTPKELELKETELVSVFFRLKKLA |
| Ga0213859_104287561 | 3300021364 | Seawater | RVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFNLRI |
| Ga0213860_105127121 | 3300021368 | Seawater | PPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRLEFSLRI |
| Ga0213865_100171315 | 3300021373 | Seawater | LEEPERISLRTPKDLELKETELASVFFRLEFSLSI |
| Ga0213865_101183263 | 3300021373 | Seawater | KELSNPPRVQEKELKEPERISLRTPKDLELKETELASVFFRLKFSLRL |
| Ga0213865_102498252 | 3300021373 | Seawater | LSNPPRVQEKELKEPERISLRTPKDLELKETELASVFFRLEFNLRI |
| Ga0213865_102569182 | 3300021373 | Seawater | PPRIQEKEFKEPERISLRTPKDLELKETELVSVFFRLKFSLRT |
| Ga0213865_105074892 | 3300021373 | Seawater | RVQEKELKEPERISLRTPKDLELKETELVSVFFRL |
| Ga0213864_102565062 | 3300021379 | Seawater | ELSNPPRIQEKEFKEPERISLRTPKDLELKETELVSVFFRLELA |
| Ga0213866_100076181 | 3300021425 | Seawater | IQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFITLEI |
| Ga0213866_100388523 | 3300021425 | Seawater | LKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0213866_105852963 | 3300021425 | Seawater | RVQEKELKEPERISLRTPKDLELKETELASVFFRLEFSLRL |
| Ga0213866_105990691 | 3300021425 | Seawater | RVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLSLQLSN |
| Ga0222718_103648872 | 3300021958 | Estuarine Water | QEKEFKEPERISLRTPKDLELKETELVSVFFRLEFSLRI |
| Ga0255775_10091661 | 3300022907 | Salt Marsh | RVQEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0255775_12677842 | 3300022907 | Salt Marsh | DKKELSNPPRIQEKEFKEPERISLRTPKDLELKETELASVFFRLEFGL |
| Ga0255755_10405601 | 3300022909 | Salt Marsh | RVQEKELKEPERISLRTPKELELKETELASVFFRLEFSIKLQLFY |
| Ga0255755_10726804 | 3300022909 | Salt Marsh | VQEKELKEPERISLRTPKDLELKETELVSVFFRLEFGL |
| Ga0255755_11257691 | 3300022909 | Salt Marsh | LSNPPRIQEKEFKEPEKISLWTPKDLELKETELVSVFFRL |
| Ga0255755_13412951 | 3300022909 | Salt Marsh | QEKELEEPERISLRTPKELELKETELASVFFRLEFSLSI |
| Ga0255765_10145616 | 3300022921 | Salt Marsh | KELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFNLRI |
| Ga0255765_11849541 | 3300022921 | Salt Marsh | EFKEPEKISLRTPKELELKETELVSVFFRLKFDFASLRI |
| Ga0255765_12806172 | 3300022921 | Salt Marsh | KELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRL |
| Ga0255765_13241161 | 3300022921 | Salt Marsh | KKELSNPPRVQEKELKEPEKISLWTPKDLELKETELVSVFFRLKFNPRI |
| Ga0255783_100065141 | 3300022923 | Salt Marsh | PRVLEKELKEPERISLRTPKDLELKETELVSVFFRLK |
| Ga0255783_100365531 | 3300022923 | Salt Marsh | RIQEKEFKEPEKISLWTPKDLELKETELVSVFFRL |
| Ga0255783_103531231 | 3300022923 | Salt Marsh | PPRVQEKELKEPERISLRTPKDLELKETELVSVFFWLKLTK |
| Ga0255773_101034501 | 3300022925 | Salt Marsh | PRIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFEITSLKI |
| Ga0255773_101334072 | 3300022925 | Salt Marsh | QEKELKEPEKISLWTPKDLELKETELVSVFFRLKFNPRI |
| Ga0255753_10978683 | 3300022926 | Salt Marsh | RVQEKELEEPERISLRTPKDLELKETELASVFFRLEFSLRL |
| Ga0255753_11957702 | 3300022926 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFLLKIN |
| Ga0255769_101304831 | 3300022927 | Salt Marsh | EFKEPEKISLRTPKELELKETELVSVFFRLKFEITSLKI |
| Ga0255769_103144881 | 3300022927 | Salt Marsh | SNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFRLEFNLRI |
| Ga0255769_103889752 | 3300022927 | Salt Marsh | KELSNPPRVQEKELKEPERISLRTPKDLELKETELASVFFRLEFGL |
| Ga0255758_100052061 | 3300022928 | Salt Marsh | PPRVQEKELKEPERISLRTPKELELKETELASVFFRLEFSLRI |
| Ga0255758_103013361 | 3300022928 | Salt Marsh | PPRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0255752_101794792 | 3300022929 | Salt Marsh | RIQEKEFKEPEKISLRTPKELELKETELVSVFFRLKFITLEI |
| Ga0255754_102446711 | 3300022939 | Salt Marsh | RNPPRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0255754_103951341 | 3300022939 | Salt Marsh | RVQEKELKEPERISLRTPKELELKETELVSVFFCLK |
| Ga0255764_103705171 | 3300023081 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFLAKIN |
| Ga0255751_100929691 | 3300023116 | Salt Marsh | KKELSNPPRVQEKELKEPERISLRTPKDLELKETELVSVFFCLK |
| Ga0255762_100306365 | 3300023119 | Salt Marsh | PRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRT |
| Ga0255762_101986262 | 3300023119 | Salt Marsh | KEVKEPEKISLRTPKELELKETELVSVFFRLKFTNLKI |
| Ga0255762_104656061 | 3300023119 | Salt Marsh | PPRVQEKELKEPERISLRTPKELELKETELVSVFFCLK |
| Ga0255759_100137461 | 3300023178 | Salt Marsh | PPRVQEKELKEPERISLRTPKELELKETELVSVFFRLEFSLRL |
| Ga0255759_101983091 | 3300023178 | Salt Marsh | PRVQEKELKEPERISLRTPKELELKETELASVFFCLK |
| Ga0255759_104243261 | 3300023178 | Salt Marsh | PPRVQEKELKEPERISLRTPKELELKETELASVFFWLKLTK |
| Ga0209359_100062991 | 3300027830 | Marine | PPRIQEKEFKEPERISLRTPKDLELKETELVSVFFRL |
| Ga0209359_100583821 | 3300027830 | Marine | VRDKKELVNPPRIQEKGFEELKKISLWTPEELELKETELVSVFFRLA |
| ⦗Top⦘ |