


| Basic Information | |
|---|---|
| Family ID | F044097 |
| Family Type | Metagenome |
| Number of Sequences | 155 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSALVFIGIVAVLAWSLAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.57 % |
| % of genes near scaffold ends (potentially truncated) | 23.23 % |
| % of genes from short scaffolds (< 2000 bps) | 81.29 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.839 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.129 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.968 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.742 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 0.00% Coil/Unstructured: 50.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF00488 | MutS_V | 11.61 |
| PF06210 | DUF1003 | 8.39 |
| PF01520 | Amidase_3 | 7.74 |
| PF03445 | DUF294 | 3.23 |
| PF05190 | MutS_IV | 1.94 |
| PF02687 | FtsX | 0.65 |
| PF00072 | Response_reg | 0.65 |
| PF02616 | SMC_ScpA | 0.65 |
| PF03109 | ABC1 | 0.65 |
| PF13376 | OmdA | 0.65 |
| PF05192 | MutS_III | 0.65 |
| PF08335 | GlnD_UR_UTase | 0.65 |
| PF01425 | Amidase | 0.65 |
| PF01300 | Sua5_yciO_yrdC | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 14.19 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 11.61 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 8.39 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 7.74 |
| COG1391 | Glutamine synthetase adenylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 6.45 |
| COG2905 | Signal-transduction protein containing cAMP-binding, CBS, and nucleotidyltransferase domains | Signal transduction mechanisms [T] | 3.23 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.65 |
| COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.65 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.48 % |
| Unclassified | root | N/A | 4.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100077991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3069 | Open in IMG/M |
| 3300002568|C688J35102_120961723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3255 | Open in IMG/M |
| 3300002912|JGI25386J43895_10009365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2774 | Open in IMG/M |
| 3300002917|JGI25616J43925_10353617 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300003319|soilL2_10300137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1181 | Open in IMG/M |
| 3300005093|Ga0062594_101319627 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005167|Ga0066672_10206028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1255 | Open in IMG/M |
| 3300005171|Ga0066677_10052912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2036 | Open in IMG/M |
| 3300005171|Ga0066677_10422772 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005171|Ga0066677_10540784 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005176|Ga0066679_10005444 | All Organisms → cellular organisms → Bacteria | 5880 | Open in IMG/M |
| 3300005176|Ga0066679_10531121 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005177|Ga0066690_10183784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
| 3300005177|Ga0066690_10298421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300005177|Ga0066690_10715039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300005178|Ga0066688_10420270 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005179|Ga0066684_10189139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300005179|Ga0066684_11055201 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005181|Ga0066678_10144670 | Not Available | 1482 | Open in IMG/M |
| 3300005181|Ga0066678_10357753 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005184|Ga0066671_10017163 | All Organisms → cellular organisms → Bacteria | 3109 | Open in IMG/M |
| 3300005184|Ga0066671_10287012 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005184|Ga0066671_10294346 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005336|Ga0070680_101031935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300005406|Ga0070703_10257469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300005436|Ga0070713_101448052 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005445|Ga0070708_100023250 | All Organisms → cellular organisms → Bacteria | 5268 | Open in IMG/M |
| 3300005445|Ga0070708_100179644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1977 | Open in IMG/M |
| 3300005445|Ga0070708_100216828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1794 | Open in IMG/M |
| 3300005446|Ga0066686_10331690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300005446|Ga0066686_10429975 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300005450|Ga0066682_10776067 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005450|Ga0066682_10898568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300005458|Ga0070681_10061739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3722 | Open in IMG/M |
| 3300005529|Ga0070741_10011262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 16575 | Open in IMG/M |
| 3300005546|Ga0070696_100517907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300005552|Ga0066701_10280860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1032 | Open in IMG/M |
| 3300005556|Ga0066707_10794663 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005559|Ga0066700_10536604 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005561|Ga0066699_10109279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1836 | Open in IMG/M |
| 3300005566|Ga0066693_10434948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005575|Ga0066702_10281590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1015 | Open in IMG/M |
| 3300005898|Ga0075276_10160149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300006032|Ga0066696_10186831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1315 | Open in IMG/M |
| 3300006173|Ga0070716_101230576 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006755|Ga0079222_11348894 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006755|Ga0079222_11542680 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006796|Ga0066665_11301172 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006806|Ga0079220_10131970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1349 | Open in IMG/M |
| 3300006854|Ga0075425_101286301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300006854|Ga0075425_102271719 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300007255|Ga0099791_10024604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2609 | Open in IMG/M |
| 3300007255|Ga0099791_10041871 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300007255|Ga0099791_10106750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1292 | Open in IMG/M |
| 3300007255|Ga0099791_10609086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300007265|Ga0099794_10003284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 6141 | Open in IMG/M |
| 3300007265|Ga0099794_10018409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3132 | Open in IMG/M |
| 3300009012|Ga0066710_103456887 | Not Available | 599 | Open in IMG/M |
| 3300009038|Ga0099829_10157928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1814 | Open in IMG/M |
| 3300009088|Ga0099830_10149555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1795 | Open in IMG/M |
| 3300009088|Ga0099830_10154265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1768 | Open in IMG/M |
| 3300009088|Ga0099830_10495395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300009088|Ga0099830_10966645 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009089|Ga0099828_11149472 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009090|Ga0099827_11392325 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009137|Ga0066709_100017819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 6971 | Open in IMG/M |
| 3300009143|Ga0099792_10014331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3415 | Open in IMG/M |
| 3300009143|Ga0099792_10240172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1050 | Open in IMG/M |
| 3300009143|Ga0099792_10889409 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009162|Ga0075423_12872082 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009792|Ga0126374_10542479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300009792|Ga0126374_11215649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300010046|Ga0126384_11481127 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010159|Ga0099796_10425956 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300010336|Ga0134071_10174653 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300010371|Ga0134125_12371615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010403|Ga0134123_12695952 | Not Available | 565 | Open in IMG/M |
| 3300012096|Ga0137389_11270819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300012189|Ga0137388_11216462 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012202|Ga0137363_10393150 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300012203|Ga0137399_10470464 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300012205|Ga0137362_10271165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1467 | Open in IMG/M |
| 3300012205|Ga0137362_11300245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300012208|Ga0137376_10640488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 918 | Open in IMG/M |
| 3300012349|Ga0137387_10338414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1089 | Open in IMG/M |
| 3300012582|Ga0137358_10904106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300012683|Ga0137398_10167198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1436 | Open in IMG/M |
| 3300012683|Ga0137398_10287906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1102 | Open in IMG/M |
| 3300012918|Ga0137396_10066035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2518 | Open in IMG/M |
| 3300012922|Ga0137394_10005682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 9525 | Open in IMG/M |
| 3300012923|Ga0137359_11334746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300012924|Ga0137413_11289378 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300012925|Ga0137419_11410289 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300012927|Ga0137416_10410925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1149 | Open in IMG/M |
| 3300012930|Ga0137407_10090566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2599 | Open in IMG/M |
| 3300012944|Ga0137410_10123569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1945 | Open in IMG/M |
| 3300014166|Ga0134079_10297862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300015171|Ga0167648_1029068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1328 | Open in IMG/M |
| 3300015241|Ga0137418_10221282 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Russulales → Hericiaceae → Dentipellis → Dentipellis fragilis | 1623 | Open in IMG/M |
| 3300015241|Ga0137418_11057262 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300015357|Ga0134072_10342754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300018060|Ga0187765_10482808 | Not Available | 781 | Open in IMG/M |
| 3300018061|Ga0184619_10051519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1791 | Open in IMG/M |
| 3300018468|Ga0066662_11282960 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300018468|Ga0066662_12894443 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018482|Ga0066669_10062254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2422 | Open in IMG/M |
| 3300020170|Ga0179594_10047828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1435 | Open in IMG/M |
| 3300024317|Ga0247660_1028255 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300024330|Ga0137417_1145579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300025885|Ga0207653_10340732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300025907|Ga0207645_11004587 | Not Available | 565 | Open in IMG/M |
| 3300025910|Ga0207684_10110013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2359 | Open in IMG/M |
| 3300025910|Ga0207684_10486619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1058 | Open in IMG/M |
| 3300025915|Ga0207693_10673898 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300025939|Ga0207665_11464454 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300026285|Ga0209438_1119082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300026312|Ga0209153_1107580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1051 | Open in IMG/M |
| 3300026312|Ga0209153_1185963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300026312|Ga0209153_1276297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300026318|Ga0209471_1000881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 18711 | Open in IMG/M |
| 3300026329|Ga0209375_1312627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300026330|Ga0209473_1056971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1690 | Open in IMG/M |
| 3300026524|Ga0209690_1010748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4896 | Open in IMG/M |
| 3300026537|Ga0209157_1210801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300026550|Ga0209474_10718341 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026551|Ga0209648_10064461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3100 | Open in IMG/M |
| 3300026555|Ga0179593_1038677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1424 | Open in IMG/M |
| 3300027587|Ga0209220_1178152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300027643|Ga0209076_1058930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1090 | Open in IMG/M |
| 3300027643|Ga0209076_1100936 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300027643|Ga0209076_1147889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300027651|Ga0209217_1003531 | All Organisms → cellular organisms → Bacteria | 5185 | Open in IMG/M |
| 3300027655|Ga0209388_1109936 | Not Available | 789 | Open in IMG/M |
| 3300027663|Ga0208990_1021233 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300027671|Ga0209588_1006354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3431 | Open in IMG/M |
| 3300027671|Ga0209588_1066187 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300027678|Ga0209011_1168124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300027846|Ga0209180_10108564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1585 | Open in IMG/M |
| 3300027875|Ga0209283_10646936 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300027882|Ga0209590_10424673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300027903|Ga0209488_10018350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5080 | Open in IMG/M |
| 3300027903|Ga0209488_10372269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1060 | Open in IMG/M |
| 3300027903|Ga0209488_10406957 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300027903|Ga0209488_11175735 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028536|Ga0137415_11032322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300031720|Ga0307469_10195333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1574 | Open in IMG/M |
| 3300031740|Ga0307468_102573851 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031820|Ga0307473_10454633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 854 | Open in IMG/M |
| 3300031939|Ga0308174_10453424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1042 | Open in IMG/M |
| 3300032066|Ga0318514_10702710 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032180|Ga0307471_103749751 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300032205|Ga0307472_101439708 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032783|Ga0335079_10074755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3854 | Open in IMG/M |
| 3300032828|Ga0335080_11861767 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.29% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.65% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1000779912 | 3300002245 | Forest Soil | MSALVFIGIVAVLAWSLAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| C688J35102_1209617233 | 3300002568 | Soil | MSALVFVAAVALLAWSVARESARRRRWREAERLSRCLFAAAGLRRYRSRWAKS* |
| JGI25386J43895_100093653 | 3300002912 | Grasslands Soil | VSALLLLGLAAVLAWSVARESARRRRWREAERLSRCLFAAASLRRYR* |
| JGI25616J43925_103536172 | 3300002917 | Grasslands Soil | VSALVLIGICCAMVWSVGRERARSRRWREAERLSRCLFAAAGLRRYR* |
| soilL2_103001372 | 3300003319 | Sugarcane Root And Bulk Soil | VSALIFAGIVLVMTWSIWREAARRRRWREAERLSRCLFAGARMRRYR* |
| Ga0062594_1013196272 | 3300005093 | Soil | MSALVLIAAIALLAWSVARECARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0066672_102060283 | 3300005167 | Soil | MSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAANLRRYR |
| Ga0066677_100529122 | 3300005171 | Soil | MSALVFIAAIALLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066677_104227723 | 3300005171 | Soil | VSALVLAGVCLVMGWSVAREHGRRRRWREAERLSRALFAAAGMRRYR* |
| Ga0066677_105407843 | 3300005171 | Soil | MTALICIGVTAVMAWSVARESGRRRRWREAERLSRCLFAA |
| Ga0066679_100054445 | 3300005176 | Soil | VSALVFLGVTLVLGWSVLRESARRRRWKEAERLSRCLFVLADLRGK* |
| Ga0066679_105311211 | 3300005176 | Soil | MSALIFCGVALVLAWAVAREGAQRRRWREAERLSRALFAAAGMRGRKWR* |
| Ga0066690_101837842 | 3300005177 | Soil | MSALVLIAAIAILAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066690_102984212 | 3300005177 | Soil | VSALVFLGVTLVLGWSVLRESARRRRWKEAERLSRCLFALADLRGK* |
| Ga0066690_107150391 | 3300005177 | Soil | VMIGICVVMAWSVAREHGRRRRWREAERLSRALFAAAGMRRYR* |
| Ga0066688_104202702 | 3300005178 | Soil | MSAAIFVAVGLALAWAIVHERGRRSRWREAERLSRCLFAAAGMRRRR* |
| Ga0066684_101891392 | 3300005179 | Soil | MTALICIGVTAVMAWSVARESGRRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066684_110552012 | 3300005179 | Soil | MTALVFVAALAVLAWSIAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066678_101446701 | 3300005181 | Soil | AAVSAALLVAVGVLLGWTVAREGKRRWRWRGAERLSRCLFAAAGVRRRSR* |
| Ga0066678_103577532 | 3300005181 | Soil | MSALIFSGIALLLAWSVARENARRRRWREAERLSRCLFAAAGVRRYR* |
| Ga0066671_100171633 | 3300005184 | Soil | MSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAANLRRYR* |
| Ga0066671_102870122 | 3300005184 | Soil | MSGLVFVFIVAVLTWSVVREAARRRRWREAERLSRCLFASARLRRYR* |
| Ga0066671_102943463 | 3300005184 | Soil | MSALIFCGVALALAWSVARENAQRRRWREAERLSRALFAAAGMRRYR* |
| Ga0070680_1010319351 | 3300005336 | Corn Rhizosphere | ADRRRGASVSALVFLAILVALTWSVVREAGRRRRWREAERLSRCLFATAGLRKYR* |
| Ga0070703_102574691 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVLIAAIALLAWSVARECARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0070713_1014480522 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAAILIALGIALGWAVARERGRRRRWREAERLSRCLFAAAGVRRRYR* |
| Ga0070708_1000232504 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALLFIGIAAVLAWSVARDCARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0070708_1001796442 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALLLLGIAAVLVWSVAREAARRRRWREAERLSRCLFASASLRRYR* |
| Ga0070708_1002168283 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALVFIGIVAVLAWSVAKESARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0066686_103316902 | 3300005446 | Soil | MSALLFIAAIAVLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066686_104299752 | 3300005446 | Soil | VSAALLVAVGVLLGWTVAREGKRRWRWRGAERLSRRLFAAAGVRRRSR* |
| Ga0066682_107760672 | 3300005450 | Soil | MSALVFIAAIALLAWSIAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066682_108985682 | 3300005450 | Soil | SALVFIGIVAALGWSLARESARRRRWREAERLSRCLFVAAGMRRYR* |
| Ga0070681_100617392 | 3300005458 | Corn Rhizosphere | VSALVFLAILVALTWSVVREAGRRRRWREAERLSRCLFATAGLRKYR* |
| Ga0070741_100112622 | 3300005529 | Surface Soil | VSALVFLAILVALTWSVVREAGRRRRWREAERLSRCLFATAGLRRYR* |
| Ga0070696_1005179072 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALVLTAAIALLAWSVARECARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0066701_102808601 | 3300005552 | Soil | MSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAADLRRYR* |
| Ga0066707_107946631 | 3300005556 | Soil | VSALVLAGVCLVMGWSVAREHGRRRRWREAERLSRALFAAAGMR |
| Ga0066700_105366043 | 3300005559 | Soil | VSALVLAGVCLVMGWSVAREHGRRRRWREAERLSRALFAAAGMRKYR* |
| Ga0066699_101092793 | 3300005561 | Soil | VSALVFVGVTLVLGWSVLRESARRRRWKEAERLSRCLFALADLRGK* |
| Ga0066693_104349482 | 3300005566 | Soil | FIAAIALLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066702_102815901 | 3300005575 | Soil | MSALVFIAAIALLAWSVAREAARRRRWREAERLSRCLFAAAGMR |
| Ga0075276_101601491 | 3300005898 | Rice Paddy Soil | AVALIAWSVARESARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0066696_101868311 | 3300006032 | Soil | MTAVVFIAAVALLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0070716_1012305762 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGLLFVAIGVVLAWSVAKEAARRRRWREAERLSRCLFAAAVLRRYR* |
| Ga0079222_113488942 | 3300006755 | Agricultural Soil | MTAVVLIALAALLAWPLARDSARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0079222_115426802 | 3300006755 | Agricultural Soil | VSGVLLVAIGVLLGWAVAREGRKRRRSRDAERLSRSLFAAAGLRRRYR* |
| Ga0066665_113011721 | 3300006796 | Soil | VSALLFIAAIAVLAWSVAREAARRRRWREAERLSRCLFAAAGM |
| Ga0079220_101319703 | 3300006806 | Agricultural Soil | MTAAVLVAALSLLAWPLARESARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0075425_1012863012 | 3300006854 | Populus Rhizosphere | MSALLFVGIAAVLAWSVARDCARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0075425_1022717192 | 3300006854 | Populus Rhizosphere | VSAAILVALGIALGWAVARERGRRRRWREAERLSRCLFAAAGLRRRYR* |
| Ga0099791_100246043 | 3300007255 | Vadose Zone Soil | MSALVFIGIVVALAWSLARESARRRRWREAERLSRCLFAAAGMRRKYR* |
| Ga0099791_100418713 | 3300007255 | Vadose Zone Soil | MSALLFVAIGVVLAWSVAKEAARRRRWREAERLSRCLFAAAVLRRYR* |
| Ga0099791_101067501 | 3300007255 | Vadose Zone Soil | MSALLFIGIAAVLAWSVARDCARRRRWREAERLSRCLFA |
| Ga0099791_106090862 | 3300007255 | Vadose Zone Soil | MSALVLLSIVGVLTWSVAKESARRRRWKEAERLSRCLFAAAGLRKYR* |
| Ga0099794_100032844 | 3300007265 | Vadose Zone Soil | MSALVFIGIVAALAWSLARESARRRRWREAERLSRCLFAAARMRRYR* |
| Ga0099794_100184093 | 3300007265 | Vadose Zone Soil | MTAALLVMVGIALGWAVARERGRRRRWREADRLSRSLFAAAGLRRFR* |
| Ga0066710_1034568872 | 3300009012 | Grasslands Soil | VSALVLAGVCLVMGWSVAREHGRRRRWREAERLSRALFAAAGMRRYR |
| Ga0099829_101579284 | 3300009038 | Vadose Zone Soil | MSALIFCGVALVLGWAVAREGAQRRRWREAERLSRALFAAAGMRGRKWR* |
| Ga0099830_101495551 | 3300009088 | Vadose Zone Soil | VTAALLVMVGIALGWAVARERTRRRRWREADRLSRSLFAAAGLRRFR |
| Ga0099830_101542651 | 3300009088 | Vadose Zone Soil | MSALVFIGICGVMAWSIAREGVRRRRWREAERLSRCLFAAAGMKRYR* |
| Ga0099830_104953951 | 3300009088 | Vadose Zone Soil | DRPGGAAVSALVLVSVCLAMGWSVMREHGRRRRWREAERLSRALFAAAGMRRYR* |
| Ga0099830_109666453 | 3300009088 | Vadose Zone Soil | MSALIFSGVALVLGWAVAREGAQRRRWREAERLSRALFAAAGMRGRKWR* |
| Ga0099828_111494722 | 3300009089 | Vadose Zone Soil | MSALVFIGICGVMAWSLAREGVRRRRWREAERLSRCLFAAAGMKRYR* |
| Ga0099827_113923252 | 3300009090 | Vadose Zone Soil | MSALLFIGIAAVLGWSVARDCARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0066709_1000178192 | 3300009137 | Grasslands Soil | VSALVLAGVCLVMGWSVAREHGRRRRWREAERLSRALFAAAGIRRYR* |
| Ga0099792_100143312 | 3300009143 | Vadose Zone Soil | MSALVIVGIVVVLVWSLAREAARRRRWREAERLSRCLFAAAGMRKYR* |
| Ga0099792_102401723 | 3300009143 | Vadose Zone Soil | MSALLFIGIAAVLAWSLARDCARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0099792_108894092 | 3300009143 | Vadose Zone Soil | VSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAADLRRYR* |
| Ga0075423_128720821 | 3300009162 | Populus Rhizosphere | MTPLLFLGIAVALAWSVARECARRRRWREAERLSRCL |
| Ga0126374_105424792 | 3300009792 | Tropical Forest Soil | LSALVFVGIALVLTWSVAKESARRRRWREAERLSRCLFAAARLRKYR* |
| Ga0126374_112156492 | 3300009792 | Tropical Forest Soil | MSALVFIGITAVLAWSVAREHGRRRRWREAERLSRALFAAAGMRRYR* |
| Ga0126384_114811272 | 3300010046 | Tropical Forest Soil | MSALVFVGILLVLAWSVAKESARRRRWREAERLSRCLFAAAGLRKYR* |
| Ga0099796_104259563 | 3300010159 | Vadose Zone Soil | MSALLFIGIAAVLAWSVARDCARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0134071_101746532 | 3300010336 | Grasslands Soil | MSALVFVGIVVALAWSLAREAARRRRWREAERLSRCLFAVAGMRRYR* |
| Ga0134125_123716151 | 3300010371 | Terrestrial Soil | AAMTALFVGIVLLLGWSVARESRRRRRWREADRLSRCLFAAAGMRRYR* |
| Ga0134123_126959522 | 3300010403 | Terrestrial Soil | MSALVFISIGGVLTWSVAREAARRRRWREAERLSRALFAAAGMRRYR* |
| Ga0137389_112708192 | 3300012096 | Vadose Zone Soil | MSALIFLGVTLVLGWSVLRESARRRRWKEAERLSRCLVALADLRGK* |
| Ga0137388_112164623 | 3300012189 | Vadose Zone Soil | MSALIFLGVTLVLGWSVLRESARRRRWKEAERLSR |
| Ga0137363_103931502 | 3300012202 | Vadose Zone Soil | MSALVFVGIVVALAWSLAREAARRRRWREAERLSRCLFAMAGMRRYR* |
| Ga0137399_104704642 | 3300012203 | Vadose Zone Soil | MSALVFIGIVAVLAWSLARESARRRRWREAERLSRCLFAVAGMRRYR* |
| Ga0137362_102711652 | 3300012205 | Vadose Zone Soil | MSALVFVGIAVVLAWSLAREAARRRRWREAERLSRCLFAVAGMRRYR* |
| Ga0137362_113002452 | 3300012205 | Vadose Zone Soil | MSALLFIGIAAVLTWSVARDYARRRRRREAERLSRCLFAAAGLRRYR* |
| Ga0137376_106404881 | 3300012208 | Vadose Zone Soil | VSALLFIAAIAVLAWSVAREAARRRRWREAERLSRCLFAAA |
| Ga0137387_103384141 | 3300012349 | Vadose Zone Soil | VSALLLLGLAAVLAWSVARESARRRRWREAERLSR |
| Ga0137358_109041062 | 3300012582 | Vadose Zone Soil | MSALLFVAIGVMLAWSVAKEAARRRRWREAERLSRCLFAAAVLRRYR* |
| Ga0137398_101671983 | 3300012683 | Vadose Zone Soil | MSALVFVGMVAVLAWSLARESARRRRWREAERLSRCLFAAAGMPKYR* |
| Ga0137398_102879061 | 3300012683 | Vadose Zone Soil | MSALVFIGIVAVLAWSLARESARRRRWREAERLSRCLFAVAGM |
| Ga0137396_100660352 | 3300012918 | Vadose Zone Soil | MSALVFVGIVVALAWSLAREAARRRRWQEAERLSRCLFAVAGMRRYR* |
| Ga0137396_101526611 | 3300012918 | Vadose Zone Soil | VSAALIVGVWIALGWAIARAGRRRRRWREAERLSRCLFAAAGMRRRYR* |
| Ga0137394_100056822 | 3300012922 | Vadose Zone Soil | VTAVLLVMVGVALGWAVARERSRRRRWREADRLSRSLFAAAGLRRFR* |
| Ga0137359_113347461 | 3300012923 | Vadose Zone Soil | TRAARSADRRGGDAVSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAADLRRYR* |
| Ga0137413_112893781 | 3300012924 | Vadose Zone Soil | MSALLFIGIAAVLAWSVARDCARGRRWREAERLSRCLFAAAGLRRYR* |
| Ga0137419_114102891 | 3300012925 | Vadose Zone Soil | MSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAA |
| Ga0137416_104109252 | 3300012927 | Vadose Zone Soil | MSALVIVGIVVVLVWSLAREAARRRRWREAERLSRCLFAAAGMPKYR* |
| Ga0137407_100905661 | 3300012930 | Vadose Zone Soil | ATAAILVALGIALGWAVARERGRRRRWREAERLSRCLFGAAGLRRRYR* |
| Ga0137410_101235692 | 3300012944 | Vadose Zone Soil | MRALVLLSIVGVLTWSVAKESARRRRWKEAERLSRCLFAAAGLRKYR* |
| Ga0134079_102978622 | 3300014166 | Grasslands Soil | MSAMVLIGIVAVLAWSVARESARRRRWREAERLSRCLFAAARLRRYR* |
| Ga0167648_10290682 | 3300015171 | Glacier Forefield Soil | MSALVLIAICSVLAWSAAREGARRRRWREAERLSRCLFAAAGMRRYR* |
| Ga0137418_102212821 | 3300015241 | Vadose Zone Soil | MSALLFIGIAVVLAWSVARDCARRRRWREAERLSRCLFAAAGLRRYR* |
| Ga0137418_110572622 | 3300015241 | Vadose Zone Soil | MSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAADLRPYR* |
| Ga0134072_103427541 | 3300015357 | Grasslands Soil | RRGGDAMSALLLLGIAAVLLWSVARESARRRRWREAERLSRCLFAAANLRRYR* |
| Ga0187765_104828082 | 3300018060 | Tropical Peatland | VTAVLFLAIGLVLGLSVAREAARRRWWREAERLSRCLFATSRMRKYR |
| Ga0184619_100515193 | 3300018061 | Groundwater Sediment | MSALLFIAAIAVLAWSIAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0066662_112829601 | 3300018468 | Grasslands Soil | MSALVFIAAIAVLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0066662_128944432 | 3300018468 | Grasslands Soil | MSAAIFVAVGLALAWAIVHERGRRSRWREAERLSRCLFAAAGMRRRR |
| Ga0066669_100622542 | 3300018482 | Grasslands Soil | MSALVFIGIVAALGWSLARESARRRRWREAERLSRCLFVAAGMRRYR |
| Ga0179594_100478283 | 3300020170 | Vadose Zone Soil | MSALVFVGIVVALAWSLAREAARRRRWREAERLSRCLFAVAGMRRYR |
| Ga0247660_10282552 | 3300024317 | Soil | MSALVLLAAVALLAWSVARECARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0137417_11455792 | 3300024330 | Vadose Zone Soil | MSALVFVGIVVALAWSLAREAARRRRWQEAERLSRCLFAVAGMRRYR |
| Ga0207653_103407321 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVLIAAIALLAWSVARECARRRRWREAERLSRCLFAAAGLRRYR |
| Ga0207645_110045871 | 3300025907 | Miscanthus Rhizosphere | MSALVLIAAIALLAWSVARECARRRRWREAERLSRCLFAAAGLRRYR |
| Ga0207684_101100133 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALLLLGIAAVLVWSVAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0207684_104866191 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALLLLGIAAVLVWSVAREAARRRRWREAERLSRCLFASASLRRYR |
| Ga0207693_106738982 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALLLVAIGVVLAWSVAKEAARRRRWREAERLSRCLFAAAVLRRYR |
| Ga0207665_114644542 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGLLFVAIGVVLAWSVAKEAARRRRWREAERLSRCLFAAAVLRRY |
| Ga0209438_11190822 | 3300026285 | Grasslands Soil | IVGVLTWSVAKESARRRRWKEAERLSRCLFAAAGLRKYR |
| Ga0209153_11075803 | 3300026312 | Soil | MSALVFIAAIALLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0209153_11859632 | 3300026312 | Soil | AGDAVSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAANLRRYR |
| Ga0209153_12762972 | 3300026312 | Soil | MTALICIGVTAVMAWSVARESGRRRRWREAERLSRCLFAAAGMRRYR |
| Ga0209471_100088118 | 3300026318 | Soil | VSALVFLGVTLVLGWSVLRESARRRRWKEAERLSRCLFVLADLRGK |
| Ga0209375_13126272 | 3300026329 | Soil | IAAIALLAWSIAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0209473_10569711 | 3300026330 | Soil | MTAVVFIAAVALLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0209690_10107483 | 3300026524 | Soil | MSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAADLRRYR |
| Ga0209157_12108012 | 3300026537 | Soil | MSALLFIAAIAVLAWSVAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0209474_107183411 | 3300026550 | Soil | VSALLFIAAIAVLAWSVAREAARRRRWREAERLSRCL |
| Ga0209648_100644612 | 3300026551 | Grasslands Soil | VSALVLIGICCAMVWSVGRERARSRRWREAERLSRCLFAAAGLRRYR |
| Ga0179593_10386772 | 3300026555 | Vadose Zone Soil | MSALLFIGIAAVLAWSVARDCARRRRWREAERLSRCLFAAAGLRRYR |
| Ga0209220_11781522 | 3300027587 | Forest Soil | MSALVFIGIVAALAWSLARESARRRRWREAERLSRCLFAVAGMRRYR |
| Ga0209076_10589301 | 3300027643 | Vadose Zone Soil | VSALLLLGIAAVLAWSVARESARRRRWREAERLSRCLFAAAGLRR |
| Ga0209076_11009362 | 3300027643 | Vadose Zone Soil | MSALVIVGIVVVLAWSLAREAARRRRWREAERLSRCLFAAAGMRKYR |
| Ga0209076_11478892 | 3300027643 | Vadose Zone Soil | VSALLLLGIAAVLAWSVARESARRRRWREAERLSRCLFAAADLRRYR |
| Ga0209217_10035315 | 3300027651 | Forest Soil | MSALVFIGIVAVLAWSLAREAARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0209388_11099362 | 3300027655 | Vadose Zone Soil | SALVFIGIVVALAWSLARESARRRRWREAERLSRCLFAAAGMGRKYR |
| Ga0208990_10212334 | 3300027663 | Forest Soil | MSALVIVGIVVVLAWSLAREAARRRRWREAERLSRCLFAVAGMRRYR |
| Ga0209588_10063542 | 3300027671 | Vadose Zone Soil | MSALVFIGIVAALAWSLARESARRRRWREAERLSRCLFAAARMRRYR |
| Ga0209588_10661873 | 3300027671 | Vadose Zone Soil | MTAALLVMVGIALGWAVARERGRRRRWREADRLSRSLFAAAGLRRFR |
| Ga0209011_11681241 | 3300027678 | Forest Soil | SADRRGGAAMSALVFIGIVAALAWSLARESARRRRWREAERLSRCLFAVAGMRRYR |
| Ga0209180_101085643 | 3300027846 | Vadose Zone Soil | MSALIFCGVALVLGWAVAREGAQRRRWREAERLSRALFAAAGMRGRKWR |
| Ga0209283_106469362 | 3300027875 | Vadose Zone Soil | MSALVFIGICGVMAWSLAREGVRRRRWREAERLSRCLFAAAGMKRYR |
| Ga0209590_104246731 | 3300027882 | Vadose Zone Soil | MSALIFCGVALVLGWAVAREGAQRRRWREAERLSRALFAAAG |
| Ga0209488_100183504 | 3300027903 | Vadose Zone Soil | MSALVIVGIVVVLVWSLAREAARRRRWREAERLSRCLFAAAGMRKYR |
| Ga0209488_103722691 | 3300027903 | Vadose Zone Soil | VSALLLLGIAAVLVWSVARESARRRRWREAERLSRCLFAAADLRRYR |
| Ga0209488_104069573 | 3300027903 | Vadose Zone Soil | MSALLFIGIAVVLAWSVARDCARRRRWREAERLSRCLFAAAGLRRYR |
| Ga0209488_111757352 | 3300027903 | Vadose Zone Soil | MSALVLIAAVALLAWSVARESARRRRWREAERLSRCLFAAAGMRRYR |
| Ga0137415_110323222 | 3300028536 | Vadose Zone Soil | MSALLFVAIGVVLAWSVAKEAARRRRWREAERLSRCLFAAAVLRRYR |
| Ga0307469_101953332 | 3300031720 | Hardwood Forest Soil | MSALVLVLIFGILTWSVAKESARRRRWKEAERLSRCLFAASGLRKYR |
| Ga0307468_1025738512 | 3300031740 | Hardwood Forest Soil | MSALVLVLIVGVLAWSVAKESARRRRWKEAERLSRCLFAASGLRKYR |
| Ga0307473_104546331 | 3300031820 | Hardwood Forest Soil | MSALVLLLVVGVLTWSVAKESARRRRWKEAERLSRCLFAAAGLR |
| Ga0308174_104534243 | 3300031939 | Soil | MTAVVLIALVALLAWPLARESARRRRWREAERLSRCLFAAAGLRRYR |
| Ga0318514_107027102 | 3300032066 | Soil | MSALVALGICGALAWSVAKERQRTRRWKEAERLSRCLFAAAGARRSRQGRTWVR |
| Ga0307471_1037497512 | 3300032180 | Hardwood Forest Soil | MSALVLLLIVGVLTWSVAKESARRRRWKEAERLSRCLFAAAGLRKYR |
| Ga0307472_1014397081 | 3300032205 | Hardwood Forest Soil | MSALVLIGVSAVLAWSVAREHGRRRRWREAERLSRALFAAAGMRRYR |
| Ga0335079_100747553 | 3300032783 | Soil | MTALLVGVLLLLGWSVARESRRRRRWREAERLSRCLFAAAGLRRYR |
| Ga0335080_118617672 | 3300032828 | Soil | MSALIAGVVIAMLLGWSVARESRRRRRWREAERLSRCLFAAAGLRRYR |
| ⦗Top⦘ |