


| Basic Information | |
|---|---|
| Family ID | F044043 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 39 residues |
| Representative Sequence | GAWWFGVQLPKIRVEARRLIVAQAMAGGEPAEEMTAPVAED |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.94 % |
| % of genes near scaffold ends (potentially truncated) | 97.42 % |
| % of genes from short scaffolds (< 2000 bps) | 90.97 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.516 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.194 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.742 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF00881 | Nitroreductase | 19.35 |
| PF03807 | F420_oxidored | 7.10 |
| PF13620 | CarboxypepD_reg | 5.81 |
| PF07676 | PD40 | 3.87 |
| PF02163 | Peptidase_M50 | 2.58 |
| PF05977 | MFS_3 | 1.94 |
| PF13649 | Methyltransf_25 | 1.94 |
| PF01558 | POR | 1.29 |
| PF11453 | DUF2950 | 1.29 |
| PF12704 | MacB_PCD | 1.29 |
| PF01520 | Amidase_3 | 0.65 |
| PF00583 | Acetyltransf_1 | 0.65 |
| PF04055 | Radical_SAM | 0.65 |
| PF01475 | FUR | 0.65 |
| PF14417 | MEDS | 0.65 |
| PF01523 | PmbA_TldD | 0.65 |
| PF02775 | TPP_enzyme_C | 0.65 |
| PF00892 | EamA | 0.65 |
| PF10677 | DUF2490 | 0.65 |
| PF02633 | Creatininase | 0.65 |
| PF01609 | DDE_Tnp_1 | 0.65 |
| PF13466 | STAS_2 | 0.65 |
| PF00392 | GntR | 0.65 |
| PF02368 | Big_2 | 0.65 |
| PF01740 | STAS | 0.65 |
| PF01471 | PG_binding_1 | 0.65 |
| PF07843 | DUF1634 | 0.65 |
| PF06029 | AlkA_N | 0.65 |
| PF12483 | GIDE | 0.65 |
| PF01638 | HxlR | 0.65 |
| PF13673 | Acetyltransf_10 | 0.65 |
| PF14534 | DUF4440 | 0.65 |
| PF00082 | Peptidase_S8 | 0.65 |
| PF12762 | DDE_Tnp_IS1595 | 0.65 |
| PF01613 | Flavin_Reduct | 0.65 |
| PF04519 | Bactofilin | 0.65 |
| PF02518 | HATPase_c | 0.65 |
| PF01070 | FMN_dh | 0.65 |
| PF00857 | Isochorismatase | 0.65 |
| PF01797 | Y1_Tnp | 0.65 |
| PF04963 | Sigma54_CBD | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.94 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 1.29 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.65 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.65 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.65 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.65 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.65 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.65 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.65 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.65 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.65 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.65 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.65 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.65 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.65 |
| COG4272 | Uncharacterized membrane protein | Function unknown [S] | 0.65 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.65 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.65 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.52 % |
| Unclassified | root | N/A | 35.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120562291 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300004092|Ga0062389_104191113 | Not Available | 542 | Open in IMG/M |
| 3300005437|Ga0070710_10257778 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300005454|Ga0066687_10366572 | Not Available | 827 | Open in IMG/M |
| 3300005518|Ga0070699_101859544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005529|Ga0070741_10030340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 7593 | Open in IMG/M |
| 3300005533|Ga0070734_10177827 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1229 | Open in IMG/M |
| 3300005534|Ga0070735_10514479 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300005538|Ga0070731_11039013 | Not Available | 542 | Open in IMG/M |
| 3300005541|Ga0070733_10257502 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005541|Ga0070733_10356964 | Not Available | 970 | Open in IMG/M |
| 3300005542|Ga0070732_10413668 | Not Available | 814 | Open in IMG/M |
| 3300005542|Ga0070732_10961233 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005554|Ga0066661_10839976 | Not Available | 537 | Open in IMG/M |
| 3300005555|Ga0066692_10874345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300005598|Ga0066706_11444543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005602|Ga0070762_10473282 | Not Available | 818 | Open in IMG/M |
| 3300005610|Ga0070763_10362531 | Not Available | 808 | Open in IMG/M |
| 3300005610|Ga0070763_10909082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 524 | Open in IMG/M |
| 3300005890|Ga0075285_1009557 | Not Available | 1066 | Open in IMG/M |
| 3300005921|Ga0070766_11215753 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006028|Ga0070717_11736728 | Not Available | 564 | Open in IMG/M |
| 3300006102|Ga0075015_100196195 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300006102|Ga0075015_100779075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300006162|Ga0075030_100719867 | Not Available | 789 | Open in IMG/M |
| 3300006176|Ga0070765_100366267 | Not Available | 1341 | Open in IMG/M |
| 3300006796|Ga0066665_10306904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300006806|Ga0079220_12115961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300006854|Ga0075425_102107233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300009090|Ga0099827_11074931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 698 | Open in IMG/M |
| 3300009143|Ga0099792_10194661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300009174|Ga0105241_12484284 | Not Available | 518 | Open in IMG/M |
| 3300009520|Ga0116214_1149848 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300009644|Ga0116121_1191124 | Not Available | 650 | Open in IMG/M |
| 3300009683|Ga0116224_10378771 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009698|Ga0116216_10012353 | All Organisms → cellular organisms → Bacteria | 5382 | Open in IMG/M |
| 3300009698|Ga0116216_10642596 | Not Available | 638 | Open in IMG/M |
| 3300009764|Ga0116134_1327522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009824|Ga0116219_10074731 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300010048|Ga0126373_11980659 | Not Available | 645 | Open in IMG/M |
| 3300010048|Ga0126373_12397237 | Not Available | 587 | Open in IMG/M |
| 3300010159|Ga0099796_10232435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300010358|Ga0126370_10880380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300010376|Ga0126381_101095557 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300010376|Ga0126381_103879201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300010403|Ga0134123_10205920 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300010937|Ga0137776_1861681 | Not Available | 948 | Open in IMG/M |
| 3300011120|Ga0150983_12377696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300011269|Ga0137392_10471197 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300011269|Ga0137392_11262621 | Not Available | 597 | Open in IMG/M |
| 3300012189|Ga0137388_10447308 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012198|Ga0137364_10327477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300012208|Ga0137376_10962706 | Not Available | 732 | Open in IMG/M |
| 3300012363|Ga0137390_10788781 | Not Available | 908 | Open in IMG/M |
| 3300012923|Ga0137359_11073238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300012988|Ga0164306_11760827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300014489|Ga0182018_10401930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300014489|Ga0182018_10630886 | Not Available | 561 | Open in IMG/M |
| 3300014492|Ga0182013_10352403 | Not Available | 805 | Open in IMG/M |
| 3300014501|Ga0182024_10800493 | Not Available | 1149 | Open in IMG/M |
| 3300014501|Ga0182024_12848744 | Not Available | 514 | Open in IMG/M |
| 3300014654|Ga0181525_10424500 | Not Available | 732 | Open in IMG/M |
| 3300014655|Ga0181516_10325189 | Not Available | 783 | Open in IMG/M |
| 3300015193|Ga0167668_1002794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3760 | Open in IMG/M |
| 3300016404|Ga0182037_10655214 | Not Available | 895 | Open in IMG/M |
| 3300017924|Ga0187820_1250236 | Not Available | 569 | Open in IMG/M |
| 3300017943|Ga0187819_10192146 | Not Available | 1207 | Open in IMG/M |
| 3300017955|Ga0187817_10024312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3631 | Open in IMG/M |
| 3300017975|Ga0187782_10035042 | All Organisms → cellular organisms → Bacteria | 3650 | Open in IMG/M |
| 3300018006|Ga0187804_10119334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300018035|Ga0187875_10255411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300018038|Ga0187855_10024934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3869 | Open in IMG/M |
| 3300018040|Ga0187862_10460618 | Not Available | 771 | Open in IMG/M |
| 3300018043|Ga0187887_10114192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300018058|Ga0187766_10044895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2587 | Open in IMG/M |
| 3300018062|Ga0187784_10474058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1009 | Open in IMG/M |
| 3300018085|Ga0187772_10121444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1704 | Open in IMG/M |
| 3300018088|Ga0187771_10329220 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300018468|Ga0066662_12411988 | Not Available | 553 | Open in IMG/M |
| 3300019278|Ga0187800_1782703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1866 | Open in IMG/M |
| 3300019786|Ga0182025_1260251 | All Organisms → cellular organisms → Bacteria | 4610 | Open in IMG/M |
| 3300020579|Ga0210407_11260333 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300020583|Ga0210401_10694469 | Not Available | 878 | Open in IMG/M |
| 3300020583|Ga0210401_10803553 | Not Available | 800 | Open in IMG/M |
| 3300021046|Ga0215015_10919778 | Not Available | 880 | Open in IMG/M |
| 3300021170|Ga0210400_10640465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300021171|Ga0210405_10320321 | Not Available | 1224 | Open in IMG/M |
| 3300021180|Ga0210396_11749302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300021402|Ga0210385_10655098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300021402|Ga0210385_11241978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300021404|Ga0210389_10410112 | Not Available | 1065 | Open in IMG/M |
| 3300021407|Ga0210383_10334305 | Not Available | 1304 | Open in IMG/M |
| 3300021420|Ga0210394_10649069 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 926 | Open in IMG/M |
| 3300021432|Ga0210384_10406051 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300021433|Ga0210391_10096005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2338 | Open in IMG/M |
| 3300021433|Ga0210391_10195703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
| 3300021433|Ga0210391_10374577 | Not Available | 1117 | Open in IMG/M |
| 3300021474|Ga0210390_10431419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300021474|Ga0210390_11037735 | Not Available | 668 | Open in IMG/M |
| 3300021479|Ga0210410_10555804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300021479|Ga0210410_11769262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300021560|Ga0126371_12056748 | Not Available | 688 | Open in IMG/M |
| 3300022525|Ga0242656_1065553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300025576|Ga0208820_1038770 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300025992|Ga0208775_1003683 | Not Available | 1072 | Open in IMG/M |
| 3300026078|Ga0207702_12305386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300026333|Ga0209158_1067932 | Not Available | 1411 | Open in IMG/M |
| 3300026334|Ga0209377_1275222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300026490|Ga0257153_1102543 | Not Available | 567 | Open in IMG/M |
| 3300026550|Ga0209474_10773549 | Not Available | 502 | Open in IMG/M |
| 3300026998|Ga0208369_1019266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300027070|Ga0208365_1001809 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
| 3300027070|Ga0208365_1035701 | Not Available | 659 | Open in IMG/M |
| 3300027371|Ga0209418_1022689 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300027565|Ga0209219_1045238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
| 3300027568|Ga0208042_1019540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1747 | Open in IMG/M |
| 3300027652|Ga0209007_1050518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1056 | Open in IMG/M |
| 3300027684|Ga0209626_1017507 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300027825|Ga0209039_10302111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027826|Ga0209060_10373534 | Not Available | 649 | Open in IMG/M |
| 3300027842|Ga0209580_10656584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300027854|Ga0209517_10059443 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
| 3300027854|Ga0209517_10245887 | Not Available | 1074 | Open in IMG/M |
| 3300027867|Ga0209167_10069622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1757 | Open in IMG/M |
| 3300027867|Ga0209167_10236165 | Not Available | 979 | Open in IMG/M |
| 3300027903|Ga0209488_10405894 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300027905|Ga0209415_10943439 | Not Available | 581 | Open in IMG/M |
| 3300027905|Ga0209415_11141961 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027911|Ga0209698_10628156 | Not Available | 823 | Open in IMG/M |
| 3300027911|Ga0209698_10703359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300028017|Ga0265356_1000979 | All Organisms → cellular organisms → Bacteria | 4552 | Open in IMG/M |
| 3300028780|Ga0302225_10481007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 580 | Open in IMG/M |
| 3300028885|Ga0307304_10295566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300028906|Ga0308309_10634287 | Not Available | 928 | Open in IMG/M |
| 3300028906|Ga0308309_10814219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300029914|Ga0311359_10244680 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300030011|Ga0302270_10419850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300030399|Ga0311353_10250357 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300030399|Ga0311353_10700471 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300030494|Ga0310037_10282799 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300030659|Ga0316363_10073656 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300031234|Ga0302325_10073357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6602 | Open in IMG/M |
| 3300031708|Ga0310686_109586768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300031718|Ga0307474_11577957 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031754|Ga0307475_10011057 | All Organisms → cellular organisms → Bacteria | 6006 | Open in IMG/M |
| 3300031754|Ga0307475_10141074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1909 | Open in IMG/M |
| 3300031946|Ga0310910_11184860 | Not Available | 593 | Open in IMG/M |
| 3300031996|Ga0308176_11386983 | Not Available | 747 | Open in IMG/M |
| 3300032074|Ga0308173_10921237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300032143|Ga0315292_10852810 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300032160|Ga0311301_11070456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300032180|Ga0307471_100911858 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300032515|Ga0348332_12866811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300032515|Ga0348332_13136723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300032770|Ga0335085_11632845 | Not Available | 666 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.39% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.58% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.94% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.29% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.29% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.29% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.29% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.29% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.65% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.65% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1205622912 | 3300002568 | Soil | GGAWWFGMKLPKIRGEARRLIMAQGMEGGAPAEEMSTPVVED* |
| Ga0062389_1041911131 | 3300004092 | Bog Forest Soil | VMGAWWFGAQLPKIRAEARQLIIAQSMAGGEPAEEMTTRVAEE* |
| Ga0070710_102577781 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GAWWFGTKLPKIRGEARRLIMAQGMQGGAPAEQMSTPVVED* |
| Ga0066687_103665721 | 3300005454 | Soil | SIIGAWWFGLQLPKIRGEARRLILAQAMAGGAPAEEMSTPVVQD* |
| Ga0070699_1018595441 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GAILFGNYLPKVRVEARRLIVAQEAAGGEPAVEMTAPIVEE* |
| Ga0070741_100303408 | 3300005529 | Surface Soil | RQLPKIRVEARRLIVAQAMAGGEPAEEMTARLVD* |
| Ga0070734_101778272 | 3300005533 | Surface Soil | WWFSIQLPKIRVEARKLIIAQSMAGGEPAEEMTKPVGEE* |
| Ga0070735_105144792 | 3300005534 | Surface Soil | VAGACWFGLQLPKIRVEARRLIVAQAVAGGEPSEMTAQAVED* |
| Ga0070731_110390131 | 3300005538 | Surface Soil | GLASVAGAWWFGVQLPKIRGEARKLILAQAMAGGEPAEEMSTPVVED* |
| Ga0070733_102575021 | 3300005541 | Surface Soil | AWWFAVQLPKIRVEARQLIMAQAMAGGGPAEEMSAPVAEE* |
| Ga0070733_103569642 | 3300005541 | Surface Soil | GLQLPRIRVEARQLIVAQGLTAGAPPEEMTAAVVDD* |
| Ga0070732_104136681 | 3300005542 | Surface Soil | WWFGVQLPKIRVEARQLIVAQAMAGGDPAEEMTAHVVED* |
| Ga0070732_109612332 | 3300005542 | Surface Soil | ALFWLRLPAFRVEARRLIVAQAVAGGDPPEEMTARVVEDE* |
| Ga0066661_108399763 | 3300005554 | Soil | SVQLPKIRVEARQLIVAQAMAGGEPSEEMTAPVVED* |
| Ga0066692_108743451 | 3300005555 | Soil | IRLPSLRVEGKQLILAQAMAGGEPSEEMTARVVD* |
| Ga0066706_114445431 | 3300005598 | Soil | GLRLPKIRGEARQLIIAQGMVGGEPVQEMTARVVEE* |
| Ga0070762_104732822 | 3300005602 | Soil | VASVAGAAWFGLQLPKIRVEARRLIVAQAAAGGEPSEMTAQAIED* |
| Ga0070763_103625312 | 3300005610 | Soil | GAWWFGVQLPKIRVEARRLIVAQAMAGGEPAEEMTAPVAED* |
| Ga0070763_109090822 | 3300005610 | Soil | CGAWWFSTQLPKIRIEARQLIMAQGMVGGEPSEQMTARVVED* |
| Ga0075285_10095571 | 3300005890 | Rice Paddy Soil | IASIAGAWWFGVQLPKIRGEARRLIQAQAMAGGAPAEGMSTPVVED* |
| Ga0070766_112157532 | 3300005921 | Soil | WFGLQLPKIRVEARRLMVAQAVVGGEPSEMTAQAVED* |
| Ga0070717_117367282 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VFGAWWFSIQLPKVRAEARKLIIAQAMAGGEPAEEMTNPIPED* |
| Ga0075015_1001961951 | 3300006102 | Watersheds | WWFSLQLPKIRAEARQLIMAQAMAGGEPAEEMMTPVVED* |
| Ga0075015_1007790751 | 3300006102 | Watersheds | LFGLQLPKIRVEARQLIIAQGMTAGAPPEEMTTRVAED* |
| Ga0075030_1007198671 | 3300006162 | Watersheds | AQLPKIRGEARRLIVAQNMAGGQPAEEMSTPVAEE* |
| Ga0070765_1003662671 | 3300006176 | Soil | GATLFGLQLPKIRVEARQLIVAQGLTAGAPPEEMSAGVVED* |
| Ga0066665_103069042 | 3300006796 | Soil | IFGLRLPKIRGEARQLIIAQGMVGGEPVQEMTTEVVEE* |
| Ga0079220_121159612 | 3300006806 | Agricultural Soil | GVQLPKIRVEARRLIVAQAMAGGEPAEEMSTPVVEE* |
| Ga0075425_1021072331 | 3300006854 | Populus Rhizosphere | FGIRLPKLRVEARRLIVAQGMVGGEPAQEMTARVVED* |
| Ga0099827_110749311 | 3300009090 | Vadose Zone Soil | WWFSVQLPKIRVEARQLIVAQAMAGGGPSEEMTAPVVED* |
| Ga0099792_101946612 | 3300009143 | Vadose Zone Soil | MGAWWFALQLPKIRVEARQLIMAQAAAGGEPAEMTAAVAED* |
| Ga0105241_124842842 | 3300009174 | Corn Rhizosphere | GGAWWFGTKLPKIRGEARRLIMAQGMQGGAPAEQMSTPVVED* |
| Ga0116214_11498482 | 3300009520 | Peatlands Soil | FGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVED* |
| Ga0116121_11911242 | 3300009644 | Peatland | GIGGMASVAGAAWFWAQLPKIRLEARRLMVAQAIAGGEPSEMTAQAVED* |
| Ga0116224_103787711 | 3300009683 | Peatlands Soil | ALFGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVED* |
| Ga0116216_100123531 | 3300009698 | Peatlands Soil | GLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVQD* |
| Ga0116216_106425961 | 3300009698 | Peatlands Soil | AAQLPKIRVEARRLIVAQAMAGGEPAEEMSAPVVEE* |
| Ga0116134_13275221 | 3300009764 | Peatland | WWFSVQLPKIRVEARKLIIAQAMAGGEPSEEMTAPVAED* |
| Ga0116219_100747315 | 3300009824 | Peatlands Soil | GWFAMHLPKIRVEARKLILAQQMAGGEPAAGVTAPVGED* |
| Ga0126373_119806592 | 3300010048 | Tropical Forest Soil | WFNAHLPKVRAEARKLIIAQAMAGGEPAEEMSNPIPED* |
| Ga0126373_123972371 | 3300010048 | Tropical Forest Soil | SVQLPKVRAEARKLIIAQTMVAGEPAQAMSTPVVED* |
| Ga0099796_102324352 | 3300010159 | Vadose Zone Soil | ACWFGLQLPKIRVEARRLIVAQAVGGGEPSEMTTQAVDD* |
| Ga0126370_108803801 | 3300010358 | Tropical Forest Soil | ISGAILFGTYLPKVRVEARRLIVAQEAAGGEPAVEVTAPITEE* |
| Ga0126381_1010955572 | 3300010376 | Tropical Forest Soil | GLAAVAGAWWFGVQLPKIRGEARRLILAQAMTGGEPAEEMSTPVVEE* |
| Ga0126381_1038792011 | 3300010376 | Tropical Forest Soil | RFLRHLPKIRVEARRLMVAQAAAGGEPAVEMTSRLNDD* |
| Ga0134123_102059201 | 3300010403 | Terrestrial Soil | GLNLPKIRTEARQLIIAQSVAGGEPSEETSSASVLAAKQ* |
| Ga0137776_18616812 | 3300010937 | Sediment | ALQLPKIRVEARQLIIAQSMAGGEPSEEMSAPVAEE* |
| Ga0150983_123776962 | 3300011120 | Forest Soil | AGWFRLQLPKIRVEARRLIVAQAVAGGEPSEMTAQAVED* |
| Ga0137392_104711972 | 3300011269 | Vadose Zone Soil | CIGAAVLFGMRLPSLQVEGRQLILAQAVAGGEPSEEMTARVVD* |
| Ga0137392_112626212 | 3300011269 | Vadose Zone Soil | LFGIRLPSLRVEGKQLILAQAMAGGEPSEEMTARVVD* |
| Ga0137388_104473081 | 3300012189 | Vadose Zone Soil | FGLQLPKIRVEARRLIVAQAAAGGEPSEMTTQAVED* |
| Ga0137364_103274772 | 3300012198 | Vadose Zone Soil | GIHLPKVRVEARRLIVAQEAAGGEPAVEITASIVEE* |
| Ga0137376_109627061 | 3300012208 | Vadose Zone Soil | SQQLPKVRAEARQLIMAQAMAPGEPAEEMTTPVVEVKED* |
| Ga0137390_107887812 | 3300012363 | Vadose Zone Soil | VAGACWFGLQLPKIRVEARLLIVAQAVGGGEPSEMTTQVVED* |
| Ga0137359_110732381 | 3300012923 | Vadose Zone Soil | HLPKIRVEGRRLIVAQEVAGGEPSVEMTARVVED* |
| Ga0164306_117608272 | 3300012988 | Soil | ACMGAAVLFFFHLPKIRVEARQLILAQDVAGREPPVEMTARGVEDN* |
| Ga0182018_104019302 | 3300014489 | Palsa | AGWFARHLPKIRVEARRLIVAQAAGGGEPSEMTAQAVED* |
| Ga0182018_106308861 | 3300014489 | Palsa | LHLPKIRVEARRLIVAQAAAGGEPSEMTAQAVED* |
| Ga0182013_103524031 | 3300014492 | Bog | TFYRYLPKIRVEARQLIVEQTAISGEPPQEMTARVVKD* |
| Ga0182024_108004932 | 3300014501 | Permafrost | GLQLPKIRVEGRQLIIAQGMTGGAPAEEMTARVVED* |
| Ga0182024_128487442 | 3300014501 | Permafrost | AWWFGAQLPKIRVEARKLIIAQAMAGGEPSEEMTAPVAEE* |
| Ga0181525_104245001 | 3300014654 | Bog | FGLQLPKICVEARRLMVAQAVVGGEPSEEMSAQAVED* |
| Ga0181516_103251891 | 3300014655 | Bog | WWFSVQLPKIRVEARQLIIAQAMAGGEPAEEMTTPV* |
| Ga0167668_10027941 | 3300015193 | Glacier Forefield Soil | HLPKIREEARQLILAQEVAGGEPSGEMTARVVEDN* |
| Ga0182037_106552142 | 3300016404 | Soil | WFSLQLPKVRAEARQLILAQAMAPGEPAEEVTTPVVED |
| Ga0187820_12502361 | 3300017924 | Freshwater Sediment | FGLQLPKIRVEARQLIIAQGMTAGAPPEEMTTRVVED |
| Ga0187819_101921463 | 3300017943 | Freshwater Sediment | GLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVDD |
| Ga0187817_100243121 | 3300017955 | Freshwater Sediment | LQLPKIRVEARQLIIAQGMTAGAPPEEMTTRVVED |
| Ga0187782_100350421 | 3300017975 | Tropical Peatland | MGAVWFGMQLPQIRVEARKLILAQQMAGGEPAAGVTAPVAEK |
| Ga0187804_101193343 | 3300018006 | Freshwater Sediment | FWLQLPKIRIEARRLIVAQAMAGGDPAEEMTARVVED |
| Ga0187875_102554111 | 3300018035 | Peatland | MGAWWFARQLPKIRAEARQLIIAQSMAGGEPSEEMTAPVADD |
| Ga0187855_100249342 | 3300018038 | Peatland | GACWFGLQLPKIRVEARRLIVAQNVAGGEPSEMTAQAVED |
| Ga0187862_104606181 | 3300018040 | Peatland | LQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVED |
| Ga0187887_101141923 | 3300018043 | Peatland | AVQLPKIRVEARQLIIAQSMAGGEPSEEMTAPVAEE |
| Ga0187766_100448954 | 3300018058 | Tropical Peatland | WFWAHWPKIRVEARQLIVAQAMTGGEPAENMTSRVVED |
| Ga0187784_104740581 | 3300018062 | Tropical Peatland | LAGAGWFALHLPKIRIEARRLIVAQHVAGGEPVEMTTQPVKE |
| Ga0187772_101214442 | 3300018085 | Tropical Peatland | GMHLPKIRVEARRLIMAQQMAGGEPASGVTTGTVED |
| Ga0187771_103292202 | 3300018088 | Tropical Peatland | GGIWFATHLPKIRVEARRLILAQQMAGGAPAEGVTAVPED |
| Ga0066662_124119882 | 3300018468 | Grasslands Soil | WWFGMQLPKIRGEARRLIIAQNMAGGQPSEEMSTPVAED |
| Ga0187800_17827032 | 3300019278 | Peatland | ACWFGLQLPKIRIEARRLIVAQAVAGGEPSEMTTQMVEE |
| Ga0182025_12602517 | 3300019786 | Permafrost | VAGAAWFWFQLPKIRVEARRLIVAQAAAGGEPAEMSAQAVED |
| Ga0210407_112603332 | 3300020579 | Soil | MGAWWFSVQLPKIRVEARRLIVAQAMAGGEPSEEMTGPVAEE |
| Ga0210401_106944691 | 3300020583 | Soil | WFGLQLPKIRVEARRLIVAQAAAGGEPPEMTVQAVEE |
| Ga0210401_108035532 | 3300020583 | Soil | CLGGATLFGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVDE |
| Ga0215015_109197783 | 3300021046 | Soil | VWFGLHLPKIRVEERQLIVAQAMAGGEPAEEMTTPVVDE |
| Ga0210400_106404651 | 3300021170 | Soil | GAWWFGVQFPKVRGEAIKLIVAQQMAGGEPAEEMTVPVVKN |
| Ga0210405_103203213 | 3300021171 | Soil | TLFGLQLPKIRMEARQLIVAQGLTAGAPPEEMIARVVED |
| Ga0210396_117493021 | 3300021180 | Soil | LGGAVSVLGAVWFGMQLPQIRGEARKLIMAQQMAGGEPSAGVTGPVEEK |
| Ga0210385_106550981 | 3300021402 | Soil | VWFRFQLPKIRVEARRLIVAQAAAGGEPAEMTSQTVEGDA |
| Ga0210385_112419781 | 3300021402 | Soil | SVMGAWWFAVQLPKIRVEARQLIMAQAMAGGGPAEEMSAPVAEK |
| Ga0210389_104101121 | 3300021404 | Soil | LQLPKIRVEARQLIVAQGMTAGAPPEEMTARVVED |
| Ga0210383_103343052 | 3300021407 | Soil | ALFGLQLPKIRLEARQLIVAQGMAAGQPPEEMTARVAED |
| Ga0210394_106490691 | 3300021420 | Soil | SAQLPKIRVEARRLIIAQSMAGGEPSEEMTAPVGEE |
| Ga0210384_104060511 | 3300021432 | Soil | IGGLASFAGACWFGVQLPKIRVEARRLIVAQAAGSEPPEMTVQAVGD |
| Ga0210391_100960051 | 3300021433 | Soil | FGLQLPKIRVEARQLIVAQGMTAGSPPEEMTAGVVED |
| Ga0210391_101957033 | 3300021433 | Soil | GGAALFGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVED |
| Ga0210391_103745773 | 3300021433 | Soil | VLGAGWFWLQLPKIRVEARRLIFAQNMAGGEPTDMTAQAVED |
| Ga0210390_104314191 | 3300021474 | Soil | ISFFYHLPKIRIEARRLIVAQAIAGGEPSAEMTARVVED |
| Ga0210390_110377352 | 3300021474 | Soil | GLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVDE |
| Ga0210410_105558041 | 3300021479 | Soil | AWWFAVQLPKIRVEARQLIMAQAMAGGGPAEEMSAPVAEK |
| Ga0210410_117692622 | 3300021479 | Soil | ASIVGACWFGLQLPKIRVEARRLIVAQAAAGGEPPEMTVQAVED |
| Ga0126371_120567481 | 3300021560 | Tropical Forest Soil | WFNAHLPKVRAEARKLIIAQAMAGGEPAEEMTPPVAED |
| Ga0242656_10655531 | 3300022525 | Soil | VMGAWWFAVQLPKIRVEARQLIMAQAMAGGGPAEEMSAPVAEK |
| Ga0208820_10387701 | 3300025576 | Peatland | FGMYLPRIRVEARRLILAQQMTGGEPAAGVTARMGEE |
| Ga0208775_10036831 | 3300025992 | Rice Paddy Soil | GGIASIAGAWWFGVQLPKIRGEARRLIQAQAMAGGAPAEGMSTPVVED |
| Ga0207702_123053861 | 3300026078 | Corn Rhizosphere | FHLPKIRVEARQLIFAQEVAGGEPSVEMTARVVED |
| Ga0209158_10679321 | 3300026333 | Soil | ASLAGAWWFSVQLPKIRVEARQLIVAQAMSGGGPSQEMTAPLVED |
| Ga0209377_12752221 | 3300026334 | Soil | GIRLPSLRVEGKQLILAQAMAGGEPSEEMTARVVD |
| Ga0257153_11025431 | 3300026490 | Soil | IFGLHLPRIRDEARRLIVAQQMVGGEPASEMTVRVVED |
| Ga0209474_107735491 | 3300026550 | Soil | FGMKLPKIRGEARRLMMAQGMEGGAPAEEMSTPVVED |
| Ga0208369_10192662 | 3300026998 | Forest Soil | GKQLPVFRGEARQLIIAQAMAGGEPAEEMTARVVQ |
| Ga0208365_10018093 | 3300027070 | Forest Soil | GAGWFALQLPKIRVEARRLIVAQAAGGGEPAEMTVQAVED |
| Ga0208365_10357012 | 3300027070 | Forest Soil | GGAALFGLQLPKIRVEARQLIVAQGMAGAPPEEMTARVVED |
| Ga0209418_10226892 | 3300027371 | Forest Soil | SIQLPKVRAEARQLIIAQAMAGGQPAEGMTTPIVED |
| Ga0209219_10452381 | 3300027565 | Forest Soil | ALFGLQLPKIRVEGRQLIIAQSMAAGAPAEEMTAGVVED |
| Ga0208042_10195401 | 3300027568 | Peatlands Soil | MHLPKIRVEARKLILAQQMAGGEPAAGVTAPVGED |
| Ga0209007_10505183 | 3300027652 | Forest Soil | AWWFGVQLPKIRVEARRLIVAQAMAGGEPAEEMTGPVAED |
| Ga0209626_10175072 | 3300027684 | Forest Soil | GLQLPKIRVEARKLIIAQAMAGGEPSEEMTAPVVEE |
| Ga0209039_103021112 | 3300027825 | Bog Forest Soil | FGLQLPKIRVEARRLIVAQAVAGGEPSEMTAQVVED |
| Ga0209060_103735342 | 3300027826 | Surface Soil | AWWFGVQLPKIRGEARKLIMAQAMAGGEPAEEMSTPVVED |
| Ga0209580_106565842 | 3300027842 | Surface Soil | GAWWFGMQLPKIRAEARQLIVAQAMAGGEPAEEMNTPLGDE |
| Ga0209517_100594431 | 3300027854 | Peatlands Soil | AGRFAMHLPKIRVEARKLILAQQMAGGEPAAGVTAPVGED |
| Ga0209517_102458871 | 3300027854 | Peatlands Soil | LFGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVDE |
| Ga0209167_100696221 | 3300027867 | Surface Soil | LGAWWFAAQLPKIRVEARQLIMAQAMATGGPAEEMSAPVAED |
| Ga0209167_102361651 | 3300027867 | Surface Soil | AALFGLQLPRIRVEARQLIVAQGLTAGAPPEEMTAAVVDD |
| Ga0209488_104058942 | 3300027903 | Vadose Zone Soil | MGAWWFALQLPKIRVEARQLIMAQAAAGGEPAEMTAAVAED |
| Ga0209415_109434392 | 3300027905 | Peatlands Soil | SVQLPKVRAEARKLIIAQAMAGGEPAEEMTKPLTED |
| Ga0209415_111419611 | 3300027905 | Peatlands Soil | FGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVED |
| Ga0209698_106281561 | 3300027911 | Watersheds | VLFFFHLPKIRVEARQLIVAQEVAGGEPSLEMTARVVED |
| Ga0209698_107033591 | 3300027911 | Watersheds | FGMQLPKIRAEARQLIVAQAMAGGEPAEEMNTPVRDG |
| Ga0265356_10009796 | 3300028017 | Rhizosphere | WFGVQLPKIRVEARRLIVAQAMAGGEPAEEMTAPVAEES |
| Ga0302225_104810072 | 3300028780 | Palsa | AVQLPKIRVEARQLIVAQSMAGGEPSEEMTAPVAED |
| Ga0307304_102955661 | 3300028885 | Soil | GGAIWFGLTLPKVRVEARRLIVAQSMAGGEPAEDLTARIAE |
| Ga0308309_106342871 | 3300028906 | Soil | AAWFAMHLPKIRVEARQLIMAQAMAGGEPAEEMTARIRET |
| Ga0308309_108142191 | 3300028906 | Soil | IAGACWFGLQLPKIRVEARRLILAQEVAGGEPSDMMAQAVED |
| Ga0311359_102446802 | 3300029914 | Bog | GGVASVAGACWFGLQLPKIRVEARRLIVAQASAAGEPPEMAAQAVED |
| Ga0302270_104198503 | 3300030011 | Bog | GWFARHLPKIRVEARRLIVAQAAGGGEPAEMTAQAVED |
| Ga0311353_102503571 | 3300030399 | Palsa | FARHLPKIRVEARRLIVAQAAGGGEPSEMTAQAVED |
| Ga0311353_107004711 | 3300030399 | Palsa | FSTQLPKIRIEARQLIIAQSMSGGAPAEQMSARVVD |
| Ga0310037_102827991 | 3300030494 | Peatlands Soil | FGLQLPKIRVEARQLIIAQGMTAGAPPEEMTARVVQD |
| Ga0316363_100736564 | 3300030659 | Peatlands Soil | AGAGRFAMHLPKIRVEARKLILAQQMAGGEPAAGVTAPVGED |
| Ga0302325_100733571 | 3300031234 | Palsa | AGWFARHLPKIRVEARRLIVAQAAGGGEPSEMTAQAVED |
| Ga0310686_1095867682 | 3300031708 | Soil | WFAVQLPKIRVEARQLIVAQSMAGGEPSEEMTAPVAEE |
| Ga0307474_115779571 | 3300031718 | Hardwood Forest Soil | WWFAVQLPKIRVEARRLIMAQAAAGGEPAEMTAAVAED |
| Ga0307475_100110574 | 3300031754 | Hardwood Forest Soil | AGWFGLQLPKIRVEARRLIVAQAVAGGEPSEMTTQAVED |
| Ga0307475_101410741 | 3300031754 | Hardwood Forest Soil | GAWWFSLQLPKIRAEARQLIVAQAMAGGEPAEEMTTRLVDE |
| Ga0310910_111848602 | 3300031946 | Soil | SAQLPKIRVEARRLIMAQSMAGAEPAGEMPNPVPEE |
| Ga0308176_113869831 | 3300031996 | Soil | IAGAWWFGMKLPKIRGEARRLILAQGMEGGAPAEEMSTPVVED |
| Ga0308173_109212372 | 3300032074 | Soil | AWFLRHLPKIRVEARRLIVAQAIAGGEPSVEMTSRLDDD |
| Ga0315292_108528101 | 3300032143 | Sediment | MGGAVWFGLSLPTFRVEARRLIVAQAVAGGEPSEEMTADLVEE |
| Ga0311301_110704561 | 3300032160 | Peatlands Soil | AAQLPKIRVEARRLIVAQAMAGGEPAEEMSAPVVEE |
| Ga0307471_1009118581 | 3300032180 | Hardwood Forest Soil | SVLGAWWFSKQLPKVRAEARRLIMAHAMAAGEPAEEMTTPLAED |
| Ga0348332_128668111 | 3300032515 | Plant Litter | AGAAWFWAQLPKIRVEARRLIVAQAAAGGEPSEMVTQAVED |
| Ga0348332_131367231 | 3300032515 | Plant Litter | AWWFAVQLPKIRVEARQLIVAQSMAGGEPSEEMTAPVAEE |
| Ga0335085_116328451 | 3300032770 | Soil | SLQLPKVRAEARRLIIAQAMAGGEPAEEMTNPIPED |
| ⦗Top⦘ |