


| Basic Information | |
|---|---|
| Family ID | F044102 |
| Family Type | Metagenome |
| Number of Sequences | 155 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RPNQALERTAARRVFTFQMIKTVSVEAELALGGGRSALSR |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.45 % |
| % of genes near scaffold ends (potentially truncated) | 72.90 % |
| % of genes from short scaffolds (< 2000 bps) | 85.16 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.194 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (30.323 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.419 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF14534 | DUF4440 | 7.74 |
| PF03544 | TonB_C | 3.23 |
| PF13302 | Acetyltransf_3 | 2.58 |
| PF12680 | SnoaL_2 | 1.94 |
| PF01872 | RibD_C | 1.94 |
| PF07883 | Cupin_2 | 1.94 |
| PF00702 | Hydrolase | 1.94 |
| PF00903 | Glyoxalase | 1.29 |
| PF02371 | Transposase_20 | 1.29 |
| PF01694 | Rhomboid | 1.29 |
| PF01663 | Phosphodiest | 1.29 |
| PF13720 | Acetyltransf_11 | 0.65 |
| PF10459 | Peptidase_S46 | 0.65 |
| PF07617 | DUF1579 | 0.65 |
| PF13091 | PLDc_2 | 0.65 |
| PF13561 | adh_short_C2 | 0.65 |
| PF07285 | DUF1444 | 0.65 |
| PF00293 | NUDIX | 0.65 |
| PF00583 | Acetyltransf_1 | 0.65 |
| PF05222 | AlaDh_PNT_N | 0.65 |
| PF02423 | OCD_Mu_crystall | 0.65 |
| PF07653 | SH3_2 | 0.65 |
| PF02578 | Cu-oxidase_4 | 0.65 |
| PF12796 | Ank_2 | 0.65 |
| PF01219 | DAGK_prokar | 0.65 |
| PF04461 | DUF520 | 0.65 |
| PF03475 | 3-alpha | 0.65 |
| PF02782 | FGGY_C | 0.65 |
| PF13673 | Acetyltransf_10 | 0.65 |
| PF01757 | Acyl_transf_3 | 0.65 |
| PF02517 | Rce1-like | 0.65 |
| PF01965 | DJ-1_PfpI | 0.65 |
| PF05658 | YadA_head | 0.65 |
| PF09350 | DJC28_CD | 0.65 |
| PF12681 | Glyoxalase_2 | 0.65 |
| PF14329 | DUF4386 | 0.65 |
| PF13964 | Kelch_6 | 0.65 |
| PF15580 | Imm53 | 0.65 |
| PF01510 | Amidase_2 | 0.65 |
| PF00202 | Aminotran_3 | 0.65 |
| PF13924 | Lipocalin_5 | 0.65 |
| PF13495 | Phage_int_SAM_4 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 3.23 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.94 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.94 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.29 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.29 |
| COG0818 | Diacylglycerol kinase | Lipid transport and metabolism [I] | 0.65 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.65 |
| COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.65 |
| COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 0.65 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.65 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.65 |
| COG4848 | YtpQ protein involved in methylglyoxal resistance, DUF1444/UPF0354 family | General function prediction only [R] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.19 % |
| Unclassified | root | N/A | 25.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17305261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2567 | Open in IMG/M |
| 2166559005|cont_contig24970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1162 | Open in IMG/M |
| 2189573000|GPBTN7E01ACPZP | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 501 | Open in IMG/M |
| 2228664021|ICCgaii200_c0950274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2413 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105332876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 624 | Open in IMG/M |
| 3300000890|JGI11643J12802_10933467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1765 | Open in IMG/M |
| 3300000955|JGI1027J12803_100277195 | Not Available | 875 | Open in IMG/M |
| 3300001545|JGI12630J15595_10030246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1121 | Open in IMG/M |
| 3300004480|Ga0062592_102547844 | Not Available | 515 | Open in IMG/M |
| 3300005172|Ga0066683_10502436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 740 | Open in IMG/M |
| 3300005172|Ga0066683_10670038 | Not Available | 619 | Open in IMG/M |
| 3300005175|Ga0066673_10483112 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005178|Ga0066688_10078154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1981 | Open in IMG/M |
| 3300005178|Ga0066688_10973564 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300005179|Ga0066684_10007649 | All Organisms → cellular organisms → Bacteria | 5025 | Open in IMG/M |
| 3300005180|Ga0066685_10230314 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300005180|Ga0066685_10998455 | Not Available | 553 | Open in IMG/M |
| 3300005186|Ga0066676_10584914 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005186|Ga0066676_10845429 | Not Available | 617 | Open in IMG/M |
| 3300005187|Ga0066675_10917033 | Not Available | 661 | Open in IMG/M |
| 3300005289|Ga0065704_10033152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 762 | Open in IMG/M |
| 3300005289|Ga0065704_10153320 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300005294|Ga0065705_10284465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1094 | Open in IMG/M |
| 3300005367|Ga0070667_102202342 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 519 | Open in IMG/M |
| 3300005439|Ga0070711_100461182 | Not Available | 1042 | Open in IMG/M |
| 3300005444|Ga0070694_101919553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → unclassified Thermoanaerobaculia → Thermoanaerobaculia bacterium | 506 | Open in IMG/M |
| 3300005445|Ga0070708_100347440 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300005445|Ga0070708_100918444 | Not Available | 822 | Open in IMG/M |
| 3300005447|Ga0066689_10047914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2279 | Open in IMG/M |
| 3300005451|Ga0066681_10626494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005451|Ga0066681_10774826 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300005451|Ga0066681_10789401 | Not Available | 574 | Open in IMG/M |
| 3300005467|Ga0070706_102107705 | Not Available | 510 | Open in IMG/M |
| 3300005518|Ga0070699_100967567 | Not Available | 780 | Open in IMG/M |
| 3300005518|Ga0070699_101622042 | Not Available | 593 | Open in IMG/M |
| 3300005540|Ga0066697_10211787 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1152 | Open in IMG/M |
| 3300005540|Ga0066697_10269507 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005553|Ga0066695_10481810 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 764 | Open in IMG/M |
| 3300005553|Ga0066695_10794052 | Not Available | 547 | Open in IMG/M |
| 3300005556|Ga0066707_10662739 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005566|Ga0066693_10122804 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005575|Ga0066702_10341387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 911 | Open in IMG/M |
| 3300005576|Ga0066708_10319374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300005598|Ga0066706_11172194 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005598|Ga0066706_11376107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
| 3300005617|Ga0068859_102118965 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005764|Ga0066903_100084438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4171 | Open in IMG/M |
| 3300005921|Ga0070766_10011975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4469 | Open in IMG/M |
| 3300006028|Ga0070717_10036143 | All Organisms → cellular organisms → Bacteria | 4004 | Open in IMG/M |
| 3300006031|Ga0066651_10175516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1130 | Open in IMG/M |
| 3300006031|Ga0066651_10530296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 624 | Open in IMG/M |
| 3300006032|Ga0066696_10394367 | Not Available | 903 | Open in IMG/M |
| 3300006034|Ga0066656_10143832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1486 | Open in IMG/M |
| 3300006034|Ga0066656_11107968 | Not Available | 509 | Open in IMG/M |
| 3300006046|Ga0066652_101263820 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
| 3300006173|Ga0070716_100879211 | All Organisms → cellular organisms → Bacteria → PVC group | 700 | Open in IMG/M |
| 3300006175|Ga0070712_100367240 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300006175|Ga0070712_101781821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300006794|Ga0066658_10205385 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300006797|Ga0066659_10855161 | Not Available | 757 | Open in IMG/M |
| 3300006797|Ga0066659_11003934 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006797|Ga0066659_11279279 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006797|Ga0066659_11340325 | Not Available | 597 | Open in IMG/M |
| 3300006800|Ga0066660_10341948 | Not Available | 1212 | Open in IMG/M |
| 3300006800|Ga0066660_10715242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_39_49 | 821 | Open in IMG/M |
| 3300006800|Ga0066660_11038488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 655 | Open in IMG/M |
| 3300006893|Ga0073928_10216565 | Not Available | 1487 | Open in IMG/M |
| 3300007076|Ga0075435_100070154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2860 | Open in IMG/M |
| 3300009012|Ga0066710_100255169 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300009012|Ga0066710_102220998 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 801 | Open in IMG/M |
| 3300009012|Ga0066710_102817803 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300009038|Ga0099829_10157169 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300009089|Ga0099828_10079596 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300009137|Ga0066709_100794280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1371 | Open in IMG/M |
| 3300009137|Ga0066709_102010217 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 801 | Open in IMG/M |
| 3300009137|Ga0066709_102293198 | Not Available | 740 | Open in IMG/M |
| 3300009137|Ga0066709_102558349 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300009137|Ga0066709_104389821 | Not Available | 515 | Open in IMG/M |
| 3300010048|Ga0126373_10294099 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1617 | Open in IMG/M |
| 3300010322|Ga0134084_10041376 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300010325|Ga0134064_10038905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1424 | Open in IMG/M |
| 3300010358|Ga0126370_12554997 | Not Available | 510 | Open in IMG/M |
| 3300010360|Ga0126372_10881515 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 895 | Open in IMG/M |
| 3300010376|Ga0126381_103206506 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 647 | Open in IMG/M |
| 3300012180|Ga0153974_1057187 | Not Available | 859 | Open in IMG/M |
| 3300012181|Ga0153922_1052225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 909 | Open in IMG/M |
| 3300012198|Ga0137364_11420773 | Not Available | 513 | Open in IMG/M |
| 3300012199|Ga0137383_10809718 | Not Available | 684 | Open in IMG/M |
| 3300012200|Ga0137382_10803676 | Not Available | 677 | Open in IMG/M |
| 3300012202|Ga0137363_10465850 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012203|Ga0137399_10000024 | All Organisms → cellular organisms → Bacteria | 45898 | Open in IMG/M |
| 3300012203|Ga0137399_10227955 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300012211|Ga0137377_11878074 | Not Available | 517 | Open in IMG/M |
| 3300012285|Ga0137370_10128105 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1452 | Open in IMG/M |
| 3300012350|Ga0137372_10282151 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300012354|Ga0137366_10797256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300012361|Ga0137360_11134211 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012361|Ga0137360_11643593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300012362|Ga0137361_11040709 | Not Available | 739 | Open in IMG/M |
| 3300012532|Ga0137373_10575865 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 851 | Open in IMG/M |
| 3300012685|Ga0137397_10659545 | Not Available | 778 | Open in IMG/M |
| 3300012922|Ga0137394_11054555 | Not Available | 674 | Open in IMG/M |
| 3300012923|Ga0137359_10044670 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3842 | Open in IMG/M |
| 3300012923|Ga0137359_11569032 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300012929|Ga0137404_10529035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1054 | Open in IMG/M |
| 3300012948|Ga0126375_10552764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 869 | Open in IMG/M |
| 3300012986|Ga0164304_11538221 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012988|Ga0164306_10812665 | Not Available | 754 | Open in IMG/M |
| 3300012989|Ga0164305_11807505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 552 | Open in IMG/M |
| 3300013102|Ga0157371_10536192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 867 | Open in IMG/M |
| 3300013296|Ga0157374_11276760 | Not Available | 756 | Open in IMG/M |
| 3300013307|Ga0157372_12348157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 612 | Open in IMG/M |
| 3300014154|Ga0134075_10091377 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1282 | Open in IMG/M |
| 3300015373|Ga0132257_101970782 | Not Available | 753 | Open in IMG/M |
| 3300015374|Ga0132255_101181137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1152 | Open in IMG/M |
| 3300016341|Ga0182035_10977740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
| 3300018051|Ga0184620_10015364 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300018058|Ga0187766_10425501 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300018073|Ga0184624_10156538 | Not Available | 1004 | Open in IMG/M |
| 3300018073|Ga0184624_10524854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Luteolibacter → Luteolibacter luteus | 513 | Open in IMG/M |
| 3300018433|Ga0066667_10615746 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300018468|Ga0066662_12001443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 606 | Open in IMG/M |
| 3300018482|Ga0066669_10054217 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2554 | Open in IMG/M |
| 3300018482|Ga0066669_11328746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300019879|Ga0193723_1013579 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300019887|Ga0193729_1000038 | All Organisms → cellular organisms → Bacteria | 61204 | Open in IMG/M |
| 3300019888|Ga0193751_1010129 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4991 | Open in IMG/M |
| 3300020006|Ga0193735_1023488 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1902 | Open in IMG/M |
| 3300020006|Ga0193735_1167522 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300021432|Ga0210384_10004754 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 15040 | Open in IMG/M |
| 3300025910|Ga0207684_10182062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1812 | Open in IMG/M |
| 3300025915|Ga0207693_11235525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300025929|Ga0207664_10850423 | Not Available | 820 | Open in IMG/M |
| 3300025986|Ga0207658_11797504 | Not Available | 559 | Open in IMG/M |
| 3300026342|Ga0209057_1082220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1359 | Open in IMG/M |
| 3300026508|Ga0257161_1135696 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026527|Ga0209059_1026769 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300026542|Ga0209805_1016240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3952 | Open in IMG/M |
| 3300026550|Ga0209474_10151243 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300027727|Ga0209328_10174807 | Not Available | 651 | Open in IMG/M |
| 3300027875|Ga0209283_10914615 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300028047|Ga0209526_10003631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 10506 | Open in IMG/M |
| 3300028536|Ga0137415_11186896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300028536|Ga0137415_11366517 | Not Available | 529 | Open in IMG/M |
| 3300028716|Ga0307311_10163949 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300028784|Ga0307282_10544091 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 564 | Open in IMG/M |
| 3300031231|Ga0170824_112514260 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 527 | Open in IMG/M |
| 3300031716|Ga0310813_10251165 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1473 | Open in IMG/M |
| 3300031753|Ga0307477_10019041 | All Organisms → cellular organisms → Bacteria | 4691 | Open in IMG/M |
| 3300031820|Ga0307473_10672662 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300031823|Ga0307478_11201001 | Not Available | 632 | Open in IMG/M |
| 3300031912|Ga0306921_10145308 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300031962|Ga0307479_10069789 | All Organisms → cellular organisms → Bacteria | 3393 | Open in IMG/M |
| 3300032180|Ga0307471_101575576 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300033412|Ga0310810_10885489 | Not Available | 787 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 30.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.29% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03538090 | 2088090014 | Soil | SPNIAIPPHDSSNQALERTVTRRVFTCQMIKTVSVEPELALGGGRSAYSR |
| cont_0970.00001830 | 2166559005 | Simulated | QTLERTAARRTFAFQMNKTVSAQAALDLSGRRSAWSR |
| N55_09839260 | 2189573000 | Grass Soil | MQGVYFSSAPNQALELTATRRVFTFQMIKRVSIAAELALGGGR |
| ICCgaii200_09502743 | 2228664021 | Soil | MQGVYFSSAPNQALELTATRRVFTFQMIKRVSIAAELALGSGRSACSR |
| INPhiseqgaiiFebDRAFT_1053328761 | 3300000364 | Soil | FSKMKSPNQALEATATRRALTFHMAKTVSVGATLALGGGRSALSR* |
| JGI11643J12802_109334673 | 3300000890 | Soil | MQGVYFSSAPNQALELTATRRVFTFQMIKRVSIAAELALGSGRSACSR* |
| JGI1027J12803_1002771953 | 3300000955 | Soil | MSDYGSNQALERTAARRTFTFYMIKTFSVAAMLALGGGRSAWSR* |
| JGI12630J15595_100302463 | 3300001545 | Forest Soil | MILPPNQALERTAARRVFTFQMIKTVPVETALALGGGRSAPSR* |
| Ga0062592_1025478441 | 3300004480 | Soil | NQIETPNQALELTVTRSVFTFQIIKTVSVEATLALGGGSSAPSR* |
| Ga0066683_105024362 | 3300005172 | Soil | NDASNQALERTATRRAFTFQMTKTVSVEAKPAEGGSRSALSR* |
| Ga0066683_106700382 | 3300005172 | Soil | KPSNQALERTATRCVFTFQMIKTVSVEAALASGGGRSAYSR* |
| Ga0066673_104831123 | 3300005175 | Soil | QKRCGGGTQNDASNQALERTATRRAFTFQMTKTVSVEAKPAEGGSRSAWSR* |
| Ga0066688_100781543 | 3300005178 | Soil | MSHLYQITPNQSLELTATRRVFTFHMIKTVSVKAELALASGGRSAPSR* |
| Ga0066688_109735642 | 3300005178 | Soil | MTVPPNTALELTATQHAFTFQMIKTVSVEAELALGGGSSALS |
| Ga0066684_100076497 | 3300005179 | Soil | MAHQSPNQVLERTAARDTFAFRMIKTVSIAARLVLGGDRSALSS* |
| Ga0066685_102303143 | 3300005180 | Soil | PNQALERTAARHAFTFQMIKQTSVKAKLPSGGDRSACSR* |
| Ga0066685_109984551 | 3300005180 | Soil | SNQALELTATRRVFIFHMIKTVSVGPTLALGGVSSALSR* |
| Ga0066676_105849142 | 3300005186 | Soil | VLVTVGRRPNQTLERTATRRMFTFQMIKTDSAEAKFADGGGRSAWSR* |
| Ga0066676_108454291 | 3300005186 | Soil | SNQALERTAARRKFTFQMIKTFSDAATLGSSGSRSAFSR* |
| Ga0066675_109170333 | 3300005187 | Soil | MRPNQALERTATRRAFTFHMIKTVSDEATLASGGGRSAFSR* |
| Ga0065704_100331522 | 3300005289 | Switchgrass Rhizosphere | MQGVYFSSAPNQALELTAXRRVFTFQMIKRVSIAAELALGGGXSACSR* |
| Ga0065704_101533201 | 3300005289 | Switchgrass Rhizosphere | YFSSAPNQALELTATRRVFTFQMIKRVSIAAELALGGGR* |
| Ga0065705_102844652 | 3300005294 | Switchgrass Rhizosphere | VVHHKTPNQTLERTAARRVFTFQMIETVSLEPTLATSVGRSALSR* |
| Ga0070667_1022023421 | 3300005367 | Switchgrass Rhizosphere | MTATPNQALDRTAARRVFTFQMIKTGSVAATLALGGGRSA |
| Ga0070711_1004611822 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MIATSASNQALERTAARRAFTFQMIKTVSVEAESAVSGGRSAWCR* |
| Ga0070694_1019195531 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TPNQALERTAARRAFVFQMIMTASVEAELAASGGRSACSR* |
| Ga0070708_1003474403 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTLNRPNQALERTAARRAFTFLLMKTVSPETELALSGGRSA |
| Ga0070708_1009184441 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAGDYTSRPNQVLERTAAQRVFTFQMIKTVSVEAMLASSGGRSAYSR* |
| Ga0066689_100479141 | 3300005447 | Soil | MRPNQALERTATRRMFTFQMIKIVSDKATLALGGGRSACSR* |
| Ga0066681_106264942 | 3300005451 | Soil | MTIETPNQALERTAARRMFTFHMIKPVSVAPTRTLVDGRSA |
| Ga0066681_107748261 | 3300005451 | Soil | PNQALERTAARRAFTFQMIETVSVEPEPALGGGRSANSR* |
| Ga0066681_107894012 | 3300005451 | Soil | SNQALELTATRRVFAFQMIKTVSVEAMLALGGGSLALSR* |
| Ga0070706_1021077052 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PNQALERTAARRVFTVQMIQTVSVEAMLGLGGGRSACFR* |
| Ga0070699_1009675672 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | RPNQALERTATRRVFTFAMTKTILVEAALALGGGRSACSR* |
| Ga0070699_1016220422 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PNQALERTATRRMFTFQMIKTFSIAAELALSSGRSAWSR* |
| Ga0066697_102117872 | 3300005540 | Soil | MRCETSENFHNRPNQALERTAARRVLTFQMIKAVSVEAGHVLGGGRSALSR* |
| Ga0066697_102695072 | 3300005540 | Soil | MISSIADRSNHSLERTAARRVFAFYMIKTISLAGTLALGGGRSAFSR* |
| Ga0066695_104818101 | 3300005553 | Soil | CGYGRVLVTVGRRPNQTLERTATRRMFIFQMIKTVSAEAKLADGGGSSSFSR* |
| Ga0066695_107940521 | 3300005553 | Soil | DASNQALERTATRRAFTFQMTKTVSVEPKPAEGGSRSALSR* |
| Ga0066707_106627392 | 3300005556 | Soil | MPPNQALELTATRRVFTFQMIKTVSVEATLALSGGSSAWSR* |
| Ga0066693_101228043 | 3300005566 | Soil | VTVGRRPNQTLERTATRRMFTLQMIKTVSAEAKLADGGGRSARSR* |
| Ga0066702_103413871 | 3300005575 | Soil | KLGKTFSLVSNEPNQALERTAARRAFTFQMIKTVSFEAELAVSDGRSAWSR* |
| Ga0066708_103193743 | 3300005576 | Soil | LKRTAARRVFTFQMIRTFSVEVALALGGGRSAYSR* |
| Ga0066706_111721942 | 3300005598 | Soil | MSLATNASNKSLELTATRRESTFQMIKTLSDTATLALGGGSSALSR* |
| Ga0066706_113761071 | 3300005598 | Soil | NRPNQALERTATRGVFTFQMIKMVSDKATLALGGGRSVCSR* |
| Ga0068859_1021189652 | 3300005617 | Switchgrass Rhizosphere | PNQALERTAARCVFTFQMIKTVSIAASLALGGGGSAWSR* |
| Ga0066903_1000844384 | 3300005764 | Tropical Forest Soil | MIDRPNQTLERTAARRAFTFQMIKTVSVEAELALGGGRSASSR* |
| Ga0070766_100119752 | 3300005921 | Soil | MKNGSNQTLELTATRRAFTFQMIKTLSVAATLAVGGGSSACSR* |
| Ga0070717_100361438 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MERTAARRVPTFQMIKTFSGKAERALSGGRSAWSR* |
| Ga0066651_101755161 | 3300006031 | Soil | PNQTLERTAARCAFTFQMIKIASIMTTLALGGGRSACSR* |
| Ga0066651_105302961 | 3300006031 | Soil | MRPNQTLERTAARCAFTFQMIKTVSLKATRALGGGRSALSR |
| Ga0066696_103943671 | 3300006032 | Soil | ERTATRRVFTFHMIETVSVEATPALGGARSAPSR* |
| Ga0066656_101438321 | 3300006034 | Soil | SNQALERTAARRALTIQMIERVSLAATLALGDGRSASSR* |
| Ga0066656_111079682 | 3300006034 | Soil | HHNASNQALERTATRRAFTFQMIKIVSVEAALALGGGRSAPSR* |
| Ga0066652_1012638201 | 3300006046 | Soil | GSNQALELTATRRMFTLQMVKTGSMKATLALGGGSSAFSR* |
| Ga0070716_1008792111 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RPNQALERTTARRAFTFQMIKTILIEATLALGGGRSAYSR* |
| Ga0070712_1003672403 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDKTRTMPNQSLELTATRRASTFQMTKTVPVKVMLALGGGRSAGSR* |
| Ga0070712_1017818212 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QALERTATRRAFMFHLIKTVSVAAMLALGGGRSPYSR* |
| Ga0066658_102053853 | 3300006794 | Soil | WPNQALERTAARRAFTFNMTKTLPARATPCVAGGRSGWSR* |
| Ga0066659_108551611 | 3300006797 | Soil | IEEVRPNHALERTATRRMFTFQMIKTASVEATLALAGGRSACSR* |
| Ga0066659_110039341 | 3300006797 | Soil | MPNQALERTAARRVFTFQVMKTFPNEPTRAPGGGRSA |
| Ga0066659_112792791 | 3300006797 | Soil | GSNQALELTATRRVFAFQMIKTVSVEAMLALGGGSLALSR* |
| Ga0066659_113403251 | 3300006797 | Soil | MFTPRDNFTLNGSNQALERTAARRAFTFQMIETVSVAATLALGGGRSACSR* |
| Ga0066660_103419482 | 3300006800 | Soil | MNRPNQALERTATRHVFTFQMIKTFSVKATLALGGGRSALSR* |
| Ga0066660_107152422 | 3300006800 | Soil | MSHLHQITPNQSLELTATRRVFTFHMIKTVSVKDELALA |
| Ga0066660_110384882 | 3300006800 | Soil | ELTASRRVFTFQMVKTVSIEVALALGGGSSAYSR* |
| Ga0073928_102165654 | 3300006893 | Iron-Sulfur Acid Spring | PNQALERTAARRVSMFHMIKTVSVEAALAPVSGRSALSR* |
| Ga0075435_1000701543 | 3300007076 | Populus Rhizosphere | MQGVYFSSAPNQALELSATRRVFTFQMIKRVSIAAELALGGGRSACSR* |
| Ga0066710_1002551691 | 3300009012 | Grasslands Soil | PSRPNQTLERTATRCVFTFHMIETVLIEANLALGSGRSAPSR |
| Ga0066710_1022209981 | 3300009012 | Grasslands Soil | QNDASNQALERTATRRAFTFQMTKTVSVEAKPAEGGSRSALSR |
| Ga0066710_1028178031 | 3300009012 | Grasslands Soil | QNDASNQALERTATRRAFTFQMTKTVSVEAKPAEGGSRSAWSR |
| Ga0099829_101571691 | 3300009038 | Vadose Zone Soil | LERTAARRVFTRQMTKTVLLEAELALGGGSSACSR* |
| Ga0099828_100795961 | 3300009089 | Vadose Zone Soil | LERTATRRDVTFQMIKTDSVEAKLSDGGGRSASSR* |
| Ga0066709_1007942801 | 3300009137 | Grasslands Soil | YKSPPPNQVLERTAAGRAFTFQMIKVVSIAATLALWGGRSAGFR* |
| Ga0066709_1020102171 | 3300009137 | Grasslands Soil | QNDASNQALERTATRRAFTFQMTKTVSVEAKPAEGGSRSALSR* |
| Ga0066709_1022931981 | 3300009137 | Grasslands Soil | ALERTATRRVFTFHTIETVSVEATSALGGARSAPSR* |
| Ga0066709_1025583493 | 3300009137 | Grasslands Soil | QNDASNQALERTATRRAFTFQMTKTVSVEAKPAEGGSRSAWSR* |
| Ga0066709_1043898211 | 3300009137 | Grasslands Soil | QALERTAARRAFTFQMIETLSVEAAPVVGGGRSACSR* |
| Ga0126373_102940993 | 3300010048 | Tropical Forest Soil | MKPEPNRAPELTAIRRVLTFQMIKTVSIEAMLAAGSGR |
| Ga0134084_100413763 | 3300010322 | Grasslands Soil | VGRRPNQTLERTATRRMFTLQMIKTVSAEAKLADGGGRSARSR* |
| Ga0134064_100389053 | 3300010325 | Grasslands Soil | LPNESMISSIADRSNHSLERTAARRVFAFYMIKTISLAGTLALGGGRSAFSR* |
| Ga0126370_125549971 | 3300010358 | Tropical Forest Soil | GATAARRAFLFEMIKTVSIEGTLALGGGRSACSR* |
| Ga0126372_108815151 | 3300010360 | Tropical Forest Soil | STRPNQALELTATGRAFTFQRMKLLSVEAPLALDGGSLSLSR* |
| Ga0126381_1032065061 | 3300010376 | Tropical Forest Soil | QTPNQALERTAVWRAFTFQMIKKVSPAATLVLGGGRSACSR* |
| Ga0153974_10571871 | 3300012180 | Attine Ant Fungus Gardens | SKFMWLSKSSNQAPERTATPRVFTFQKIKTVSVEAALAFGGGRSAFSR* |
| Ga0153922_10522253 | 3300012181 | Attine Ant Fungus Gardens | SNQALERTAARCAFTFPMIKTGSIGATLAPTGGRSAGSR* |
| Ga0137364_114207732 | 3300012198 | Vadose Zone Soil | GRVLVTVGRRPNQTLERTATRRMFTLQMIKTVSAEAKLADGGGRSAWSR* |
| Ga0137383_108097182 | 3300012199 | Vadose Zone Soil | ERTANRRAFAFQMIKTVSIEATLGVGGGRSALSR* |
| Ga0137382_108036761 | 3300012200 | Vadose Zone Soil | MISSIADRSNHSLERTAARRVFAFYMIKTISLAGTLALGGGRSAFS |
| Ga0137363_104658503 | 3300012202 | Vadose Zone Soil | MKDETETSNQSLERTAARRAFILQMIKTVLIQAKLAPGGGRSALSR* |
| Ga0137399_1000002443 | 3300012203 | Vadose Zone Soil | MNDNGSNQALERTATRRAFTFQMIKAFSVKAALALGGGRSACSR* |
| Ga0137399_102279551 | 3300012203 | Vadose Zone Soil | LELTATRRVFTRQITKTVLLEAELALGGGSSACLVR* |
| Ga0137377_118780741 | 3300012211 | Vadose Zone Soil | ERTATRRMFTLQMIKTVSAEAKLADGGGRSAWSR* |
| Ga0137370_101281051 | 3300012285 | Vadose Zone Soil | ALERTAAWRVFTFQMIKTVSVKAALALGGGRSACSR* |
| Ga0137372_102821512 | 3300012350 | Vadose Zone Soil | ALERTAARRVFAFYMIKTISLAGTLALCGGRSAFSR* |
| Ga0137366_107972561 | 3300012354 | Vadose Zone Soil | MWPNHALERTATRRVLTFHMTKTVSVGATLALGGGRSA |
| Ga0137360_111342111 | 3300012361 | Vadose Zone Soil | TLERTATRRMFTFQMIKTVSAEAKFADGGGRSAWSR* |
| Ga0137360_116435931 | 3300012361 | Vadose Zone Soil | QMTPPNNALERTATRRDVTFQMIKTDSVEAKLSDGGGRSASSR* |
| Ga0137361_110407091 | 3300012362 | Vadose Zone Soil | DVLRPPTSNQSLERTAARRMFTFHMIKTVSVEATLALGGGRSACSR* |
| Ga0137373_105758652 | 3300012532 | Vadose Zone Soil | ERTAARCAFTFQMIKTVSIEVTLALGGGRSAPSR* |
| Ga0137397_106595452 | 3300012685 | Vadose Zone Soil | EPNKALERTAARRMFTFHMIKPVSVAAALGLGGGRSALSR* |
| Ga0137394_110545552 | 3300012922 | Vadose Zone Soil | ALERTAARRAFTFQMIKTGLAKATLALGGGRSAFSR* |
| Ga0137359_100446704 | 3300012923 | Vadose Zone Soil | MHIETLHLHLPNQPLERTAARRVFILQMINAPSVVTTLACGGGRSAWSR* |
| Ga0137359_115690321 | 3300012923 | Vadose Zone Soil | TPPNNALERTATRRDVTFQMIKTDSVEAKLCDGGGRSASSR* |
| Ga0137404_105290351 | 3300012929 | Vadose Zone Soil | VSIPPIASNQALERTSARCAFTFQIIKTVSLQVPLAPSGGRSA |
| Ga0126375_105527641 | 3300012948 | Tropical Forest Soil | MTPNQALERTAARHVFTFQMIETVSVEAEFALGGGRSA* |
| Ga0164304_115382211 | 3300012986 | Soil | ALELTATRRVFTFQMIKTISVEATLALGGGSSAYSR* |
| Ga0164306_108126651 | 3300012988 | Soil | NHALERTAARRTFSFYMIKTVSALAVLAIGGGRSAWSR* |
| Ga0164305_118075052 | 3300012989 | Soil | MQGVYFSSAPNQALELTATRRVFTFQMIKRVSIAAELALGGGRPACSR* |
| Ga0157371_105361923 | 3300013102 | Corn Rhizosphere | MQGVYFSSAPNQALELTATRRVFTFQMIKRVSIAAE |
| Ga0157374_112767601 | 3300013296 | Miscanthus Rhizosphere | EKVAETPNQALERTAARRAFVCQMIMTASVEAELAASGGRSACSR* |
| Ga0157372_123481571 | 3300013307 | Corn Rhizosphere | VTRPNQALERTAARRAFTFQMIKTISLEATLAPVSGRSAWSR* |
| Ga0134075_100913771 | 3300014154 | Grasslands Soil | KALEQTAARRVFTFQMIKTVSVTVDFGGDRSTLSR* |
| Ga0132257_1019707821 | 3300015373 | Arabidopsis Rhizosphere | LERTATRRVFPFQMIKTISVQAAFAPGGGRSTLSR* |
| Ga0132255_1011811374 | 3300015374 | Arabidopsis Rhizosphere | LERTAARGTITLQMIKTVSIEATPALGGGRSAWSR* |
| Ga0182035_109777401 | 3300016341 | Soil | VMRHRRSNESLHLTAARRVFTFQMIKALSVATTLALDGGRSAT |
| Ga0184620_100153644 | 3300018051 | Groundwater Sediment | NQALERTATRRTLHFLMIKTVSVAVELGDGGGRSPCFR |
| Ga0187766_104255011 | 3300018058 | Tropical Peatland | QALEQTAARLALTFQMIKTVSVEATLALGDGRSACSR |
| Ga0184624_101565383 | 3300018073 | Groundwater Sediment | SNQALELTAARCAFTFQMIKTVSVEATLGPGGDSSACSR |
| Ga0184624_105248542 | 3300018073 | Groundwater Sediment | MFRSPPPNQALERTAARRVFTFEMIKTVSVEAKLA |
| Ga0066667_106157463 | 3300018433 | Grasslands Soil | MQPRERRNQALERIAAVRVFTFQMANTVSLETERALGGGRS |
| Ga0066662_120014432 | 3300018468 | Grasslands Soil | QALERTAARRAFTFLLIKTVSPEAELALSGGRSACSR |
| Ga0066669_100542172 | 3300018482 | Grasslands Soil | MISSIADRSNHALERTAARRVFAFYMIKTISLAGTLALGGGRSAFSR |
| Ga0066669_113287462 | 3300018482 | Grasslands Soil | PNQTLERTVTRRMFTFQMIKTVSAQAKLADGGGRSSFSR |
| Ga0193723_10135791 | 3300019879 | Soil | MQGVYFSSAPNQALELTATRRVFTFQMIKRVSIAAELALGGGRSACSR |
| Ga0193729_10000384 | 3300019887 | Soil | MRPNHVLERTAARRVFTFQMIKTVSVEATLAFGGGRSAFSR |
| Ga0193751_10101291 | 3300019888 | Soil | LHDESPNQTLERTAARRAFTFKMIETVSVEATLGFGSGRSALSR |
| Ga0193735_10234882 | 3300020006 | Soil | MNLMPPNHALQRTATRRVFTFPMIKTVSVAASLVLGGGR |
| Ga0193735_11675221 | 3300020006 | Soil | MRPNQALELTATPRAFTFQMIKTVSVEATLAPGGDS |
| Ga0210384_1000475413 | 3300021432 | Soil | MRSNHALQRTATRRVFTFRMIKTVLLDAVLGLGDGR |
| Ga0207684_101820621 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSNQALERTATRRTFTFQMTKTVSVEGEFAPGVGRSALSR |
| Ga0207693_112355251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ALERTATRRAFMFHLIKTVSVAAMLALGGGRSPYSR |
| Ga0207664_108504231 | 3300025929 | Agricultural Soil | LEPTAARCAFTFQMIKTVSLEATLALGGGRSAFSR |
| Ga0207658_117975041 | 3300025986 | Switchgrass Rhizosphere | MIATSASNQALERTAARRAFTFQMIKTVSVEAESAVSGGRSAWCR |
| Ga0209057_10822202 | 3300026342 | Soil | MISSIADRSNHSLERTAARRVFAFYMIKTISLAGTLALGGGRSAFSR |
| Ga0257161_11356961 | 3300026508 | Soil | RPNQALERTAARRVFTFQMIKTVSVEAELALGGGRSALSR |
| Ga0209059_10267693 | 3300026527 | Soil | MTPNQALERTAARRTFTFQMTKTISVEATLALGGGGSAYSR |
| Ga0209805_10162401 | 3300026542 | Soil | NQALELTATRRVFTFQMIKTVSVEAALGLGGGSSAYSR |
| Ga0209474_101512432 | 3300026550 | Soil | MTPNQALERTAARRTFTFQMTKTVSVEATLALGGGGSAYSR |
| Ga0209328_101748071 | 3300027727 | Forest Soil | VSGTTNNSSNQALDRTAARRVFTFQMIKTVSVEAACALGGGRS |
| Ga0209283_109146151 | 3300027875 | Vadose Zone Soil | LERTATRRDVTFQMIKTDSVEAKLSDGGGRSASSR |
| Ga0209526_100036315 | 3300028047 | Forest Soil | MILPPNQALERTAARRVFTFQMIKTVPVETALALGGGRSAPSR |
| Ga0137415_111868961 | 3300028536 | Vadose Zone Soil | QALERTATRRVFTLQMIKTVSVKAALALGGGSSACSR |
| Ga0137415_113665172 | 3300028536 | Vadose Zone Soil | MATNTPNQSLELTATRCVFTFQMIKTVSVKATLAAGGGS |
| Ga0307311_101639491 | 3300028716 | Soil | MGPNQALELTATPRAFTFQMIKTVSVEATLAPGGGS |
| Ga0307282_105440912 | 3300028784 | Soil | MAASHLNATPNQALERTATRRAFTFQMIKTVSVAATLALGDGRSA |
| Ga0170824_1125142602 | 3300031231 | Forest Soil | MTPDKALERTAARGTLALPMIKAVSAQTTLALGGGRSAFSR |
| Ga0310813_102511652 | 3300031716 | Soil | LERTAARRTFTFQMIKRFPIEAEHVVGGGRSAFSR |
| Ga0307477_100190416 | 3300031753 | Hardwood Forest Soil | MNDNGSNQALERIATRRAFTFQMIKKSSVKAALALGGRRSVLSR |
| Ga0307473_106726622 | 3300031820 | Hardwood Forest Soil | GPNQALELTAARRMFTFQMIKTVSPKATLALGGGRSAWSR |
| Ga0307478_112010012 | 3300031823 | Hardwood Forest Soil | MNDNGSNQALERIVTRRAFTFQMIKKSSVKAALALGGRRSVLSR |
| Ga0306921_101453085 | 3300031912 | Soil | MIDELRENRPNQSLERTAAAGVCSHFQMIKTVSVEATLALAGGRSA |
| Ga0307479_100697893 | 3300031962 | Hardwood Forest Soil | MAPNQSLERTATRDVFTLQMIKTVSVEATLALGGSSSALSR |
| Ga0307471_1015755761 | 3300032180 | Hardwood Forest Soil | MNCFPKRPNQALELTATRCVFTFQMIETVSIEATVALG |
| Ga0310810_108854892 | 3300033412 | Soil | MIRDVPNQSSFLTAARRAFAFQMIKTVLVAATLALGDGRSAWSR |
| ⦗Top⦘ |