


| Basic Information | |
|---|---|
| Family ID | F044109 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AVGEEYMVERTISVHEDLPALAANLFKLRHKLLEIAGWQGE |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.19 % |
| % of genes near scaffold ends (potentially truncated) | 86.45 % |
| % of genes from short scaffolds (< 2000 bps) | 83.23 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.903 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (18.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.871 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.161 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF05239 | PRC | 4.52 |
| PF13545 | HTH_Crp_2 | 4.52 |
| PF07690 | MFS_1 | 2.58 |
| PF00072 | Response_reg | 1.94 |
| PF08281 | Sigma70_r4_2 | 1.29 |
| PF04909 | Amidohydro_2 | 1.29 |
| PF06745 | ATPase | 1.29 |
| PF13340 | DUF4096 | 1.29 |
| PF06114 | Peptidase_M78 | 1.29 |
| PF01555 | N6_N4_Mtase | 0.65 |
| PF04392 | ABC_sub_bind | 0.65 |
| PF11752 | DUF3309 | 0.65 |
| PF04120 | Iron_permease | 0.65 |
| PF00583 | Acetyltransf_1 | 0.65 |
| PF03734 | YkuD | 0.65 |
| PF17167 | Glyco_hydro_36 | 0.65 |
| PF05717 | TnpB_IS66 | 0.65 |
| PF13439 | Glyco_transf_4 | 0.65 |
| PF13602 | ADH_zinc_N_2 | 0.65 |
| PF04542 | Sigma70_r2 | 0.65 |
| PF04966 | OprB | 0.65 |
| PF03729 | DUF308 | 0.65 |
| PF13565 | HTH_32 | 0.65 |
| PF00665 | rve | 0.65 |
| PF00982 | Glyco_transf_20 | 0.65 |
| PF03448 | MgtE_N | 0.65 |
| PF01227 | GTP_cyclohydroI | 0.65 |
| PF12706 | Lactamase_B_2 | 0.65 |
| PF13581 | HATPase_c_2 | 0.65 |
| PF09913 | DUF2142 | 0.65 |
| PF06035 | Peptidase_C93 | 0.65 |
| PF05974 | DUF892 | 0.65 |
| PF02272 | DHHA1 | 0.65 |
| PF00813 | FliP | 0.65 |
| PF06823 | DUF1236 | 0.65 |
| PF01594 | AI-2E_transport | 0.65 |
| PF01272 | GreA_GreB | 0.65 |
| PF02310 | B12-binding | 0.65 |
| PF03575 | Peptidase_S51 | 0.65 |
| PF12762 | DDE_Tnp_IS1595 | 0.65 |
| PF10017 | Methyltransf_33 | 0.65 |
| PF08241 | Methyltransf_11 | 0.65 |
| PF12850 | Metallophos_2 | 0.65 |
| PF00487 | FA_desaturase | 0.65 |
| PF07813 | LTXXQ | 0.65 |
| PF05973 | Gp49 | 0.65 |
| PF13442 | Cytochrome_CBB3 | 0.65 |
| PF01047 | MarR | 0.65 |
| PF04545 | Sigma70_r4 | 0.65 |
| PF13542 | HTH_Tnp_ISL3 | 0.65 |
| PF09849 | DUF2076 | 0.65 |
| PF01425 | Amidase | 0.65 |
| PF00817 | IMS | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.58 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.65 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.65 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.65 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.65 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.65 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.65 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.65 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.65 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.65 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.65 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.65 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.65 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.65 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.65 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.65 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.65 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.65 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.65 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.65 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.90 % |
| Unclassified | root | N/A | 7.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001383|JGI20194J14741_1003268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 2309 | Open in IMG/M |
| 3300001402|JGI20195J14853_1003279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5105 | Open in IMG/M |
| 3300001402|JGI20195J14853_1013286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1842 | Open in IMG/M |
| 3300001412|JGI20173J14856_1017403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1204 | Open in IMG/M |
| 3300001545|JGI12630J15595_10032127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1082 | Open in IMG/M |
| 3300001661|JGI12053J15887_10060810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2099 | Open in IMG/M |
| 3300001867|JGI12627J18819_10057722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1617 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100289261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1523 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10216697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300004080|Ga0062385_10272311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 956 | Open in IMG/M |
| 3300004080|Ga0062385_10731017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300004082|Ga0062384_100642295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300004092|Ga0062389_101012117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1016 | Open in IMG/M |
| 3300004635|Ga0062388_101076307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300005176|Ga0066679_10749769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300005439|Ga0070711_101517740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300005542|Ga0070732_10276802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1006 | Open in IMG/M |
| 3300005591|Ga0070761_10108575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1604 | Open in IMG/M |
| 3300005591|Ga0070761_10447047 | Not Available | 793 | Open in IMG/M |
| 3300005993|Ga0080027_10333891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300006028|Ga0070717_10173958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1874 | Open in IMG/M |
| 3300006028|Ga0070717_11062149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300006055|Ga0097691_1002561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12027 | Open in IMG/M |
| 3300006086|Ga0075019_10157910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1328 | Open in IMG/M |
| 3300006162|Ga0075030_100046971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3620 | Open in IMG/M |
| 3300006173|Ga0070716_100479849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300006174|Ga0075014_100666945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300006175|Ga0070712_100055964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2765 | Open in IMG/M |
| 3300006358|Ga0068871_101330177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300006638|Ga0075522_10002024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 15229 | Open in IMG/M |
| 3300006638|Ga0075522_10288625 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006642|Ga0075521_10132233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. | 1163 | Open in IMG/M |
| 3300006844|Ga0075428_100196639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2180 | Open in IMG/M |
| 3300006880|Ga0075429_100591022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 973 | Open in IMG/M |
| 3300006880|Ga0075429_101734672 | Not Available | 542 | Open in IMG/M |
| 3300006893|Ga0073928_10893211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300006949|Ga0075528_10090365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 803 | Open in IMG/M |
| 3300007265|Ga0099794_10674177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300009137|Ga0066709_101664103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 908 | Open in IMG/M |
| 3300009176|Ga0105242_13170585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300009762|Ga0116130_1162923 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010046|Ga0126384_11194850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300010343|Ga0074044_10151168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300010360|Ga0126372_10966345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 860 | Open in IMG/M |
| 3300010376|Ga0126381_104253009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300010379|Ga0136449_101581572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
| 3300010398|Ga0126383_10833729 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300010400|Ga0134122_13390165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300010880|Ga0126350_10400682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 751 | Open in IMG/M |
| 3300011120|Ga0150983_13010365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300011120|Ga0150983_13301255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300011270|Ga0137391_10335454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1300 | Open in IMG/M |
| 3300011415|Ga0137325_1041437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300012019|Ga0120139_1076150 | Not Available | 823 | Open in IMG/M |
| 3300012096|Ga0137389_11027801 | Not Available | 706 | Open in IMG/M |
| 3300012200|Ga0137382_10939195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300012202|Ga0137363_10181355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1677 | Open in IMG/M |
| 3300012205|Ga0137362_11151205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300012205|Ga0137362_11481454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300012359|Ga0137385_11084715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300012361|Ga0137360_10175000 | Not Available | 1721 | Open in IMG/M |
| 3300012361|Ga0137360_11281343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300012362|Ga0137361_10225935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1699 | Open in IMG/M |
| 3300012362|Ga0137361_11786463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300012683|Ga0137398_10175789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1402 | Open in IMG/M |
| 3300012918|Ga0137396_11103417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300012922|Ga0137394_11343243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300012957|Ga0164303_10445955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 813 | Open in IMG/M |
| 3300012960|Ga0164301_11671778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300012989|Ga0164305_10042553 | All Organisms → cellular organisms → Bacteria | 2596 | Open in IMG/M |
| 3300013766|Ga0120181_1015684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2025 | Open in IMG/M |
| 3300014200|Ga0181526_10462464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 804 | Open in IMG/M |
| 3300014490|Ga0182010_10383680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300014501|Ga0182024_10248426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2388 | Open in IMG/M |
| 3300014501|Ga0182024_11794186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 687 | Open in IMG/M |
| 3300014501|Ga0182024_11795185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
| 3300014502|Ga0182021_11463281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300014638|Ga0181536_10028253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4256 | Open in IMG/M |
| 3300014823|Ga0120170_1107198 | Not Available | 562 | Open in IMG/M |
| 3300015242|Ga0137412_11136019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300015245|Ga0137409_10370802 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300016341|Ga0182035_12092923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300017946|Ga0187879_10247242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 994 | Open in IMG/M |
| 3300018030|Ga0187869_10347125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300018044|Ga0187890_10274140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 948 | Open in IMG/M |
| 3300018061|Ga0184619_10028155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2352 | Open in IMG/M |
| 3300018076|Ga0184609_10037755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2017 | Open in IMG/M |
| 3300019786|Ga0182025_1035404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300019888|Ga0193751_1048330 | Not Available | 1849 | Open in IMG/M |
| 3300020579|Ga0210407_10499386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300020582|Ga0210395_11029041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300020582|Ga0210395_11099377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300020583|Ga0210401_11551802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300021178|Ga0210408_10299653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1282 | Open in IMG/M |
| 3300021178|Ga0210408_10729270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300021178|Ga0210408_10844602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300021180|Ga0210396_11710592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300021405|Ga0210387_10039229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3770 | Open in IMG/M |
| 3300021418|Ga0193695_1013788 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300021432|Ga0210384_10403156 | Not Available | 1232 | Open in IMG/M |
| 3300021432|Ga0210384_11191906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300021432|Ga0210384_11870506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300021474|Ga0210390_10009668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7896 | Open in IMG/M |
| 3300021510|Ga0222621_1007064 | Not Available | 2033 | Open in IMG/M |
| 3300022712|Ga0242653_1066625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300022731|Ga0224563_1002787 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300025314|Ga0209323_10628838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300025324|Ga0209640_10365048 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300025457|Ga0208850_1004850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2894 | Open in IMG/M |
| 3300025457|Ga0208850_1052753 | Not Available | 673 | Open in IMG/M |
| 3300025475|Ga0208478_1041903 | Not Available | 883 | Open in IMG/M |
| 3300025484|Ga0208587_1016424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2457 | Open in IMG/M |
| 3300025484|Ga0208587_1028127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1624 | Open in IMG/M |
| 3300025505|Ga0207929_1094028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300025527|Ga0208714_1093229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300025544|Ga0208078_1002096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5135 | Open in IMG/M |
| 3300025544|Ga0208078_1015129 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300025544|Ga0208078_1120100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300025579|Ga0207927_1015942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2401 | Open in IMG/M |
| 3300025604|Ga0207930_1113904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300025650|Ga0209385_1098487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 952 | Open in IMG/M |
| 3300025664|Ga0208849_1003564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7392 | Open in IMG/M |
| 3300025725|Ga0209638_1076851 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300025829|Ga0209484_10061091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 833 | Open in IMG/M |
| 3300025852|Ga0209124_10048584 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300025852|Ga0209124_10202735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
| 3300025862|Ga0209483_1078725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1482 | Open in IMG/M |
| 3300025862|Ga0209483_1221292 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300026354|Ga0257180_1026083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300026377|Ga0257171_1058412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
| 3300026482|Ga0257172_1070802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300026496|Ga0257157_1036678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300026557|Ga0179587_11132983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300027625|Ga0208044_1042900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1479 | Open in IMG/M |
| 3300027729|Ga0209248_10043699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1382 | Open in IMG/M |
| 3300027737|Ga0209038_10035237 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300027829|Ga0209773_10017835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2766 | Open in IMG/M |
| 3300027842|Ga0209580_10390159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300027889|Ga0209380_10574718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300027903|Ga0209488_10045026 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300027903|Ga0209488_10840036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
| 3300028673|Ga0257175_1129017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300028708|Ga0307295_10168829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300028906|Ga0308309_10169023 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300030580|Ga0311355_11749529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300031057|Ga0170834_100132171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300031128|Ga0170823_11557266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300031344|Ga0265316_10330643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1106 | Open in IMG/M |
| 3300031525|Ga0302326_10312810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2500 | Open in IMG/M |
| 3300031708|Ga0310686_106869336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2120 | Open in IMG/M |
| 3300031708|Ga0310686_116373056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300031715|Ga0307476_10630085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300031912|Ga0306921_11601696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 708 | Open in IMG/M |
| 3300032076|Ga0306924_10922585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
| 3300033233|Ga0334722_11287231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 18.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.58% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.58% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.94% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.29% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.29% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.65% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.65% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001383 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001412 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20194J14741_10032683 | 3300001383 | Arctic Peat Soil | MVERTIIIHQDLPVLAANSLKLRHKPLEIAGRQGA* |
| JGI20195J14853_10032791 | 3300001402 | Arctic Peat Soil | HHRDDTAIGEEDMVERTISVHENLPALAANVFKLRHKSLEIAGWQGK* |
| JGI20195J14853_10132861 | 3300001402 | Arctic Peat Soil | YMVERTIIIHQDLPVLAANSLKLRHKPLEIAGRQGA* |
| JGI20173J14856_10174033 | 3300001412 | Arctic Peat Soil | AVRINRYHRDYTAVWEEYMVERTIGVHENLLALAANLFKLRHKLLEIAGWQGE* |
| JGI12630J15595_100321273 | 3300001545 | Forest Soil | MGEEDMVERTISVQENLLALAANVLKLRHESLEIAGWQGK* |
| JGI12053J15887_100608104 | 3300001661 | Forest Soil | VRIDRHRRDNTAVGEEYMIERTICVHQDLFALAVYLFKLPHKLLEIRR* |
| JGI12627J18819_100577221 | 3300001867 | Forest Soil | NDAAICVNRHHRDDTGIGEEDMIERTISVHRDLLAFAAYVFKLRHDLLEIGGWQGQ* |
| JGIcombinedJ26739_1002892614 | 3300002245 | Forest Soil | MIERTISVHQDLFAFAAYLFKLWHKLLXIGGWQSK* |
| JGIcombinedJ51221_102166971 | 3300003505 | Forest Soil | VDRHHRDDTAIGEEYMVERTISVHQDLPALAGNAFKLWHKPLEIAGRKGK* |
| Ga0062385_102723111 | 3300004080 | Bog Forest Soil | VRINRHRRDDTAVGEEYMIEGTVSVHQDLFAFTAYLCKLQQLKLLEIRGWQGEQKPIAGPV* |
| Ga0062385_107310171 | 3300004080 | Bog Forest Soil | RDDTAVGEEYMVERSISVHEDLRALAGNVFKLPHKPFEIAGR* |
| Ga0062384_1006422952 | 3300004082 | Bog Forest Soil | NAVCINRHRQDDTAVGEEYAIERTITVHQDLFAVAAYLFKLRHKLLEIGGWQGE* |
| Ga0062389_1010121171 | 3300004092 | Bog Forest Soil | HRDDTAVGEEYMVERTISVHKDLPAMAANVFKLRHKLLEIRGWQVE* |
| Ga0062388_1010763071 | 3300004635 | Bog Forest Soil | DAAVGEEYMIERTISVHQDQFALATDLFKLREKLLDIGGWQCQQ* |
| Ga0066679_107497691 | 3300005176 | Soil | EHIVERTIGIHQDLLALAGNMLKFRQELLEIAGWQGEQEAIAGPI* |
| Ga0070711_1015177401 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GEEDMVERTISVHENLPALAANVLELRHESLESTGWQGQ* |
| Ga0070732_102768022 | 3300005542 | Surface Soil | MVERTIGVQEDLPALAANMFKVRHEPLEIAGWQGE* |
| Ga0070761_101085753 | 3300005591 | Soil | GEEYMVERTISVHQDLCAFAVYLFKLRRKPLEIGGWQGE* |
| Ga0070761_104470472 | 3300005591 | Soil | MVERTISVHKDLPAMAANVFKLRHKLLEIGGWQGE |
| Ga0080027_103338911 | 3300005993 | Prmafrost Soil | REEYMIERTIGVHQDLLAFAANVFKLRHKPLEIAGWQGQ* |
| Ga0070717_101739586 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RINRHHRDDTAVGEEYMVERTVSVHQDLPALAAYLFKLRHKLFEIAGWQGEEKPVAGPI* |
| Ga0070717_110621491 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HRDDTAIGEEDMVERTISVHENLLALAANVLKLRHESLKIAGWQGK* |
| Ga0097691_100256122 | 3300006055 | Arctic Peat Soil | VRINRHHRDYTAVGEKYMVERTVSVGENLLALAANLFELRHKLLEIAGWQGE* |
| Ga0075019_101579103 | 3300006086 | Watersheds | EEYMVERTVGVHEDLPAMAANLFKLRHKLLEIAGRQGE* |
| Ga0075030_1000469718 | 3300006162 | Watersheds | HHRDNTAIGEVDVVERTVSIHEDLPALAADLFELRHESLEIAGWQGK* |
| Ga0070716_1004798492 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VRIDRHYRDDTAIGEVYVVERTISIHEDLPALAMNLFKLRHEPLEIGGWQGE* |
| Ga0075014_1006669453 | 3300006174 | Watersheds | VEWTIGIHQNLPAFAAYLFKLRHKLLEIGGGQGK* |
| Ga0070712_1000559644 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NRHRRDDTAIGKEYMVEWTISVHQDLLAFAVDVFKLRHKLLEIRGWQRE* |
| Ga0068871_1013301772 | 3300006358 | Miscanthus Rhizosphere | IGEKYLIERTISVHEDLASLAANMFKLRHQSLEIAGWQGK* |
| Ga0075522_1000202418 | 3300006638 | Arctic Peat Soil | MVERTISVHEDLLALAANVFKLRHKPLEIAGWKGE* |
| Ga0075522_102886251 | 3300006638 | Arctic Peat Soil | MSSSEANMVERTISVHENLLALAENMFKLWHESLEIAGWQSQ* |
| Ga0075521_101322332 | 3300006642 | Arctic Peat Soil | YHRDYTAVWEEDMVERTVGIHEDLSVLAANLFKLWHKLLEIAGWQGE* |
| Ga0075428_1001966395 | 3300006844 | Populus Rhizosphere | DMVERTISVHEDLPALATNVFQLRHESLEIAGWQGK* |
| Ga0075429_1005910223 | 3300006880 | Populus Rhizosphere | GEEYMVERTVSVHQDLPTLAWNLFKLRHKPLEIAGWQSE* |
| Ga0075429_1017346721 | 3300006880 | Populus Rhizosphere | AERTVGVDQDLLAFAGNLFKLRHELLEIAGWQGE* |
| Ga0073928_108932112 | 3300006893 | Iron-Sulfur Acid Spring | INRHHRDDTAIGEEDMIERTISVHQDLLAFAAYVFKLRHDLLEVGGWQGQ* |
| Ga0075528_100903651 | 3300006949 | Arctic Peat Soil | YVVERTISVHQNLLALAANVFKLWHEPLEIAGWQSK* |
| Ga0099794_106741772 | 3300007265 | Vadose Zone Soil | AIGKEYMVKWTISVHQDLLAFAADVFKLRHKLLEIGGWQGE* |
| Ga0066709_1016641031 | 3300009137 | Grasslands Soil | CRHDTAVGEKYMVERTIRIHQNLFAFAAYLFKPRHKLLEIGGWQGE* |
| Ga0105242_131705852 | 3300009176 | Miscanthus Rhizosphere | RDDTAIGEEYMVERTISVYENLFASAANVFKLRHESLQVAGWEGK* |
| Ga0116130_11629231 | 3300009762 | Peatland | DHGDDTAIWEKDMVERPISVHKDLSALAADLFQLRHESLEIAGWQGK* |
| Ga0126384_111948501 | 3300010046 | Tropical Forest Soil | EEYVIERIIGVHQDLFPFIAYLFKFRHQLLKIGRWQGK* |
| Ga0074044_101511683 | 3300010343 | Bog Forest Soil | MVERTISIHQDLPAVAAYLLKLRHKLLEIGGWQGE* |
| Ga0126372_109663452 | 3300010360 | Tropical Forest Soil | RDDTAVEEEYAIERTISVHQDLFAVAAYLFKLRHKLLEIEGWQGE* |
| Ga0126381_1042530092 | 3300010376 | Tropical Forest Soil | RRNDTAIGKEYMVKRTIGVHQDLRAFAAYGFKLRHKLLEIGAWQSE* |
| Ga0136449_1015815721 | 3300010379 | Peatlands Soil | RDDTAVGEEYMVERTVGIHQNLTAFARYLLKLRHKLLEIGGGQGE* |
| Ga0126383_108337292 | 3300010398 | Tropical Forest Soil | DTAIREEYIVERTIGIHQDLLALAANMLKFRQKLPEIAGRQGE* |
| Ga0134122_133901651 | 3300010400 | Terrestrial Soil | MAVRVNCNYRDDPAIGEEDMLERTVSVHENLLGLAANVFELRHKPL |
| Ga0126350_104006821 | 3300010880 | Boreal Forest Soil | MVERTVGVHQDLRAFAANAFKLRHKLPEVGGWQGQ* |
| Ga0150983_130103651 | 3300011120 | Forest Soil | HTAIGEEYMVERTISVHQDLRALAANLFKLRHKPLKIAGGQR* |
| Ga0150983_133012552 | 3300011120 | Forest Soil | RINRHRRDDTAVGEEYMVERTISVHQDLGAFTMYMFKLRHKLLEIGGWQSE* |
| Ga0137391_103354542 | 3300011270 | Vadose Zone Soil | VERTISVHENLLALAANVFKLWHEPLEIAGWKGEQ* |
| Ga0137325_10414371 | 3300011415 | Soil | TAVREEHMVERTIGVHEDLPALAANLFKVWHKPLEIGGWQGE* |
| Ga0120139_10761501 | 3300012019 | Permafrost | YMVERPIIIHQDLPVLAANSLKLRHKPLEIAGWQGA* |
| Ga0137389_110278012 | 3300012096 | Vadose Zone Soil | IGEEDMVERTISVHQDLPALAWNVFKLRHKQLEIAGWKGE* |
| Ga0137382_109391951 | 3300012200 | Vadose Zone Soil | EDIVDRAISVQQDLLALAANVFKLQHKSLQIAGWQGE* |
| Ga0137363_101813554 | 3300012202 | Vadose Zone Soil | MVERTISVHQDLLAVAGDVFKMRHKPPQIAGRQSE* |
| Ga0137362_111512051 | 3300012205 | Vadose Zone Soil | DTAVGEKYMVERTIGIHQNLFAFAAYLFKPRHKLLEIGGWQGE* |
| Ga0137362_114814541 | 3300012205 | Vadose Zone Soil | NGATVGVNGHDRDDTAIREEYIVERTIGIHQDLLALAANMLKFRQKLLEIAGWQGE* |
| Ga0137385_110847151 | 3300012359 | Vadose Zone Soil | AIGQEYMVERTISVDQKLPALAWNVFKLRQNLLEIAGWQGE* |
| Ga0137360_101750001 | 3300012361 | Vadose Zone Soil | YMIERTISIHQDLFAFAAYLFKLRYKLVEIGGWQGE* |
| Ga0137360_112813432 | 3300012361 | Vadose Zone Soil | GEEYMIERTISIHQDLFAFAVYVFQLRHKLLEIGGWQGE* |
| Ga0137361_102259351 | 3300012362 | Vadose Zone Soil | INRHRRDDTAVGEEYMIERTISIHQDLFAFAAYLFKLRYKLLEIGGWQGE* |
| Ga0137361_117864632 | 3300012362 | Vadose Zone Soil | DRCHLNDAAVCINRHRRDDTTIGKEYMVKWTISVHQDLLAFAVDVFKLRHKLLEIGGWQGE* |
| Ga0137398_101757892 | 3300012683 | Vadose Zone Soil | DDTAIREEYIVERTIGIHQDLLALAANGLKFRQKLLEIAGWQGE* |
| Ga0137396_111034171 | 3300012918 | Vadose Zone Soil | INRYHRDYTAVWEEYMVERTVGVHEDLPALAANLFKLRHKLFEIAGWQGE* |
| Ga0137394_113432432 | 3300012922 | Vadose Zone Soil | TIGEEYMVERTISVHQDLLAAAGNALKVRHKPLEIAGRQSE* |
| Ga0164303_104459552 | 3300012957 | Soil | EEYMVERTISVHQDLRPLAANVFKLRHESIEIAGWQGK* |
| Ga0164301_116717782 | 3300012960 | Soil | RDDTAIGEEYMVERTIGVHQDLRAMAADVFKLRHKPLEISGGQRE* |
| Ga0164305_100425533 | 3300012989 | Soil | MVERTISVHEHLPTVAANVLKLWHESLEIAGWQGK* |
| Ga0120181_10156843 | 3300013766 | Permafrost | EEDMVERTIIIHQDLSVLAANSLQLRHKPLEIAGWQGE* |
| Ga0181526_104624642 | 3300014200 | Bog | GEEYMVERTISIHQDLLALAANVFKLRQKPLEIGGWQGE* |
| Ga0182010_103836802 | 3300014490 | Fen | EEYIVERTVSVHEDLLALAANLFELRHKLLEIAGWQGE* |
| Ga0182024_102484261 | 3300014501 | Permafrost | IDRHHRDHTAIWKEDMVERTVSVHEDLLAMATNVFKLRQNPLEIADWKGE* |
| Ga0182024_117941861 | 3300014501 | Permafrost | RDHTAIGEEDMVERTISVHEDLLALAANVFELRHKPLEIAGWQGQ* |
| Ga0182024_117951851 | 3300014501 | Permafrost | DRHHRDDTVVGEEYMVERAIGVQEDLPAVAANLFKLRHKPLEIGGWQGK* |
| Ga0182021_114632811 | 3300014502 | Fen | TAVGEEYIVERTVSVHEDLLALAANVFELRHKPLEIAGWKGE* |
| Ga0181536_100282534 | 3300014638 | Bog | DDAVVGEVYMVERTVSVHQDLPASAGNLFKLRHEPLEIGGWQGE* |
| Ga0120170_11071981 | 3300014823 | Permafrost | NIVERAIDVQQDLTFLAGNLFKLRHKPLEIALWQSE* |
| Ga0137412_111360191 | 3300015242 | Vadose Zone Soil | AVRINRYHRDYTAVWEEYMVERTVGVHEDLPALAANLFKLRHKLFEIAGWQGE* |
| Ga0137409_103708022 | 3300015245 | Vadose Zone Soil | RHCGDDTAVGEEYMIERTISIQQDLFAFAAYLFKLRQKLLEIRRWQGE* |
| Ga0182035_120929232 | 3300016341 | Soil | HRRDDTAVEEEYAIERTISVHQDLFAVAAYLFKLRHKLLEIGGWQGE |
| Ga0187879_102472422 | 3300017946 | Peatland | VGEEYMVERTISIHQDLLALAANVFKLRQKPLEIGGWQGE |
| Ga0187869_103471251 | 3300018030 | Peatland | RHNRDDTTVGEEYMADRTISVHKDLFALAANVLKLRHKLLEIGGWQGQ |
| Ga0187890_102741401 | 3300018044 | Peatland | MVERTISVHEDLLALAANVFKLRHEPLEIAGWQGQ |
| Ga0184619_100281552 | 3300018061 | Groundwater Sediment | MVERTISVHENLIALAANVFKLRHELLEIAGWQGN |
| Ga0184609_100377554 | 3300018076 | Groundwater Sediment | AIGKEYMVERTIGVHQDLPALAWNVFKLRQKLLEIAGWQRE |
| Ga0182025_10354041 | 3300019786 | Permafrost | EKYMVERTVGVHEDLLALAANVFELRHKPLEIAGWKGE |
| Ga0193751_10483303 | 3300019888 | Soil | IGEVDMVERTIGVHENLPALAENVLKLWHEPFEFTGWKGEK |
| Ga0210407_104993861 | 3300020579 | Soil | MVKWTISVHQDLLAFTVDVFKLRHKLLEIRGWQRE |
| Ga0210395_110290411 | 3300020582 | Soil | EKEDMIERTVSVHQDLLAFAAYVFGLRHDLLEIGGRQGQ |
| Ga0210395_110993771 | 3300020582 | Soil | NNTAIREKDMVERTISLHENLRAAARNALKLRHEPLQIGGWQSEQ |
| Ga0210401_115518021 | 3300020583 | Soil | NRHRRDDTAVGEVYLVERTISIHQDLPAFAGYLLQLRHKLPEIGGWQGE |
| Ga0210408_102996531 | 3300021178 | Soil | RDNRDDTAIGEIDMVERTISVHENLPALAGNVLKLWHQELEIAGWQGK |
| Ga0210408_107292701 | 3300021178 | Soil | RRYRDDTAIEKEDMIERTVSVHQDLLAFAAYVFGLRHDLLEIGGRQGQ |
| Ga0210408_108446022 | 3300021178 | Soil | TVVGEEYMVERTISIHQDPPAFASYLLKLRHKLLEIGGRQGA |
| Ga0210396_117105921 | 3300021180 | Soil | DRWHLNDTAVRINRHRRDDTAVGEVYLVERTISIHQDLPAFAGYLLQLRHKLPEIGGWQG |
| Ga0210387_100392291 | 3300021405 | Soil | MVERTISIHQDLPAFAAYLLKLRHKLLETGGWQGE |
| Ga0193695_10137881 | 3300021418 | Soil | MSLERTIRIHQDLFAFAAYLFKLRHKLVKIGGWKGK |
| Ga0210384_104031561 | 3300021432 | Soil | DTAIGEEYMVERTISVHEDLPAQAGNLFKLRHEALEIAGWKGKQ |
| Ga0210384_111919062 | 3300021432 | Soil | YVVERTISVHQDLLALAAYLLKLRHKLLEIGGWQGE |
| Ga0210384_118705062 | 3300021432 | Soil | RRDDTAVGEEYVIERTISVHQDLFAFTAYLFKLRHKLLEIAGWQGE |
| Ga0210390_100096682 | 3300021474 | Soil | MVKRTISVHQDLPAVAAYLFNLRHQPFEIEGWQGE |
| Ga0222621_10070641 | 3300021510 | Groundwater Sediment | NTAIGEEDMVERTISVHENLIALAANVFKLRHELLEIAGWQGN |
| Ga0242653_10666252 | 3300022712 | Soil | INRHRRDDTAVGEVYLVERTISIHQDLPAFAGYLLQLRHKLPEIGGWQGE |
| Ga0224563_10027872 | 3300022731 | Soil | RRDDTAVGEEYMVERTISVHQDLCAFAAYLFKLRHKPLEIGEGQGK |
| Ga0209323_106288381 | 3300025314 | Soil | NRDHRDDTAIREEYMVERTIGVHQDLPALAVNLFKLRQKLLEIAGWQGE |
| Ga0209640_103650483 | 3300025324 | Soil | RINCHRRDDTAIGEEYMVERTVSVHEDLPAVAANLFKLRHEPLEIAGWEGE |
| Ga0208850_10048502 | 3300025457 | Arctic Peat Soil | MVERTISVHEDLLALAANVFKLRHKPLEIAGWKGE |
| Ga0208850_10527531 | 3300025457 | Arctic Peat Soil | GEEDMVDRTISIHKDLPVLAANLFKLRHKPLEITGWQGE |
| Ga0208478_10419031 | 3300025475 | Arctic Peat Soil | DHTAIGEEDMVERTVNVHEDLLALAANVFKLRHKPLEIAGWKGQ |
| Ga0208587_10164244 | 3300025484 | Arctic Peat Soil | HRYDTAIREEYVVERTISVQQNLLAFAANLFKLWHESLEIAGWQGK |
| Ga0208587_10281271 | 3300025484 | Arctic Peat Soil | RDYTAVGEEYMVERTVSVHEDLLALAANLFKLRHKLLEIAGWQGE |
| Ga0207929_10940281 | 3300025505 | Arctic Peat Soil | MSSSEANMVERTISVHENLLALAENMFKLWHESLEIAGWQSQ |
| Ga0208714_10932291 | 3300025527 | Arctic Peat Soil | NRYHRDYTAVWEEYMVERTVGVHEDLSALAANLFKLRHKLLEIAGWQGE |
| Ga0208078_10020968 | 3300025544 | Arctic Peat Soil | YVVERTISVQQNLLAFAANLFKLWHESLEIAGSQG |
| Ga0208078_10151291 | 3300025544 | Arctic Peat Soil | YVVERTISVQQNLLAFAANLFKLWHESLEIAGWQGK |
| Ga0208078_11201001 | 3300025544 | Arctic Peat Soil | HRDYTAVWEEYMVEQTVGVHEDLLALAPNLFKLRPKLLEIAGW |
| Ga0207927_10159421 | 3300025579 | Arctic Peat Soil | YMVERTVGVHEDLRALAANLFKLRHKLLEIAGWQGE |
| Ga0207930_11139041 | 3300025604 | Arctic Peat Soil | AIGEEDMVERTVSVQEDLLALAANVFKLRHKPLEIAGWKGQ |
| Ga0209385_10984872 | 3300025650 | Arctic Peat Soil | HRRDHTAIGEEDMVERTVSVHEDLLALAANVFKLRHKPLEIAGWKGQ |
| Ga0208849_10035642 | 3300025664 | Arctic Peat Soil | MVERTISVHENLLALAENMFKLWHESLEIAGWQSQ |
| Ga0209638_10768511 | 3300025725 | Arctic Peat Soil | EEDMVERTVSVHEDLLALAANVFKLRHKPLEIAGWKGQ |
| Ga0209484_100610913 | 3300025829 | Arctic Peat Soil | YVVERTISVHQNLLALAANVFKLWHEPLEIAGWQSK |
| Ga0209124_100485842 | 3300025852 | Arctic Peat Soil | EEYMVERTIIIHQDLPVLAANSLKLRHKPLEIAGRQGA |
| Ga0209124_102027351 | 3300025852 | Arctic Peat Soil | SGKKYMVRTVSVGENLLALAANLFELRHKLLEIAGWQGE |
| Ga0209483_10787254 | 3300025862 | Arctic Peat Soil | VGEEHMIERTISVHQDLLALAANVFKLRHESLEIAGWQGE |
| Ga0209483_12212922 | 3300025862 | Arctic Peat Soil | MSSSEANMVERTISVHENLLALAENMFKLWHESLEIAGRQSQ |
| Ga0257180_10260831 | 3300026354 | Soil | MIERTISIHQDLFAFAAYLFKLRHKLLEIGGWQGE |
| Ga0257171_10584122 | 3300026377 | Soil | HRDDTAIGEVDMVERTISVHENLPALAENVLKLWHQELEIAGWQGKKKSIAGPI |
| Ga0257172_10708021 | 3300026482 | Soil | RHRRDDTAIGKEYMVKWTISVHQDLLAFAVDVFKLRHKLLEIRGWQRE |
| Ga0257157_10366781 | 3300026496 | Soil | CHLNDAAVCINRHRRDDTAIGKEYMVKWTISVHQDLLAFAVDVFKLRHKLLEIRGWQRE |
| Ga0179587_111329831 | 3300026557 | Vadose Zone Soil | AIGEEDMVERTISVREDLPALAADLLKLRHESFEIAGCQGK |
| Ga0208044_10429004 | 3300027625 | Peatlands Soil | INRHHRDDTAVGEEHVVERTVGVHQDLAPVAANLFKLRQKPLEIGGRQGKQKTITRPI |
| Ga0209248_100436993 | 3300027729 | Bog Forest Soil | TAVGEEYAIERTITVHQDLFAVAAYLFKLRHKLLEIGGWQGE |
| Ga0209038_100352371 | 3300027737 | Bog Forest Soil | DDTAVRVNRYRRNDTAVGEEYMIERTIGVHQDLFAFATYLFKLRDKLLQIGGR |
| Ga0209773_100178352 | 3300027829 | Bog Forest Soil | MIERTIGVHQDLFAVAADLFKLRDKLLEIGGRQGE |
| Ga0209580_103901592 | 3300027842 | Surface Soil | MTPLSGKNMVERTIGVQEDLPALAANMFKVRHEPLEIAGWQGE |
| Ga0209380_105747181 | 3300027889 | Soil | WEEYMVERTIGVHQDLPALAGNVFKLRHKPLEVAGGQGK |
| Ga0209488_100450263 | 3300027903 | Vadose Zone Soil | MVKWTISVHQDLLAFAVDVFKLRHKLLEIRGWQRE |
| Ga0209488_108400361 | 3300027903 | Vadose Zone Soil | GEEDMVERTISVHQHLPAVAANVLKLRHESLEIAGWQGK |
| Ga0257175_11290172 | 3300028673 | Soil | MIERTISIHQDLFAFAAYLFKLRYKLLEIGGWQGE |
| Ga0307295_101688291 | 3300028708 | Soil | DVAVRIDRDHRDNTAIGEEDMVERTISVHENLIALAANVFKLRHELLEIAGWQGN |
| Ga0308309_101690231 | 3300028906 | Soil | RDDTAMGEKDMVERTISVHENLPALAANVFKLRHELLEIAGRQGK |
| Ga0311355_117495291 | 3300030580 | Palsa | MVERAICVHEDPRALAANVFKLRHKPLEIAGRQSEQK |
| Ga0170834_1001321712 | 3300031057 | Forest Soil | GAEYVVERTISVHQDLRAFAAYLFKLRHKLLEIGGWQGE |
| Ga0170823_115572661 | 3300031128 | Forest Soil | AVGEEYMIERTISIHQDLFAFAAYLFKLRHKLLEIRRWQGE |
| Ga0265316_103306432 | 3300031344 | Rhizosphere | MVERTVGIHEDLSALAANLFKLWHKLLEIAGWQGE |
| Ga0302326_103128107 | 3300031525 | Palsa | EDMVERTVGIHQDLAALAKNMFKFWHELLEIGGGHGE |
| Ga0310686_1068693364 | 3300031708 | Soil | NRHHRDDTAVGEEYMFERAIGVHQDLLAFAAYPFKLWHKLLEIRRWQSK |
| Ga0310686_1163730562 | 3300031708 | Soil | AVRINRDHRDNTAVAEINMVERTISLHENLPALAANVLQLWHESFEIAGWQGN |
| Ga0307476_106300851 | 3300031715 | Hardwood Forest Soil | RDNTAVGKEYMVKRTISVHQDLPAFAAYLFNLRHQLFEIDGWQGE |
| Ga0306921_116016962 | 3300031912 | Soil | AAVRINRHRRDDTTVGEEYIIERTICIQQDLFAFAAYLFKLRDKLRKIGGWQGE |
| Ga0306924_109225852 | 3300032076 | Soil | HRRDDTTVGEEYIIERTICIQQDLFAFAAYLFKLRDKLRKIGGWQGE |
| Ga0334722_112872312 | 3300033233 | Sediment | AVGEEYMVERTISVHEDLPALAANLFKLRHKLLEIAGWQGE |
| ⦗Top⦘ |